RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780725|ref|YP_003065138.1| response regulator receiver protein [Candidatus Liberibacter asiaticus str. psy62] (427 letters) >gnl|CDD|34570 COG4963, CpaE, Flp pilus assembly protein, ATPase CpaE [Intracellular trafficking and secretion]. Length = 366 Score = 228 bits (583), Expect = 2e-60 Identities = 110/286 (38%), Positives = 166/286 (58%), Gaps = 7/286 (2%) Query: 123 ALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNC 182 A I N V D ++ S + ++G+ ++F+G++GGVG+ST+AHN Sbjct: 71 ADIKNIKENLAAIRAGVNDCVDIESDSISIAQQGR-----ELAFLGAKGGVGTSTLAHNL 125 Query: 183 AFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAE 242 A +A + LL DLDL GTA + D+DP I++A+ R+D+ + L A Sbjct: 126 AKGLAILSGAAVLLVDLDLQGGTAALYLDQDPAFGIAEAVKQPERLDQVLLDSLLTRLAS 185 Query: 243 NLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVI 302 L +L AP L++ YD + +LD+L F V++D+P++W WT++VL+ SD++VI Sbjct: 186 GLKLLAAPTELAKNYDLKTGAVERLLDLLRGSFDFVVVDLPNIWTDWTRQVLSGSDEIVI 245 Query: 303 TTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAI 362 LA LRN+K L+D LK+LRP D P LVLN+V PK+PE SD LGI + Sbjct: 246 VAEPSLASLRNAKELLDELKRLRPNDPKPILVLNRVGVPKRPE--PSDLEEILGIESLLV 303 Query: 363 IPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSK 408 +PFD A+FG +AN+G+M+ EVDP S A L ++ L GR++ + Sbjct: 304 LPFDPALFGDAANNGRMLSEVDPGSPAAKALAQLAQSLGGRISGER 349 >gnl|CDD|30803 COG0455, COG0455, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning]. Length = 262 Score = 72.2 bits (177), Expect = 2e-13 Identities = 57/263 (21%), Positives = 111/263 (42%), Gaps = 7/263 (2%) Query: 163 SISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFD-KDPINSISDA 221 I+ + +GGVG +TI N ++A++ LL D DL G ++ + ++ D Sbjct: 4 VIAVVSGKGGVGKTTITANLGAALAALGGKVVLLIDADLGLGNLSLLLGVESKPTTLHDV 63 Query: 222 IYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILD 281 + I+ P L +L + L D + + V+ LE+++ +++D Sbjct: 64 LAGEASIEDIIY-ETPQD---GLYVLPGGSGLEDLAKLDPEDLEDVIKELEELYDYILID 119 Query: 282 VPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTP 341 + T + SD++VI T+ + + ++ I +L KL +VLN+V++ Sbjct: 120 TGAGLSRDTLSFILSSDELVIVTTPEPTSITDAYKTIKILSKLGLDLLGRRVVLNRVRST 179 Query: 342 K-KPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVL 400 K +++ + +IPFD V + GK I P S + + + + L Sbjct: 180 KEGVDVAALLIQVVKQVPVLQVIPFDPEV-RRALAEGKPIVLYSPNSKASQAIKELAAKL 238 Query: 401 MGRVTVSKPQSAMYTKIKKIFNM 423 G P+ +KIK++ Sbjct: 239 AGLPEPKAPRRGFISKIKRLLKR 261 >gnl|CDD|31385 COG1192, Soj, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning]. Length = 259 Score = 57.9 bits (139), Expect = 5e-09 Identities = 57/240 (23%), Positives = 96/240 (40%), Gaps = 17/240 (7%) Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDP-INSISDAI 222 I+ +GGVG +T A N A ++A + LL DLD P G+ P + + Sbjct: 5 IAVANQKGGVGKTTTAVNLAAALAKRGGKKVLLIDLD-PQGSLTSWLGLRPDLEGDLYNL 63 Query: 223 YPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFD------EKMIVPVLDILEQIFP 276 + + V E L ++ + L+ + + E ++ +LD ++ + Sbjct: 64 