BLAST/PSIBLAST alignment of GI: 254780727 and GI: 209551759 at iteration 1
>gi|209551759|ref|YP_002283676.1| type II and III secretion system protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 499
>gi|209537515|gb|ACI57450.1| type II and III secretion system protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 499
 Score =  419 bits (1078), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 220/447 (49%), Positives = 301/447 (67%), Gaps = 25/447 (5%)

Query: 48  KKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGK 107
           +++ +GLNK +++ +P D  D+LVSDPT AD V  + R +YLFGK VGQ N+ + G  G+
Sbjct: 58  RRLKLGLNKAVVVDLPEDAHDILVSDPTMADAVTRTSRRIYLFGKKVGQTNIFVFGAGGQ 117

Query: 108 QMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETF 167
           +++NLDI IERD++ LE+ L RFI DSNI VE+VSD +VL G VRT QD+ +A +L++ F
Sbjct: 118 EIVNLDIEIERDVSGLEVNLHRFIPDSNINVEIVSDNIVLTGTVRTPQDATQAADLAQVF 177

Query: 168 L---SQSGRNQYANSS--------------SKKVMNLLNIAGEDQVTLKVTIAEVRRDIL 210
           L     + R + A+ +              + +V+NLL I GEDQVTLKVTIAEVRR++L
Sbjct: 178 LKGGEATTRTETASGTGGDSSVALFAEGRQTSQVVNLLQIEGEDQVTLKVTIAEVRREVL 237

Query: 211 KQIGFQHSITGSSS---GPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERAT 267
           KQ+GF + ++ SS        S +AD     V  G     K  + ++   T L+ALE+A 
Sbjct: 238 KQLGFDNLVSNSSGMTVAQLGSPSADSATSVVGGGLAALFKSSIGKYDISTYLNALEQAK 297

Query: 268 AIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGR 327
            ++TLAEPTLTAISGQ+A+F SGGQ LY T + S G  +V   +YG+ L F P VLS GR
Sbjct: 298 VVKTLAEPTLTAISGQAATFNSGGQQLYST-TDSNGNVTVVPFNYGINLAFKPVVLSSGR 356

Query: 328 IGLRIQTEVSEPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPL 387
           I L+I+T VSEPV G +     +Y+ R A+T+VELPSGG+I LAGL++D++ Q   G P 
Sbjct: 357 ISLQIKTNVSEPVAGSSGA---TYQRRSAETSVELPSGGSIALAGLIRDNVSQTMGGTPG 413

Query: 388 LSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNR 447
           +SKIP+LG LFR   F R+ETE+ I ATP+LV+PVA   L+RPDD++S E+D   FF NR
Sbjct: 414 VSKIPLLGTLFRQKGFERQETELVIIATPYLVRPVARNQLNRPDDNFSPENDGATFFLNR 473

Query: 448 VNKIYGPKEASEVEGQNYKGAIGFIYK 474
           VNK+YG +EA   + Q + G+IGFIYK
Sbjct: 474 VNKVYGRREAPVADAQ-FHGSIGFIYK 499