BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780727|ref|YP_003065140.1| putative pilus assembly
protein [Candidatus Liberibacter asiaticus str. psy62]
         (474 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780727|ref|YP_003065140.1| putative pilus assembly protein [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040404|gb|ACT57200.1| putative pilus assembly protein [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 474

 Score =  421 bits (1081), Expect = e-115,   Method: Composition-based stats.
 Identities = 474/474 (100%), Positives = 474/474 (100%)

Query: 1   MRYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIIL 60
           MRYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIIL
Sbjct: 1   MRYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIIL 60

Query: 61  QVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDI 120
           QVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDI
Sbjct: 61  QVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDI 120

Query: 121 AHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSS 180
           AHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSS
Sbjct: 121 AHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSS 180

Query: 181 SKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVS 240
           SKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVS
Sbjct: 181 SKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVS 240

Query: 241 EGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSS 300
           EGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSS
Sbjct: 241 EGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSS 300

Query: 301 STGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGDMPSYRVRKADTTV 360
           STGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGDMPSYRVRKADTTV
Sbjct: 301 STGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGDMPSYRVRKADTTV 360

Query: 361 ELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVK 420
           ELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVK
Sbjct: 361 ELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVK 420

Query: 421 PVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
           PVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK
Sbjct: 421 PVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474


>gi|15963894|ref|NP_384247.1| putative pilus assembly transmembrane protein [Sinorhizobium
           meliloti 1021]
 gi|307315791|ref|ZP_07595305.1| type II and III secretion system protein [Sinorhizobium meliloti
           BL225C]
 gi|307320426|ref|ZP_07599843.1| type II and III secretion system protein [Sinorhizobium meliloti
           AK83]
 gi|15073069|emb|CAC41528.1| Pilus assembly protein [Sinorhizobium meliloti 1021]
 gi|306893992|gb|EFN24761.1| type II and III secretion system protein [Sinorhizobium meliloti
           AK83]
 gi|306898559|gb|EFN29232.1| type II and III secretion system protein [Sinorhizobium meliloti
           BL225C]
          Length = 511

 Score =  370 bits (950), Expect = e-100,   Method: Composition-based stats.
 Identities = 209/508 (41%), Positives = 307/508 (60%), Gaps = 37/508 (7%)

Query: 2   RYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQ 61
           +  + +    +S  L  S  ++  LP  + A+++V+ I D   G  K I++GLNK +++ 
Sbjct: 6   KKFRASLAAGLSFCLTFSGMALPTLPAAEAASSSVVRIVDSGPGARKTINLGLNKAVVVD 65

Query: 62  VPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIA 121
           +P D  D+LV+DP+ AD +  + R +YLFGK+VGQ N+ + G  G+++++L++ +ERD+A
Sbjct: 66  LPSDAHDILVADPSLADAITRTSRRIYLFGKSVGQTNIFVFGPGGEEIVSLEVAVERDVA 125

Query: 122 HLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQ------ 175
            LE  LRRFI D++I VE++SD VVL G VRT  DS RAV+L+  FL             
Sbjct: 126 GLEANLRRFIPDADINVEIISDNVVLTGTVRTPLDSTRAVDLARAFLKGGEATTRNITAQ 185

Query: 176 ---------YANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGP 226
                      +  + +++NLL I G+DQVTLKVT+AEV R +LKQ+GF   ++   SG 
Sbjct: 186 GNNGDADIFAEDRQNSQIVNLLTIEGDDQVTLKVTVAEVSRQVLKQLGFNGRVSDGESGI 245

Query: 227 SKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSAS 286
           S    A+ G   ++ G +  +KG +   +  + ++A+E+A  +RTLAEP+LTAISGQ A 
Sbjct: 246 SFRNPANLG-DAIAVGTNALIKGSIGPTTISSYINAMEQAGVMRTLAEPSLTAISGQEAK 304

Query: 287 FTSGGQH---------LYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS 337
           F  GG+                 +T    V   +YG+ L+F P VL PGRI L+I+T+VS
Sbjct: 305 FYVGGEFRLAGVQEVSTDDETGQTTVEREVNDVEYGIRLNFKPVVLGPGRISLQIETDVS 364

Query: 338 EPV-----------IGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIP 386
           EP              +        R R+A T+VELPSGG+IV+AGL++D+I+Q   G+P
Sbjct: 365 EPTYEGSVVTGNSMTAIPGNTFLGIRRREASTSVELPSGGSIVIAGLVQDNIRQAMSGLP 424

Query: 387 LLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFN 446
             SKIPILG LFR+  F R ETE+ I ATP+LV+PVA   +SRPDD+++  +D ++FF  
Sbjct: 425 GASKIPILGTLFRSKDFQRSETELVIIATPYLVRPVARSAISRPDDNFNPANDLESFFLG 484

Query: 447 RVNKIYGPKEASEVEGQNYKGAIGFIYK 474
           RVN+IYG  EA    G+ Y G +GFIYK
Sbjct: 485 RVNRIYGRPEAQPPAGR-YHGNVGFIYK 511


>gi|332560337|ref|ZP_08414659.1| Type II and III secretion system protein precursor [Rhodobacter
           sphaeroides WS8N]
 gi|332278049|gb|EGJ23364.1| Type II and III secretion system protein precursor [Rhodobacter
           sphaeroides WS8N]
          Length = 466