LSGLKERPDILDYTVVI--EGLDLIPSNIDLAEGAEIELNAVAKELLLKRLLDPVKDDYD 121 Query: 277 LVILDVPHVWNSWTQEVLTLSDKVVI---TTSLDLAGLRNSKNLIDVLKKLRPADKPPY- 332 +I+D P T L +D V+I LDL GL N ++ L KLR Sbjct: 122 YIIIDTPPSLGVLTLNALAAADHVLIPVQPEFLDLEGLEQLLNTLEDLLKLRRNKLIVVG 181 Query: 333 LVLNQVKTPKKPEISISDFCAPLGITP--SAIIPFDGAVFGMSANSGKMIHEVDPKSAIA 390 +++ + + K + L P IP + +A GK ++E DPKS A Sbjct: 182 ILITRFDSRTKLADEVLQELKQLLGDPVLKTKIPRR-VAYREAAAEGKPLYEYDPKSKAA 240 >gnl|CDD|73340 cd03111, CpaE_like, This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster. The function of these proteins are unkown. The Caulobacter pilus assembly contains 7 genes: pilA, cpaA, cpaB, cpaC, cpaD, cpaE and cpaF. These genes are clustered together on chromosome.. Length = 106 Score = 53.0 bits (127), Expect = 2e-07 Identities = 21/48 (43%), Positives = 31/48 (64%) Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFD 211 I+FIG++GGVG++T+A N A ++A LL DLDL +G + D Sbjct: 2 IAFIGAKGGVGATTLAANLAVALAKEAGRRVLLVDLDLQFGDDYVVVD 49 Score = 46.4 bits (110), Expect = 2e-05 Identities = 18/63 (28%), Positives = 34/63 (53%), Gaps = 1/63 (1%) Query: 276 PLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADK-PPYLV 334 V++D+ + + L +D+V + T DL +RN+K L+++L+ L + LV Sbjct: 44 DYVVVDLGRSLDEVSLAALDQADRVFLVTQQDLPSIRNAKRLLELLRVLDYSLPAKIELV 103 Query: 335 LNQ 337 LN+ Sbjct: 104 LNR 106 >gnl|CDD|32719 COG2894, MinD, Septum formation inhibitor-activating ATPase [Cell division and chromosome partitioning]. Length = 272 Score = 51.0 bits (122), Expect = 7e-07 Identities = 62/277 (22%), Positives = 118/277 (42%), Gaps = 42/277 (15%) Query: 170 RGGVGSSTIAHNCAFSIAS------VFAMETLLADLDLPYGTAN-INFDKDPINSISDAI 222 +GGVG +T N ++A + + L +LDL G N I +D + D I Sbjct: 11 KGGVGKTTTTANIGTALAQLGKKVVLIDFDIGLRNLDLIMGLENRIVYD------LVDVI 64 Query: 223 YPVGRIDKAFVS--RLPVFYAENLSILTAPAMLSRTYDFD----EKMIVPVLDILEQIFP 276 +++A + RL ENL +L A S+T D D E + V ++ F Sbjct: 65 EGEATLNQALIKDKRL-----ENLFLLPA----SQTRDKDALTPEGVKKVVNELKAMDFD 115 Query: 277 LVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVL-----KKLRPADKPP 331 +I+D P + + +D+ ++ T+ +++ +R+S +I +L + + Sbjct: 116 YIIIDSPAGIEQGFKNAVYFADEAIVVTNPEVSSVRDSDRIIGLLESKSRRAEIGEEPKE 175 Query: 332 YLVLNQVKT---PKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSA 388 +L+LN+ + + +S+ D L I +IP D V ++N G+ + +D S Sbjct: 176 HLLLNRYRPEMVKRGEMLSVEDVLEILSIPLIGVIPEDQDVL-RASNKGEPV-ILDDNSD 233 Query: 389 IANLLVDFSRVLMGR----VTVSKPQSAMYTKIKKIF 421 D +R L+G + + + ++K F Sbjct: 234 AGKAYRDIARRLLGEEVPFRFLEEEKKGFLARLKGGF 270 >gnl|CDD|73299 cd02036, MinD, Bacterial cell division requires the formation of a septum at mid-cell. The site is determined by the min operon products MinC, MinD and MinE. MinC is a nonspecific inhibitor of the septum protein FtsZ. MinE is the supressor of MinC. MinD plays a pivotal role, selecting the mid-cell over other sites through the activation and regulation of MinC and MinE. MinD is a membrane-associated ATPase, related to nitrogenase iron protein. More distantly related proteins include flagellar biosynthesis proteins