>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily. Rheb was initially identified in rat brain, where its expression is elevated by seizures or by long-term potentiation. It is expressed ubiquitously, with elevated levels in muscle and brain. Rheb functions as an important mediator between the tuberous sclerosis complex proteins, TSC1 and TSC2, and the mammalian target of rapamycin (TOR) kinase to stimulate cell growth. TOR kinase regulates cell growth by controlling nutrient availability, growth factors, and the energy status of the cell. TSC1 and TSC2 form a dimeric complex that has tumor suppressor activity, and TSC2 is a GTPase activating protein (GAP) for Rheb. The TSC1/TSC2 complex inhibits the activation of TOR kinase through Rheb. Rheb has also been shown to induce the formation of large cytoplasmic vacuoles in a process that is dependent on the GTPase cycle of Rheb, but independent of the TOR kinase, suggesting Rheb plays a role in endocytic trafficking that le

Probab=92.17 E-value=0.84 Score=24.09 Aligned_cols=119 Identities=13% Similarity=0.117 Sum_probs=72.3 Q ss_pred CCCEEEECCCCC--CCHHHHHHHHHCCCCCCCCCC-CHHHHHHHHHHHHHHHH-CCCCCCCCEEEEECCCCCCCCHHHHH Q ss_conf 288899738888--898999998620125435787-76889999999999998-19876753899956589875200599 Q gi|254780725|r 274 IFPLVILDVPHV--WNSWTQEVLTLSDKVVITTSL-DLAGLRNSKNLIDVLKK-LRPADKPPYLVLNQVKTPKKPEISIS 349 (427) Q Consensus 274 ~yd~VIiD~p~~--~~~~~~~~L~~AD~vviV~~p-~~~slr~a~~ll~~l~~-~~~~~~~~~iVlNr~~~~~~~~i~~~ 349 (427) T Consensus 48 ~~~l~iwDtaG~e~~~~~~~~~~~~a~~~ilvydvt~~~Sf~~~~~~~~~~~~~~~~~~~piilVgNK~DL~~~r~V~~~ 127 (180) T cd04137 48 DYHLEIVDTAGQDEYSILPQKYSIGIHGYILVYSVTSRKSFEVVKVIYDKILDMLGKESVPIVLVGNKSDLHTQRQVSTE 127 (180) T ss_pred EEEEEEEECCCCCCCCHHHHHHHHHCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCHHHCCCCHH T ss_conf 99999998998701006679998635578999743887889999999999999758888867977653462440788999 Q ss_pred HHHHHHCCCEEEEECCCHHHHHHHHHCCCCEEEECCCC--HHHHHHHHHHHHHHCCCCCCCCC Q ss_conf 99998489537990687999999884796189888999--89999999999985221223211 Q gi|254780725|r 350 DFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKS--AIANLLVDFSRVLMGRVTVSKPQ 410 (427) Q Consensus 350 ~~~~~lg~~~~~~IP~D~~~~~~A~~~G~pi~e~~p~s--~~a~~~~~La~~i~gr~~~~~~k 410 (427) T Consensus 128 e~----------------~--~~a~~~~~~f~EtSAk~g~nV~e~F~~l~~~i~k~~~~~~~~ 172 (180) T cd04137 128 EG----------------K--ELAESWGAAFLESSARENENVEEAFELLIEEIEKVENPLDPG 172 (180) T ss_pred HH----------------H--HHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCC T ss_conf 99----------------9--999983998999776889198999999999998863899999

HHsearch alignment for GI: 254780725 and conserved domain: cd04137