 Score =  370 bits (950), Expect = e-100,   Method: Composition-based stats.
 Identities = 134/454 (29%), Positives = 225/454 (49%), Gaps = 28/454 (6%)

Query: 33  NAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGK 92
            AA   +  +E      +++ +N+ ++++      ++ +++P  AD+   S  ++Y+ GK
Sbjct: 29  PAAAQTLRVMEGSASGALNVPMNRAVVVESDRPFAELSIANPGIADISTLSETSIYVLGK 88

Query: 93  NVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVR 152
             G+  + L+G DG+ + N+D+ +  D+A  +  LR+ +   NI V   +D +VL G V 
Sbjct: 89  APGRTTLTLLGADGRLISNVDVHVTPDVAEFKERLRQILPGENIEVRTANDGIVLSGTVT 148

Query: 153 TIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQ 212
           +     RA++L+  +            +  +V NL+++ G  QV LKV  AE++R + K 
Sbjct: 149 STAKLDRALDLASRY------------APDRVSNLMSVGGTQQVMLKVRFAEMQRSVAKS 196

Query: 213 IGFQHSITGSSSGPSKSFAADFGGKFVSEG--------GDFSVKGVLDRFSFETVLHALE 264
           +G        S                  G        G  S+   +    F+ +L ALE
Sbjct: 197 LGSSIYARNGSGSVIGGTGTLLQNGIPPSGNPISTSGNGALSLGFSVGALEFQVLLEALE 256

Query: 265 RATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLS 324
               +RTLAEP LTA+SGQ A F +GG++    V+S     S+    +GV L+FTP V+ 
Sbjct: 257 SKGVVRTLAEPNLTALSGQEAKFLAGGEYPIP-VASGDEKISIEYKPFGVELNFTPVVVD 315

Query: 325 PGRIGLRIQTEVSEPVIGV----NAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQ 380
             +I L I   VS     V    +   + +++ R+  TTVE+  G +  +AGLL+DD + 
Sbjct: 316 GNQINLMINAAVSSIDNTVTLESSGFTINAFKRRETSTTVEMRDGESFAIAGLLQDDFRN 375

Query: 381 LKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDA 440
           L   +P L  IPILGALFR++ + R ++E+ I  TP LV P     L+ P D   +  + 
Sbjct: 376 LNGQVPWLGDIPILGALFRSAEYQRSQSELVIIVTPHLVTPTRGEALALPTDRVKLPSEK 435

Query: 441 KAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
             F F RV    G   A+EV  Q++ G+ G++ +
Sbjct: 436 DLFLFGRVT---GRGAAAEVARQDFSGSYGYVME 466


>gi|315121891|ref|YP_004062380.1| putative pilus assembly protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495293|gb|ADR51892.1| putative pilus assembly protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 471

 Score =  370 bits (949), Expect = e-100,   Method: Composition-based stats.
 Identities = 330/474 (69%), Positives = 389/474 (82%), Gaps = 3/474 (0%)

Query: 1   MRYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIIL 60
           M+  Q+T F +  IF+ SSN  +A+   +   NA+ I+I D  IG  KKI+IGL KV+IL
Sbjct: 1   MKNFQKTLFMLFVIFISSSNFLLAQSKLVDAKNASTIHIGDSAIGTSKKINIGLGKVVIL 60

Query: 61  QVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDI 120
            +P  VQDVLVSDPTKADVVVHS +T+Y+FGK+VGQANVILIGHD KQ+LN+DI IERDI
Sbjct: 61  HLPSRVQDVLVSDPTKADVVVHSSKTVYIFGKSVGQANVILIGHDEKQLLNIDIFIERDI 120

Query: 121 AHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSS 180
            +LEMT RRF++ SNI VEM+SD +VLHG VRTIQDSQ AVELS  FLS    N Y  +S
Sbjct: 121 RNLEMTFRRFLSGSNIHVEMLSDNLVLHGEVRTIQDSQHAVELSNMFLSNERNNLYKTAS 180

Query: 181 SKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVS 240
             KV+NLLNI  EDQVTLKVTIAEVRRD+LKQIGFQH+I  SS GPSK    DF G    
Sbjct: 181 GSKVINLLNIGAEDQVTLKVTIAEVRRDVLKQIGFQHTI--SSGGPSKGKRIDFDGSLGG 238

Query: 241 EGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSS 300
           +G DF++  +LDRF+F++VL+ALERATAIRTLAEPTLTAISGQ+A+F SGG  LY++V  
Sbjct: 239 QGADFAMTTILDRFTFKSVLNALERATAIRTLAEPTLTAISGQNATFRSGGTRLYRSV-G 297

Query: 301 STGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGDMPSYRVRKADTTV 360
           + G +++T HDYGVVL FTPTVLSPGRIGLRI+TEVSEPV+GV+    P YR+RKADTTV
Sbjct: 298 ANGTSTITPHDYGVVLTFTPTVLSPGRIGLRIETEVSEPVLGVSTTGEPEYRMRKADTTV 357

Query: 361 ELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVK 420
           ELPSGGTIVLAGLLKDDIQQ + G+PLLSKIPILGALFR++ F+REETEIFI+ATPFLVK
Sbjct: 358 ELPSGGTIVLAGLLKDDIQQKRGGVPLLSKIPILGALFRSNSFSREETEIFISATPFLVK 417