and ParA chromosome partitioning proteins. MinD is a monomer.. Length = 179 Score = 40.5 bits (95), Expect = 0.001 Identities = 45/229 (19%), Positives = 83/229 (36%), Gaps = 56/229 (24%) Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIY 223 I +GGVG +T N T LA L Y I+ D Sbjct: 2 IVVTSGKGGVGKTTTTANLG----------TALAQLG--YKVVLIDAD------------ 37 Query: 224 PVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVP 283 NL ++ + +++ + D+L +++D P Sbjct: 38 ---------------LGLRNLDLIL---------GLENRVVYTLHDVLAG--DYILIDSP 71 Query: 284 HVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKK 343 + +D+ ++ T+ +++ LR++ + +L+ L K +++N+V P Sbjct: 72 AGIERGFITAIAPADEALLVTTPEISSLRDADRVKGLLEAL--GIKVVGVIVNRV-RPDM 128 Query: 344 PEIS--ISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIA 390 E + D LG+ +IP D AV + N G+ + PKS A Sbjct: 129 VEGGDMVEDIEEILGVPLLGVIPEDPAVI-RATNRGEPVVLNKPKSPAA 176 >gnl|CDD|30835 COG0489, Mrp, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning]. Length = 265 Score = 38.9 bits (90), Expect = 0.003 Identities = 46/208 (22%), Positives = 87/208 (41%), Gaps = 14/208 (6%) Query: 125 ISNHVSEYLIEPLSVADIINSISAIFTP---QEEGKGSSGCSISFIGSRGGVGSSTIAHN 181 I +++ L L + ++ A+ T + + I+ +GGVG ST+A N Sbjct: 18 IPELLAKALAALLPKSTASEALRALRTNLKFAKVLRKGVKNVIAVTSGKGGVGKSTVAVN 77 Query: 182 CAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYA 241 A ++A + LL D DL + + + +++ + +A + Sbjct: 78 LAAALAQL-GKRVLLLDADLRGPSIPRMLGLENLPGLTELL-----AGEALEPVIQHDGI 131 Query: 242 ENLSILTA--PAMLSRTYDFDEKMIVPVL-DILEQIFPLVILDVPHVW-NSWTQEVLTLS 297 + LSIL ++ R K ++ +L D+L + VI+D P ++ + + Sbjct: 132 KVLSILPLGPVPVIPRGL-LGSKAMLQLLEDVLWGEYDYVIIDTPPGTGDADATVLQRIP 190 Query: 298 DKVVITTSLDLAGLRNSKNLIDVLKKLR 325 D VVI T+ L + K ID+L+K Sbjct: 191 DGVVIVTTPGKTALEDVKKAIDMLEKAG 218 >gnl|CDD|31343 COG1149, COG1149, MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion]. Length = 284 Score = 36.4 bits (84), Expect = 0.016 Identities = 28/130 (21%), Positives = 53/130 (40%), Gaps = 9/130 (6%) Query: 262 KMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVL 321 K++ + +++ L+I+D L +D ++ T GL + K ++++ Sbjct: 151 KLVTALKKHAKELADLLIIDSAAGTGCPVIASLKGADLAILVTEPTPFGLHDLKRALELV 210 Query: 322 KKLRPADKPPYLVLNQVKTPKKPEIS-ISDFCAPLGITPSAIIPFDGAVFGMSANSGKMI 380 + P +V+N+ S I ++C GI IP+D + N G+ Sbjct: 211 EHFG---IPTGIVINR----YNLGDSEIEEYCEEEGIPILGEIPYDKDIPEAYVN-GEPF 262 Query: 381 HEVDPKSAIA 390 E D K A A Sbjct: 263 VEPDSKEAEA 272 Score = 29.1 bits (65), Expect = 2.5 Identities = 11/37 (29%), Positives = 20/37 (54%), Gaps = 2/37 (5%) Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLD 200 ++ +GG G +T+A N A + + + +LAD D Sbjct: 4 VAVASGKGGTGKTTVAANLAVLLGDKY--KLVLADCD 38 >gnl|CDD|73301 cd02038, FleN-like, FleN is a member of the Fer4_NifH superfamily. It shares the common function as an ATPase, with the ATP-binding domain at the N-terminus. In Pseudomonas aeruginosa, FleN gene is involved in regulating the number of flagella and chemotactic motility by influencing FleQ activity.. Length = 139 Score = 