HHsearch alignment for GI: 254780727 and conserved domain: PRK11023

>PRK11023 hypothetical protein; Provisional.
Probab=95.88  E-value=0.042  Score=30.44  Aligned_cols=51  Identities=20%  Similarity=0.197  Sum_probs=41.4

Q ss_pred             CCCCEEEEEECCEEEEEEEECCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEECCCC
Q ss_conf             87716999838949999971999999999999998612234555556654430355432777
Q gi|254780727|r  132 ADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGE  193 (474)
Q Consensus       132 p~~~i~v~~~~~~vvl~G~v~~~~~~~~~~~ia~~~~~~~~~~~~~~~~~~~vvn~l~v~~~  193 (474)
T Consensus        66 ~~~~I~v~v~ng~VLLtGqV~~~~~k~~a~~ia~~~~gV-----------r~V~Nei~V~~~  116 (191)
T PRK11023         66 KEARINVTAYQGKVLLIGQSPNAELSARAKQIAMGVEGV-----------TEVYNEIRQGQP  116 (191)
T ss_pred             CCCEEEEEEECCEEEEEEEECCHHHHHHHHHHHHCCCCC-----------EEEEEEEEECCC
T ss_conf             460899999778999999979999999999998466884-----------289999996688