Query: 421 PVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
           PVAM +LSRPDD+Y +E+DAKAF FNRVNKIYGPKEA++  GQNYKGAIGFIYK
Sbjct: 418 PVAMNELSRPDDNYDIENDAKAFLFNRVNKIYGPKEAAQGNGQNYKGAIGFIYK 471


>gi|146276361|ref|YP_001166520.1| type II and III secretion system protein [Rhodobacter sphaeroides
           ATCC 17025]
 gi|145554602|gb|ABP69215.1| type II and III secretion system protein [Rhodobacter sphaeroides
           ATCC 17025]
          Length = 461

 Score =  369 bits (948), Expect = e-100,   Method: Composition-based stats.
 Identities = 133/475 (28%), Positives = 230/475 (48%), Gaps = 28/475 (5%)

Query: 12  MSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLV 71
           M+  L     ++A +        +   +  +E      +++ +N+ ++++      ++ +
Sbjct: 3   MNHILRMGMAALAFMASAAPMAVSAQTLRVMEGSASGALNVPMNRAVVVESDRPFAELSI 62

Query: 72  SDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFI 131
           ++P  AD+   S  ++Y+ GK  G+  + L+G DG+ + N+D+ +  D+A  +  LR+ +
Sbjct: 63  ANPGIADISTLSETSIYVLGKAPGRTTLTLLGADGRLISNVDVHVTPDVAEFKERLRQIL 122

Query: 132 ADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIA 191
              NI V   +D +VL G V + +   RA++L+  +            +  +V NL+++ 
Sbjct: 123 PGENIEVRTANDGIVLSGTVTSAERLDRALDLANRY------------APDRVSNLMSVG 170

Query: 192 GEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEG--------G 243
           G  QV LKV  AE++R + K +G        S                  G        G
Sbjct: 171 GTQQVMLKVRFAEMQRSVAKSLGSSIYARNGSGSVIGGTGTLLQNGIPPSGAPITTAATG 230

Query: 244 DFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTG 303
              +   +    F  +L ALE    +RTLAEP LTA+SGQ A F +GG++    V+S   
Sbjct: 231 ALGLGFSVGALEFSVLLEALESKGVVRTLAEPNLTALSGQEAKFLAGGEYPIP-VASGDE 289

Query: 304 ATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVN----AGDMPSYRVRKADTT 359
             ++    +GV L+FTP V+   +I L I   VS     V+       + +++ R+  TT
Sbjct: 290 KIAIEYKPFGVELNFTPVVVDGSQINLMINAAVSSIDNTVSLESAGFTINAFKRRETSTT 349

Query: 360 VELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLV 419
           VE+  G +  +AGLL+DD + L   +P L  IPILGALFR++ + R ++E+ I  TP LV
Sbjct: 350 VEMRDGESFAIAGLLQDDFRNLNGQVPWLGDIPILGALFRSAEYQRSQSELVIIVTPHLV 409

Query: 420 KPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
            P     L+ P D   +  + + F F RV    G   A EV  Q++ G+ G++ +
Sbjct: 410 TPTRGEALALPTDRIKLPSEKELFLFGRVT---GRGAAGEVARQDFSGSYGYVME 461


>gi|221638316|ref|YP_002524578.1| Type II and III secretion system protein [Rhodobacter sphaeroides
           KD131]
 gi|221159097|gb|ACM00077.1| Type II and III secretion system protein precursor [Rhodobacter
           sphaeroides KD131]
          Length = 461

 Score =  368 bits (944), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 134/454 (29%), Positives = 225/454 (49%), Gaps = 28/454 (6%)

Query: 33  NAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGK 92
            AA   +  +E      +++ +N+ ++++      ++ +++P  AD+   S  ++Y+ GK
Sbjct: 24  PAAAQTLRVMEGSASGALNVPMNRAVVVESDRPFAELSIANPGIADISTLSETSIYVLGK 83

Query: 93  NVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVR 152
             G+  + L+G DG+ + N+D+ +  D+A  +  LR+ +   NI V   +D +VL G V 
Sbjct: 84  APGRTTLTLLGADGRLISNVDVHVTPDVAEFKERLRQILPGENIEVRTANDGIVLSGTVT 143

Query: 153 TIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQ 212
           +     RA++L+  +            +  +V NL+++ G  QV LKV  AE++R + K 
Sbjct: 144 STAKLDRALDLASRY------------APDRVSNLMSVGGTQQVMLKVRFAEMQRSVAKS 191

Query: 213 IGFQHSITGSSSGPSKSFAADFGGKFVSEG--------GDFSVKGVLDRFSFETVLHALE 264
           +G        S                  G        G  S+   +    F+ +L ALE
Sbjct: 192 LGSSIYARNGSGSVIGGTGTLLQNGIPPSGAPISTSGNGALSLGFSVGALEFQVLLEALE 251

Query: 265 RATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLS 324
               +RTLAEP LTA+SGQ A F +GG++    V+S     S+    +GV L+FTP V+ 
Sbjct: 252 SKGVVRTLAEPNLTALSGQEAKFLAGGEYPIP-VASGDEKISIEYKPFGVELNFTPVVVD 310