35.5 bits (82), Expect = 0.028 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 3/48 (6%) Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFD 211 I+ +GGVG + I+ N A ++A + LL D DL G AN+++D Sbjct: 2 IAVTSGKGGVGKTNISANLALALAKL-GKRVLLLDADL--GLANLDYD 46 >gnl|CDD|34367 COG4753, COG4753, Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain [Signal transduction mechanisms]. Length = 475 Score = 35.3 bits (81), Expect = 0.031 Identities = 17/95 (17%), Positives = 43/95 (45%), Gaps = 2/95 (2%) Query: 67 EAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALIS 126 EA+ ++ PD++I + + L ++ + E T+ I++ ++ + + Sbjct: 39 EALELIQETQ-PDIVITDINMPGMDGLDLIKAIKEQ-SPDTEFIILSGYDEFEYAKKAMK 96 Query: 127 NHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSG 161 V +YL++P+ A++ ++ I EE + Sbjct: 97 LGVKDYLLKPVDKAELEEALKKIIGKLEEQQKVKQ 131 >gnl|CDD|145019 pfam01656, CbiA, CobQ/CobB/MinD/ParA nucleotide binding domain. This family consists of various cobyrinic acid a,c-diamide synthases. These include CbiA and CbiP from S.typhimurium, and CobQ from R. capsulatus. These amidases catalyse amidations to various side chains of hydrogenobyrinic acid or cobyrinic acid a,c-diamide in the biosynthesis of cobalamin (vitamin B12) from uroporphyrinogen III. Vitamin B12 is an important cofactor and an essential nutrient for many plants and animals and is primarily produced by bacteria. The family also contains dethiobiotin synthetases as well as the plasmid partitioning proteins of the MinD/ParA family. Length = 212 Score = 35.1 bits (81), Expect = 0.041 Identities = 39/185 (21%), Positives = 77/185 (41%), Gaps = 15/185 (8%) Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIY 223 I+ G++GGVG +T+A N A ++A LL DLD + + D + Sbjct: 1 IAIAGTKGGVGKTTLAANLARALAK-RGYRVLLIDLDPQANLTSSLGKG---PDLIDVLK 56 Query: 224 PVGRIDKAFVSR------LPVFYAENLSILTAPAMLSRT-YDFDEKMIVPVLDILEQIFP 276 I A + +P + L L P+ LS ++ + + +++ + Sbjct: 57 EGLEIVDAQPLQHIAAAIVPSRNLDPL--LLIPSNLSLANFESELILEGGEEGLIKLAYD 114 Query: 277 LVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLN 336 VI+D T L +D +V+ + + ++ L++++++L K +VLN Sbjct: 115 YVIIDGAPGLGELTANALVAADILVVPIEPEGVAVLGAQRLLELVERLG--LKILGVVLN 172 Query: 337 QVKTP 341 +V Sbjct: 173 KVDRG 177 >gnl|CDD|73302 cd02042, ParA, ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation. ParB binds to DNA sequences adjacent to the origin of replication and localizes to opposite cell poles shortly following the initiation of DNA replication. ParB regulates the ParA ATPase activity by promoting nucleotide exchange in a fashion reminiscent of the exchange factors of eukaryotic G proteins. ADP-bound ParA binds single-stranded DNA, whereas the ATP-bound form dissociates ParB from its DNA binding sites. Increasing the fraction of ParA-ADP in the cell inhibits cell division, suggesting that this simple nucleotide switch may regulate cytokinesis. ParA shares sequence similarity to a conserved and widespread family of ATPases which includes the repA protein of the repABC operon in R. etli