BLAST/PSIBLAST alignment of GI: 254780727 and GI: 218516388 at iteration 1
>gi|218516388|ref|ZP_03513228.1| pilus assembly secretion protein [Rhizobium etli 8C-3] Length = 436
 Score =  412 bits (1060), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 219/441 (49%), Positives = 296/441 (67%), Gaps = 25/441 (5%)

Query: 54  LNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLD 113
           +NK +++ +P D  D+LVSDP+ AD V  + R +YLFGK VGQ N+ + G  G++++NLD
Sbjct: 1   MNKAVVVDLPEDAHDILVSDPSMADAVTRTSRRIYLFGKKVGQTNIFVFGAGGQEIINLD 60

Query: 114 ILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFL---SQ 170
           I IERD++ LE  LRRFI DSNI VE+VSD +VL G VRT QD+ +A +L++ FL     
Sbjct: 61  IEIERDVSGLEANLRRFIPDSNINVEIVSDNIVLTGTVRTPQDATQAADLAQVFLKGGEA 120

Query: 171 SGRNQYANSS--------------SKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQ 216
           + R + A+ +              + +V+NLL I GEDQVTLKVTIAEVRR++LKQ+GF 
Sbjct: 121 TTRTETASGTGGDSAVALFAEGRQTSQVVNLLKIEGEDQVTLKVTIAEVRREVLKQLGFD 180

Query: 217 HSITGSSSGPSKSF---AADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLA 273
           + I+ SS          +AD     V  G     K  + ++   T L+ALE+A  +RTLA
Sbjct: 181 NLISNSSGMTVAQLGTPSADSATATVGGGLAALFKSSIGKYDISTYLNALEQAKVVRTLA 240

Query: 274 EPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQ 333
           EPTLTAISGQ+A+F SGGQ LY T + + G  +V   +YG+ L F P VLS GRI L I+
Sbjct: 241 EPTLTAISGQAATFNSGGQQLYST-TDNDGNVTVVPFNYGINLAFKPVVLSSGRISLEIK 299

Query: 334 TEVSEPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPI 393
           T VSEPV G  +G+  +Y+ R A+T+VELPSGG+I LAGL++D++ Q   G P +SKIP+
Sbjct: 300 TNVSEPVAG--SGNA-TYQRRSAETSVELPSGGSIALAGLIRDNVSQTMGGTPGVSKIPL 356

Query: 394 LGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYG 453
           LG LFR   F R+ETE+ I ATP+LV+PVA   L+RPDD++S E+D   FF NRVNK+YG
Sbjct: 357 LGTLFRQKGFERQETELVIIATPYLVRPVARNQLNRPDDNFSPENDGATFFLNRVNKVYG 416

Query: 454 PKEASEVEGQNYKGAIGFIYK 474
            +EA   + Q + G+IGFIYK
Sbjct: 417 RREAPVADAQ-FHGSIGFIYK 436