Query: 325 PGRIGLRIQTEVSEPVIGV----NAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQ 380
             +I L I   VS     V    +   + +++ R+  TTVE+  G +  +AGLL+DD + 
Sbjct: 311 GNQINLMINAAVSSIDNTVTLESSGFTINAFKRRETSTTVEMRDGESFAIAGLLQDDFRN 370

Query: 381 LKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDA 440
           L   +P L  IPILGALFR++ + R ++E+ I  TP LV P     L+ P D   +  + 
Sbjct: 371 LNGQVPWLGDIPILGALFRSAEYQRSQSELVIIVTPHLVTPTRGEALALPTDRVKLPSEK 430

Query: 441 KAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
             F F RV    G   A+EV  Q++ G+ G++ +
Sbjct: 431 DLFLFGRVT---GRGAAAEVARQDFSGSYGYVME 461


>gi|126461331|ref|YP_001042445.1| type II and III secretion system protein [Rhodobacter sphaeroides
           ATCC 17029]
 gi|126102995|gb|ABN75673.1| type II and III secretion system protein [Rhodobacter sphaeroides
           ATCC 17029]
          Length = 461

 Score =  368 bits (944), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 134/454 (29%), Positives = 225/454 (49%), Gaps = 28/454 (6%)

Query: 33  NAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGK 92
            AA   +  +E      +++ +N+ ++++      ++ +++P  AD+   S  ++Y+ GK
Sbjct: 24  PAAAQTLRVMEGSASGALNVPMNRAVVVESDRPFAELSIANPGIADISTLSETSIYVLGK 83

Query: 93  NVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVR 152
             G+  + L+G DG+ + N+D+ +  D+A  +  LR+ +   NI V   +D +VL G V 
Sbjct: 84  APGRTTLTLLGADGRLISNVDVHVTPDVAEFKERLRQILPGENIEVRTANDGIVLSGTVT 143

Query: 153 TIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQ 212
           +     RA++L+  +            +  +V NL+++ G  QV LKV  AE++R + K 
Sbjct: 144 STAKLDRALDLASRY------------APDRVSNLMSVGGTQQVMLKVRFAEMQRSVAKS 191

Query: 213 IGFQHSITGSSSGPSKSFAADFGGKFVSEG--------GDFSVKGVLDRFSFETVLHALE 264
           +G        S                  G        G  S+   +    F+ +L ALE
Sbjct: 192 LGSSIYARNGSGSVIGGTGTLLQNGIPPSGAPISTSGNGALSLGFSVGALEFQVLLEALE 251

Query: 265 RATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLS 324
               +RTLAEP LTA+SGQ A F +GG++    V+S     S+    +GV L+FTP V+ 
Sbjct: 252 SKGVVRTLAEPNLTALSGQEAKFLAGGEYPIP-VASGDEKISIEYKPFGVELNFTPVVVD 310

Query: 325 PGRIGLRIQTEVSEPVIGV----NAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQ 380
             +I L I   VS     V    +   + +++ R+  TTVE+  G +  +AGLL+DD + 
Sbjct: 311 GNQINLMINAAVSSIDNTVTLESSGFTINAFKRRETSTTVEMRDGESFAIAGLLQDDFRN 370

Query: 381 LKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDA 440
           L   +P L  IPILGALFR++ + R ++E+ I  TP LV P     L+ P D   +  + 
Sbjct: 371 LNGQVPWLGDIPILGALFRSAEYQRSQSELVIIVTPHLVTPTRGEALALPTDRVKLPSEK 430

Query: 441 KAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
             F F RV    G   A+EV  Q++ G+ G++ +
Sbjct: 431 DLFLFGRVT---GRGAAAEVARQDFSGSYGYVME 461


>gi|77462453|ref|YP_351957.1| Outer membrane general secretion pathway protein, secretin
           [Rhodobacter sphaeroides 2.4.1]
 gi|77386871|gb|ABA78056.1| Outer membrane general secretion pathway protein, Secretin
           [Rhodobacter sphaeroides 2.4.1]
          Length = 461

 Score =  367 bits (943), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 134/454 (29%), Positives = 225/454 (49%), Gaps = 28/454 (6%)

Query: 33  NAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGK 92
            AA   +  +E      +++ +N+ ++++      ++ +++P  AD+   S  ++Y+ GK
Sbjct: 24  PAAAQTLRVMEGSASGALNVPMNRAVVVESDRPFAELSIANPGIADISTLSETSIYVLGK 83

Query: 93  NVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVR 152
             G+  + L+G DG+ + N+D+ +  D+A  +  LR+ +   NI V   +D +VL G V 
Sbjct: 84  APGRTTLTLLGADGRLISNVDVHVTPDVAEFKERLRQILPGENIEVRTANDGIVLSGTVT 143

Query: 153 TIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQ 212
           +     RA++L+  +            +  +V NL+++ G  QV LKV  AE++R + K 
Sbjct: 144 STAKLDRALDLASRY------------APDRVSNLMSVGGTQQVMLKVRFAEMQRSVAKS 191

Query: 213 IGFQHSITGSSSGPSKSFAADFGGKFVSEG--------GDFSVKGVLDRFSFETVLHALE 264
           +G        S                  G        G  S+   +    F+ +L ALE
Sbjct: 192 LGSSIYARNGSGSVIGGTGTLLQNGIPPSGASIATSGNGALSLGFSVGALEFQVLLEALE 251