Sym plasmid. This operon is involved in the plasmid replication and partition.. Length = 104 Score = 34.1 bits (78), Expect = 0.080 Identities = 18/75 (24%), Positives = 33/75 (44%), Gaps = 4/75 (5%) Query: 265 VPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVI---TTSLDLAGLRNSKNLIDVL 321 V ++D+ Q + +I+D P T+ L +D V+I + LDL GL + + Sbjct: 31 VLLIDLDPQ-YDYIIIDTPPSLGLLTRNALAAADLVLIPVQPSPLDLDGLEKLLETLILE 89 Query: 322 KKLRPADKPPYLVLN 336 +L P ++ Sbjct: 90 DRLNPDLDILGILPT 104 Score = 31.0 bits (70), Expect = 0.61 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPY 203 I+ +GGVG +T A N A ++A LL DLD Y Sbjct: 2 IAVANQKGGVGKTTTAVNLAAALAR-RGKRVLLIDLDPQY 40 >gnl|CDD|31832 COG1646, COG1646, Predicted phosphate-binding enzymes, TIM-barrel fold [General function prediction only]. Length = 240 Score = 31.0 bits (70), Expect = 0.63 Identities = 17/74 (22%), Positives = 31/74 (41%), Gaps = 6/74 (8%) Query: 85 TKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVS------LYRALISNHVSEYLIEPLS 138 T +D + A E ++GT I+IG ++ V+ + A+ ++ P S Sbjct: 20 TLIDPDKTEEADEIAEAAAEAGTDAIMIGGSDGVTEENVDNVVEAIKERTDLPVILFPGS 79 Query: 139 VADIINSISAIFTP 152 + I A+F P Sbjct: 80 PSGISPYADAVFFP 93 >gnl|CDD|32386 COG2204, AtoC, Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms]. Length = 464 Score = 30.3 bits (68), Expect = 0.99 Identities = 16/87 (18%), Positives = 36/87 (41%), Gaps = 2/87 (2%) Query: 60 ITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVS 119 +T S EA+ S DL+++ ++ + L L+ + D VIV+ D+ Sbjct: 32 VTAESAEEAL-EALSESPFDLVLLDIRMPGMDGLELLKEIKSR-DPDLPVIVMTGHGDID 89 Query: 120 LYRALISNHVSEYLIEPLSVADIINSI 146 + ++L +P + ++ + Sbjct: 90 TAVEALRLGAFDFLEKPFDLDRLLAIV 116 >gnl|CDD|73339 cd03110, Fer4_NifH_child, This protein family's function is unkown. It contains nucleotide binding site. It uses NTP as energy source to transfer electron or ion.. Length = 179 Score = 30.2 bits (68), Expect = 1.1 Identities = 16/73 (21%), Positives = 32/73 (43%), Gaps = 3/73 (4%) Query: 292 EVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDF 351 LT +D ++ T +GL + + +++++ P +V+N+ + I D+ Sbjct: 110 ASLTGADAALLVTEPTPSGLHDLERAVELVRHFG---IPVGVVINKYDLNDEIAEEIEDY 166 Query: 352 CAPLGITPSAIIP 364 C GI IP Sbjct: 167 CEEEGIPILGKIP 179 >gnl|CDD|34203 COG4565, CitB, Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms]. Length = 224 Score = 29.8 bits (67), Expect = 1.3 Identities = 25/101 (24%), Positives = 43/101 (42%), Gaps = 19/101 (18%) Query: 50 DPRMSQVNMRI-----------TRGSIAEAVSCFSDSSTPDLIIVQ---TKVDSREVLSA 95 DP +++++ R T G++ EA + PDLI++ + E+L Sbjct: 9 DPMVAEIHRRYVKQIPGFSVVGTAGTLEEAKMIIEEFK-PDLILLDIYMPDGNGIELLPE 67 Query: 96 LEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEP 136 L D VIVI +D+ + + V +YLI+P Sbjct: 68 LRSQHYPVD----VIVITAASDMETIKEALRYGVVDYLIKP 104 >gnl|CDD|33502 COG3707, AmiR, Response regulator with putative antiterminator output domain [Signal transduction mechanisms]. Length = 194 Score = 29.8 bits (67), Expect = 1.6 Identities = 15/70 (21%), Positives = 37/70 (52%), Gaps = 2/70 (2%) Query: 74 DSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYL 133 + PD++I+ ++ R+++ AL +E + ++ + +D +L A I V Y+ Sbjct: 47 ERLQPDVVILDIEMPRRDIIEALLLASE--NVARPIVALTAYSDPALIEAAIEAGVMAYI 104 Query: 134 IEPLSVADII 143 ++PL + ++ Sbjct: 105 VKPLDESRLL 114 >gnl|CDD|145605 pfam02558, ApbA, Ketopantoate reductase PanE/ApbA. This is a family of 2-dehydropantoate 2-reductases also known as ketopantoate reductases, EC:1.1.1.169. The reaction catalysed by this enzyme is: (R)-pantoate + NADP(+) <=> 2-dehydropantoate + NADPH. AbpA catalyses the NADPH reduction of ketopantoic acid to pantoic acid in the alternative pyrimidine biosynthetic (APB) pathway. ApbA and PanE are allelic. ApbA, the ketopantoate reductase enzyme is required for the synthesis of thiamine via the APB biosynthetic pathway. Length = 150 Score = 29.5 bits (67), Expect = 1.7 Identities = 14/47 (29%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Query: 66 AEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVI 112 A S + DL+IV K + + ALE LA + T V+++ Sbjct: 55 PVATSASEELGPADLVIVAVK--AYQTAEALEDLAPLLGPNTVVLLL 99 >gnl|CDD|164554 CHL00175, minD, septum-site determining protein; Validated. Length = 281 Score = 29.4 bits (66), Expect = 2.2 Identities = 58/286 (20%), Positives = 123/286 (43%), Gaps = 27/286 (9%) Query: 151 TPQEEGKGSSGCSISFIGS-RGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANIN 209 T +++ K ++ I I S +GGVG +T N SIA + L D D+ G N++ Sbjct: 4 TTEDKEKSATMSRIIVITSGKGGVGKTTTTANLGMSIARL-GYRVALIDADI--GLRNLD 60 Query: 210 ----FDKDPINSISDAIYPVGRIDKAFV--SRLPVFYAENLSILTAPAMLSRTYDFDEKM 263 + + + D + R+D+A + R NLS+L R + M Sbjct: 61 LLLGLENRVLYTAMDVLEGECRLDQALIRDKRWK-----NLSLLAISKNRQRYNVTRKNM 115 Query: 264 IVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKK 323 + V + + + +++D P + + + + ++ T+ ++ +R++ + +L+ Sbjct: 116 NMLVDSLKNRGYDYILIDCPAGIDVGFINAIAPAQEAIVVTTPEITAIRDADRVAGLLEA 175 Query: 324 LRPADKPPYLVLNQVKT---PKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMI 380 L++N+V+ +S+ D LGI IP D V +S N G+ + Sbjct: 176 --NGIYNVKLLVNRVRPDMIQANDMMSVRDVQEMLGIPLLGAIPEDENVI-ISTNRGEPL 232 Query: 381 HEVDPKSAIANL-LVDFSRVLMGR----VTVSKPQSAMYTKIKKIF 421 ++ K ++ + + +R L+G+ + + P +++K F Sbjct: 233 -VLNKKLTLSGIAFENAARRLVGKQDYFIDLDSPSKGPLKRLQKFF 277 >gnl|CDD|38881 KOG3677, KOG3677, KOG3677, RNA polymerase I-associated factor - PAF67 [Translation, ribosomal structure and biogenesis, Transcription]. Length = 525 Score = 28.9 bits (64), Expect = 2.6 Identities = 9/35 (25%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Query: 15 NEDNLSESMCSLPRISVHVFCVTDTLYSVVERSKI 49 N+D + E++ S+ + +++ + + L+S+V++S+I Sbjct: 171 NKDEI-ENLQSIFSNNWNIYWILNILHSLVDKSQI 204 >gnl|CDD|73254 cd01295, AdeC, Adenine deaminase (AdeC) directly deaminates adenine to form hypoxanthine. This reaction is part of one of the adenine salvage pathways, as well as the degradation pathway. It is important for adenine utilization as a purine, as well as a nitrogen source in bacteria and archea.. Length = 422 Score = 28.6 bits (64), Expect = 3.0 Identities = 17/68 (25%), Positives = 33/68 (48%), Gaps = 10/68 (14%) Query: 293 VLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLR----------PADKPPYLVLNQVKTPK 342 V+ + KV+ L +AGL + + +V ++L+ A P++ L+ + P Sbjct: 350 VVVKNGKVLAELPLPIAGLMSDEPAEEVAEELKKLREALRELGYALDDPFMTLSFLSLPV 409 Query: 343 KPEISISD 350 PE+ I+D Sbjct: 410 IPELKITD 417 >gnl|CDD|133256 cd00880, Era_like, Era (E. coli Ras-like protein)-like. This family includes several distinct subfamilies (TrmE/ThdF, FeoB, YihA (EngG), Era, and EngA/YfgK) that generally show sequence conservation in the region between the Walker A and B motifs (G1 and G3 box motifs), to the exclusion of other GTPases. TrmE is ubiquitous in bacteria and is a widespread mitochondrial protein in eukaryotes, but is absent from archaea. The yeast member of TrmE family, MSS1, is involved in mitochondrial translation; bacterial members are often present in translation-related operons. FeoB represents an unusual adaptation of GTPases for high-affinity iron (II) transport. YihA (EngB) family of GTPases is typified by the E. coli YihA, which is an essential protein involved in cell division control. Era is characterized by a distinct derivative of the KH domain (the pseudo-KH domain) which is located C-terminal to the GTPase domain. EngA and its orthologs are composed of two GTPase domains and, since the sequences of the two domains are more similar to each other than to other GTPases, it is likely that an ancient gene duplication, rather than a fusion of evolutionarily distinct GTPases, gave rise to this family. Length = 163 Score = 28.4 bits (64), Expect = 3.4 Identities = 32/144 (22%), Positives = 59/144 (40%), Gaps = 24/144 (16%) Query: 262 KMIVPVLDILEQIFPLVILDVPHV---------WNSWTQEVLTLSDKVVITTSLDLAGLR 312 V + L + P+V++D P + + VL +D ++ A LR Sbjct: 32 TDPVEYVWELGPLGPVVLIDTPGIDEAGGLGREREELARRVLERADLILFVVD---ADLR 88 Query: 313 NSKNLIDVLKKLRPADKPPYLVLNQV-KTPKKPEISISDFCA--PLGITPSAIIPFDGAV 369 + +L+ LR KP LVLN++ P++ E + + L + +I Sbjct: 89 ADEEEEKLLELLRERGKPVLLVLNKIDLLPEEEEEELLELRLLILLLLLGLPVIA----- 143 Query: 370 FGMSANSGKMIHEVDPKSAIANLL 393 +SA +G+ I E+ + A+ L Sbjct: 144 --VSALTGEGIDEL--REALIEAL 163 >gnl|CDD|38232 KOG3022, KOG3022, KOG3022, Predicted ATPase, nucleotide-binding [Cell cycle control, cell division, chromosome partitioning]. Length = 300 Score = 28.3 bits (63), Expect = 3.7 Identities = 17/59 (28%), Positives = 28/59 (47%), Gaps = 1/59 (1%) Query: 170 RGGVGSSTIAHNCAFSIASV-FAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGR 227 +GGVG ST+ N A ++AS + L ADL P + + + ++ + PV Sbjct: 56 KGGVGKSTVTVNLALALASEGKKVGLLDADLCGPSIPRMMGLEGEVVHQSDNGWIPVVV 114 >gnl|CDD|153252 cd07990, LPLAT_LCLAT1-like, Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: LCLAT1-like. Lysophospholipid acyltransferase (LPLAT) superfamily member: acyltransferases of de novo and remodeling pathways of glycerophospholipid biosynthesis which catalyze the incorporation of an acyl group from either acylCoAs or acyl-acyl carrier