Query: 265 RATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLS 324
               +RTLAEP LTA+SGQ A F +GG++    V+S     S+    +GV L+FTP V+ 
Sbjct: 252 SKGVVRTLAEPNLTALSGQEAKFLAGGEYPIP-VASGDEKISIEYKPFGVELNFTPVVVD 310

Query: 325 PGRIGLRIQTEVSEPVIGV----NAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQ 380
             +I L I   VS     V    +   + +++ R+  TTVE+  G +  +AGLL+DD + 
Sbjct: 311 GNQINLMINAAVSSIDNTVTLESSGFTINAFKRRETSTTVEMRDGESFAIAGLLQDDFRN 370

Query: 381 LKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDA 440
           L   +P L  IPILGALFR++ + R ++E+ I  TP LV P     L+ P D   +  + 
Sbjct: 371 LNGQVPWLGDIPILGALFRSAEYQRSQSELVIIVTPHLVTPTRGEALALPTDRVKLPSEK 430

Query: 441 KAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
             F F RV    G   A+EV  Q++ G+ G++ +
Sbjct: 431 DLFLFGRVT---GRGAAAEVARQDFSGSYGYVME 461


>gi|255262444|ref|ZP_05341786.1| outer membrane general secretion pathway protein, Secretin
           [Thalassiobium sp. R2A62]
 gi|255104779|gb|EET47453.1| outer membrane general secretion pathway protein, Secretin
           [Thalassiobium sp. R2A62]
          Length = 480

 Score =  366 bits (939), Expect = 5e-99,   Method: Composition-based stats.
 Identities = 137/478 (28%), Positives = 228/478 (47%), Gaps = 28/478 (5%)

Query: 7   TFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDV 66
           T+   M   L     + + +P    A    +            +++ +N+ ++++  V  
Sbjct: 19  TYDRFMKAALMGLFVATSSVPAAVSAETLRVMRG----APSSALNVPMNRAVVVESDVPF 74

Query: 67  QDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMT 126
            ++ +++P  AD+   S RT+Y+ GK  G+  + L+G DG+ + N+D+ +  DIA  +  
Sbjct: 75  AELSIANPGIADISTLSDRTIYVLGKLPGRTTLTLLGPDGRLITNVDVHVTPDIAEFKER 134

Query: 127 LRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMN 186
           L + +   NI V   +D +VL G+V +     RA++L+E +            +  +V N
Sbjct: 135 LSQILPGENIEVRTANDGIVLSGVVSSSARLTRALDLAERY------------APDRVSN 182

Query: 187 LLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAAD----FGGKFVSEG 242
           L+++ G  QV L+V  AE++R + K +    +I G+    +           GG      
Sbjct: 183 LMSVGGTQQVMLRVRFAEMQRSVRKSLSSSVNIFGTGFSTAAGNINGVQAAGGGITTDAT 242

Query: 243 GDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSST 302
           G            F  +L ALE    +RTLAEP LTA+SGQ A F +GG++    V+   
Sbjct: 243 GAAFFGIDAGDIQFNVLLEALESKGVVRTLAEPNLTALSGQEAHFLAGGEYPVP-VAQEG 301

Query: 303 GATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAG-----DMPSYRVRKAD 357
           G T+V   D+GV L F P V+    I L ++  VS               + ++R R+  
Sbjct: 302 GTTTVEYKDFGVELTFLPVVVDQDLINLTLKASVSSIDTTNGVQVGSDFTIAAFRTRETS 361

Query: 358 TTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPF 417
           TTVE+  G +  +AGLL+DD   L   +P L  +P+LGALFR++ +NR ++E+ I  TP 
Sbjct: 362 TTVEMRDGESFAIAGLLQDDFTDLNGQVPWLGDVPVLGALFRSAEYNRSQSELVIIVTPH 421

Query: 418 LVKPVAMRDLSRPDDHYSVEDDAKAFFFNRV--NKIYGPKEASEVEGQNYKGAIGFIY 473
           LV P     L+ P D      +   F F RV  +       A EV  Q++ G+ G++ 
Sbjct: 422 LVTPTRGEALALPTDRVRPPTERDLFLFGRVAASDAPQSGAAGEVAKQDFSGSYGYVM 479


>gi|260426909|ref|ZP_05780888.1| type II and III secretion system protein [Citreicella sp. SE45]
 gi|260421401|gb|EEX14652.1| type II and III secretion system protein [Citreicella sp. SE45]
          Length = 473

 Score =  364 bits (935), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 135/483 (27%), Positives = 236/483 (48%), Gaps = 38/483 (7%)

Query: 12  MSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLV 71
           +   L     +   L     A+    N+  V  G    +++ +N+ ++++      ++ +
Sbjct: 7   LKAALIGLALTAGPLVEGARAD----NLRVVRTGTESVLNVPMNRAVVVESDQPFAELSI 62

Query: 72  SDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFI 131
           ++P  AD+   S RT+Y+ GK  G   + ++  +G+ + N+D+ +  D+   +  LR+ +
Sbjct: 63  ANPAIADISSLSERTIYVLGKTPGTTTLTILDGNGRLITNVDVRVAADVTEFKERLRQIL 122

Query: 132 ADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIA 191
              +I V   +D +VL G V + Q  QRA++L++ +            + ++V NL+ + 
Sbjct: 123 PGESIEVRTANDGIVLSGTVSSAQKLQRALDLAQRY------------APERVSNLMTVG 170

Query: 192 GEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFS----- 246
           G  QV LKV  AE++R + K +    SI G   G  +       G +++ G  +      
Sbjct: 171 GVQQVMLKVRFAEMQRSVSKNLRSSLSIGGPIFGEDEITIGSETGTWLNSGNSYGDAVTV 230

Query: 247 --------VKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTV 298
                   + G         +L ALE    +RTLAEP LTA+SGQ A F +GG++    V
Sbjct: 231 ADGTESALLLGFNGAIEVGILLEALESKGMVRTLAEPNLTALSGQEAKFLAGGEYPVP-V 289

Query: 299 SSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVI----GVNAGDMPSYRVR 354
           S   G  SVT   +GV L+F PTV+    I L+++  VS          +A  + ++R R
Sbjct: 290 SQEDGKLSVTYKPFGVELNFVPTVIDGDLINLQLEAAVSSIDSSNGITTDAISIDAFRRR 349

Query: 355 KADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAA 414
           +  TTVE+  G +  +AGLL+DD + +   +P +  IP+LGALFR++ + R+++E+ I  
Sbjct: 350 ETSTTVEMRDGESFAIAGLLQDDFRDVNGQVPWIGDIPVLGALFRSAEYERQQSELVIIV 409

Query: 415 TPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVN----KIYGPKEASEVEGQNYKGAIG 470
           TP LV P     L+ P D      +   F F R +    +      A+EV  Q++ G+ G
Sbjct: 410 TPHLVTPTRGEALALPTDRVMPPTEKDLFLFGRTSSDDARRPRTGGAAEVARQDFTGSYG 469

Query: 471 FIY 473
           ++ 
Sbjct: 470 YVM 472


>gi|56697919|ref|YP_168290.1| type II/III secretion system protein [Ruegeria pomeroyi DSS-3]
 gi|56679656|gb|AAV96322.1| bacterial type II/III secretion system protein [Ruegeria pomeroyi
           DSS-3]
          Length = 475

 Score =  364 bits (935), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 127/480 (26%), Positives = 231/480 (48%), Gaps = 33/480 (6%)

Query: 11  MMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVL 70
           ++   L     + + +  + +A    +    V+ G  + + + +N+ I+++      ++ 
Sbjct: 13  LIKAALTGLALACSPMTGLAQAQDLRV----VKQGAAETLDVPMNRAIVVESETPFAELS 68

Query: 71  VSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRF 130
           +++   AD+   S RT+Y+ GK+ G   + L    G+ + N+++ +  D+A  +  L++ 
Sbjct: 69  IANAGIADISSLSDRTIYVLGKSPGLTTLSLFDAGGRLITNVNVRVSFDVAEFKERLKQI 128

Query: 131 IADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNI 190
           + +  I V   +D +VL G   +    QRA++L+E +            + ++V NL+++
Sbjct: 129 LPNEKIEVRTANDGIVLSGTASSTARLQRALDLAERY------------APERVSNLMSV 176

Query: 191 AGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSS-------GPSKSFAADFGGKFVS--- 240
           AG  QV LKV  AE++R + K +     ++G +          S S     GG   +   
Sbjct: 177 AGVQQVMLKVRFAEMQRSVSKSLSASLGVSGGNIVGGLNTLNSSGSLTNAIGGSIPALND 236

Query: 241 EGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSS 300
             G               +L ALER   +RTLAEP L+A+SGQ A F +GG++    V+ 
Sbjct: 237 NAGAILFGFSAGSTQVRLLLEALERKGVVRTLAEPNLSALSGQEAKFLAGGEYPIP-VAQ 295

Query: 301 STGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKA 356
             G  +V    +GV + F P V+    I L +   VS       + VN  D+ +++ R+ 
Sbjct: 296 RDGLFTVEYKPFGVEMAFIPRVVDGDLINLELLAAVSSLDPNNSVTVNGFDIAAFQRRET 355

Query: 357 DTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATP 416
            TTVEL  G +  +AGL++D+     + +P L  +P+LGALFR++ + R +TE+ I  T 
Sbjct: 356 STTVELKDGESFAIAGLIEDEFLDNNQQLPWLGDVPVLGALFRSANYQRSQTELVIIITA 415

Query: 417 FLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKE--ASEVEGQNYKGAIGFIYK 474
            LV P     L+ P D      +A  F   +  +    +   ASEV  Q++ G+ G++ +
Sbjct: 416 HLVSPTRGEALALPTDRVKPPSEADLFLRGKTARTERARGGAASEVARQDFSGSYGYVLE 475


>gi|163738370|ref|ZP_02145785.1| bacterial type II/III secretion system protein [Phaeobacter
           gallaeciensis BS107]
 gi|161388291|gb|EDQ12645.1| bacterial type II/III secretion system protein [Phaeobacter
           gallaeciensis BS107]
          Length = 484

 Score =  364 bits (934), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 125/484 (25%), Positives = 230/484 (47%), Gaps = 35/484 (7%)

Query: 7   TFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDV 66
            F   ++  L   +     +      N   +    V+ G    + + +N+ ++++  V  
Sbjct: 18  AFRRYVAAALTGLSLVCFPVADAAWGNGLRV----VKKGTAANLEVPMNRAVVVESDVPF 73