proteins (acylACPs) into acceptors such as glycerol 3-phosphate, dihydroxyacetone phosphate or lyso-phosphatidic acid. Included in this subgroup are such LPLATs as Lysocardiolipin acyltransferase 1 (LCLAT1) or 1-acyl-sn-glycerol-3-phosphate acyltransferase and similar proteins. Length = 193 Score = 28.0 bits (63), Expect = 5.5 Identities = 18/35 (51%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Query: 99 LAEVCDSGTKVIVIGDTNDVSLYRAL-ISNHVSEY 132 L E SG KV+V GD + RAL ISNH SE Sbjct: 3 LFEWL-SGVKVVVYGDEPKLPKERALIISNHRSEV 36 >gnl|CDD|133294 cd01894, EngA1, EngA1 subfamily. This CD represents the first GTPase domain of EngA and its orthologs, which are composed of two adjacent GTPase domains. Since the sequences of the two domains are more similar to each other than to other GTPases, it is likely that an ancient gene duplication, rather than a fusion of evolutionarily distinct GTPases, gave rise to this family. Although the exact function of these proteins has not been elucidated, studies have revealed that the E. coli EngA homolog, Der, and Neisseria gonorrhoeae EngA are essential for cell viability. A recent report suggests that E. coli Der functions in ribosome assembly and stability. Length = 157 Score = 27.4 bits (62), Expect = 8.5 Identities = 14/40 (35%), Positives = 23/40 (57%), Gaps = 2/40 (5%) Query: 318 IDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGI 357 ++ K LR + KP LV+N+V K+ E ++F + LG Sbjct: 95 EEIAKYLRKSKKPVILVVNKVDNIKE-EDEAAEFYS-LGF 132 >gnl|CDD|73300 cd02037, MRP-like, MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily. Like the other members of the superfamily, MRP contains a ATP-binding domain at the N-termini. It is found in bacteria as a membrane-spanning protein and functions as a Na+/H+ antiporter.. Length = 169 Score = 27.4 bits (61), Expect = 8.8 Identities = 10/19 (52%), Positives = 14/19 (73%) Query: 170 RGGVGSSTIAHNCAFSIAS 188 +GGVG ST+A N A ++A Sbjct: 8 KGGVGKSTVAVNLALALAK 26 >gnl|CDD|34971 COG5412, COG5412, Phage-related protein [Function unknown]. Length = 637 Score = 27.2 bits (60), Expect = 9.1 Identities = 16/71 (22%), Positives = 29/71 (40%) Query: 244 LSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVIT 303 I LS ++ + +I + +I+ QIF V + VWN+ ++ + I Sbjct: 263 AGISVVKDSLSGIWNAIKPLIGFLFNIIAQIFQNVKSLLSGVWNNIKSVIVGAAHSAFIG 322 Query: 304 TSLDLAGLRNS 314 + GL N Sbjct: 323 LITKITGLVNQ 333 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.319 0.135 0.386 Gapped Lambda K H 0.267 0.0709 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 4,960,120 Number of extensions: 260629 Number of successful extensions: 636 Number of sequences better than 10.0: 1 Number of HSP's gapped: 631 Number of HSP's successfully gapped: 39 Length of query: 427 Length of database: 6,263,737 Length adjustment: 97 Effective length of query: 330 Effective length of database: 4,167,664 Effective search space: 1375329120 Effective search space used: 1375329120 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 59 (26.5 bits)