Query: 67  QDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMT 126
            ++ +++P+ AD+   S RT+Y+ GK+ G   + L+   G+ + N+D+ +  D++  +  
Sbjct: 74  SELSIANPSIADISSLSDRTIYVLGKSPGLTTLTLLDASGRLITNVDVRVAADVSEFKER 133

Query: 127 LRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMN 186
           LR+ +    I V   +D +VL G+V +    QRA++L+E +            + ++V N
Sbjct: 134 LRQILPGEKIEVRTANDGIVLSGVVSSSARLQRALDLAERY------------APERVSN 181

Query: 187 LLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITG-------------SSSGPSKSFAAD 233
           L+++ G  QV LKV  AE++R + K +     + G             ++ G   +  + 
Sbjct: 182 LMSVGGVQQVMLKVRFAEMQRTVSKSLSASLGVKGGNSVGVNGGTSTLNTQGALTNSLSG 241

Query: 234 FGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQH 293
                    G F        F    +L ALE+   +RTLAEP L+A+SGQ A F +GG++
Sbjct: 242 NIPAGNDNTGAFVFGFNAGAFQVNLLLEALEQKGVVRTLAEPNLSALSGQEAKFLAGGEY 301

Query: 294 LYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGV----NAGDMP 349
               V+   G  ++    +G+ L+F P V+    I L ++  VS          N   + 
Sbjct: 302 PIP-VAQEDGIITIEFKPFGIELNFVPRVVDADVINLEMKAAVSAIDPTNSIELNGLSIA 360

Query: 350 SYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETE 409
           ++  R+  TTVEL  G +  +AGL++D+ +     +P +  +P+LG+LFR++ + R +TE
Sbjct: 361 AFSRRETSTTVELRDGESFAIAGLIRDEFRDSSSQLPWIGDVPVLGSLFRSANYQRAQTE 420

Query: 410 IFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAI 469
           + I  +  LV P     LS P D      +++ F   RV K      ASEV  Q++ G+ 
Sbjct: 421 LVIIVSAHLVTPTRGEALSLPTDRIRPPSESELFLMGRVAKGQ-KGPASEVAKQDFNGSY 479

Query: 470 GFIY 473
           G++ 
Sbjct: 480 GYVM 483


>gi|84687277|ref|ZP_01015157.1| Outer membrane general secretion pathway protein, Secretin
           [Maritimibacter alkaliphilus HTCC2654]
 gi|84664710|gb|EAQ11194.1| Outer membrane general secretion pathway protein, Secretin
           [Rhodobacterales bacterium HTCC2654]
          Length = 474

 Score =  363 bits (932), Expect = 3e-98,   Method: Composition-based stats.
 Identities = 136/488 (27%), Positives = 227/488 (46%), Gaps = 38/488 (7%)

Query: 8   FFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQ 67
               +   L     S   +P    A    +       G  + +++ +N+ ++++      
Sbjct: 3   LDRYVKAALTGLALSWITVPLPGMAQTLRVMDG----GVAETLNVPMNRAVVVESDQPFA 58

Query: 68  DVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTL 127
           ++ +++P  AD+   S RT+Y+ GK+ G+  + L+  DG  + N+++ +  D++  +  L
Sbjct: 59  EISIANPGIADISTLSDRTIYVLGKSQGRTTLTLLAPDGTLISNVEVQVTPDLSEFKERL 118

Query: 128 RRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNL 187
           R+ +    I V   +D +VL G V +I    RA++L+E +            +  KV NL
Sbjct: 119 RQILPGEPIEVRTANDGIVLSGTVTSIAALDRALDLAERY------------APDKVSNL 166

Query: 188 LNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSE------ 241
           L++ G  QV LKV  AE++R + K +        + +G   S      G   +       
Sbjct: 167 LSVGGTQQVMLKVRFAEMQRSVTKSLSSSLGFGTNINGLGGSIGTGALGNQANLDAASAG 226

Query: 242 ---------GGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQ 292
                     G F+         F  +L ALE    +RTLAEP LTA+SGQ ASF +GG+
Sbjct: 227 DLISTGNDRTGAFTFGFNAGALQFAVMLEALENKGMVRTLAEPNLTALSGQEASFLAGGE 286

Query: 293 HLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS----EPVIGVNAGDM 348
           +   +V    GA  +    +GV L FTP V+    I L++   VS        G  A  +
Sbjct: 287 YPIPSV-QENGAVVIDYKPFGVELTFTPRVVDQDIINLQMTASVSGLDNSVTYGDGAISV 345

Query: 349 PSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREET 408
            +++ R+  TTVE+  G +  +AGLL+DD + L   +P L  +PILGALFR++ + R ++
Sbjct: 346 NAFKRRETSTTVEMRDGQSFAIAGLLQDDFRDLNGQVPWLGDVPILGALFRSADYERSQS 405

Query: 409 EIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGP--KEASEVEGQNYK 466
           E+ I  TP LV P     L+ P D      +A  F          P    A EV  Q++ 
Sbjct: 406 ELVIIVTPHLVTPTRGEALALPTDRVRPPSEADLFLRGNTAAPNRPTTGAAGEVARQDFT 465

Query: 467 GAIGFIYK 474
           G+ G++ +
Sbjct: 466 GSYGYVME 473


>gi|254466441|ref|ZP_05079852.1| bacterial type II/III secretion system protein [Rhodobacterales
           bacterium Y4I]
 gi|206687349|gb|EDZ47831.1| bacterial type II/III secretion system protein [Rhodobacterales
           bacterium Y4I]
          Length = 468

 Score =  363 bits (931), Expect = 4e-98,   Method: Composition-based stats.
 Identities = 121/484 (25%), Positives = 226/484 (46%), Gaps = 35/484 (7%)

Query: 7   TFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDV 66
                ++  L   +           A +  +    V+ G    + + +N+ ++++  +  
Sbjct: 2   AIRRFVAAALMGLSLIGVPQADGAWAQSLRV----VKKGTAATLDVPMNRAVVVESEIPF 57

Query: 67  QDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMT 126
            ++ +++P+ AD+   S RT+Y+ GK+ G   + L+   G+ + N+D+ +  D+   +  
Sbjct: 58  AELSIANPSIADISSLSDRTIYVLGKSPGLTTLTLLDGSGRLITNVDVRVAADVTEFKQR 117

Query: 127 LRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMN 186
           LR+ + +  I V   +D +VL G V +    QRA++L+E +            + ++V N
Sbjct: 118 LRQILPNEKIEVRTANDGIVLSGTVSSSARLQRALDLAERY------------APERVSN 165

Query: 187 LLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSIT----------GSSSGPSKSFAADFGG 236
           L+++ G  QV LKV  AE++R + K +                  ++   S + A    G
Sbjct: 166 LMSVGGVQQVMLKVRFAEMQRSVSKSLSASLGFNGGTGNGRTGGYNTLNTSGALANSLAG 225

Query: 237 KFVS---EGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQH 293
              +     G F             +L ALE+   +RTLAEP L+A+SGQ A F +GG++
Sbjct: 226 NIPAANENTGAFLFGFNAGSVQVSLLLEALEQKGVVRTLAEPNLSALSGQEAKFLAGGEY 285

Query: 294 LYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVN----AGDMP 349
               V+   G  ++    +G+ L+F P V+    I L +   VS      +       + 
Sbjct: 286 PVP-VAQEGGVITIEFKPFGIELNFIPRVIDGDLINLELNAAVSAIDPTNSLELSGLTID 344

Query: 350 SYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETE 409
           ++  R+  TTVE+  G +  +AGL++D+       +P L  +P+LGALFR++ + RE+TE
Sbjct: 345 AFSRRETSTTVEMRDGESFAIAGLIRDEFLDNSSQLPWLGDVPVLGALFRSADYQREQTE 404

Query: 410 IFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAI 469
           + I  +  LV P     L+ P D  +   +   F F R ++      A+EV  Q++ G+ 
Sbjct: 405 LVIIVSAHLVTPTRGEALTLPTDRVAPPSEKDLFLFGRTSR-NRAGPAAEVAKQDFNGSY 463

Query: 470 GFIY 473
           G++ 
Sbjct: 464 GYVL 467


>gi|227823971|ref|YP_002827944.1| pilus assembly protein CpaC, contains signal peptide [Sinorhizobium
           fredii NGR234]
 gi|227342973|gb|ACP27191.1| pilus assembly protein CpaC, contains signal peptide [Sinorhizobium
           fredii NGR234]
          Length = 515

 Score =  362 bits (929), Expect = 7e-98,   Method: Composition-based stats.
 Identities = 210/517 (40%), Positives = 304/517 (58%), Gaps = 45/517 (8%)

Query: 1   MRYLQRTFFTMMSI----FLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNK 56
           M+    TF T ++      L  S   +  +P  + A ++V+ I +   G  +K+++GLNK
Sbjct: 1   MKRSGNTFRTCLAAGLSFSLTFSGLMLPAVPTAQAAASSVVRIVESGPGVKRKVNLGLNK 60

Query: 57  VIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILI 116
            +++ +P D  D+LV+DP  AD V  + R +YLFGK VGQ N+ + G +G+++++L++ +
Sbjct: 61  AVVVDLPTDAHDILVADPVLADAVTRTSRRIYLFGKTVGQTNIFVFGPNGEEIVSLEVAV 120

Query: 117 ERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQ- 175
           ERD+A LE  LRRFI +++I VE++SD VVL G VRT  DS +AV+L+  FL        
Sbjct: 121 ERDVAGLEANLRRFIPEADINVEIISDNVVLTGTVRTPLDSTKAVDLARAFLQGGEATTR 180

Query: 176 --------------YANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITG 221
                              + +++NLL + GEDQVTLKVT+AEV R +LKQ+GF   I+ 
Sbjct: 181 NITAQGTNGDADIFAEERQTSQIVNLLTVEGEDQVTLKVTVAEVSRQVLKQLGFNGRISD 240

Query: 222 SSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAIS 281
             SG S    A+ G   +  G +  +KG +   +  + ++A+E+A  +RTLAEP+LTAIS
Sbjct: 241 GESGLSFRNPANLG-DAIGVGANALIKGSIGPTTISSYINAMEQAGVMRTLAEPSLTAIS 299

Query: 282 GQSASFTSGGQHLYKTVSSSTGATS-------------VTTHDYGVVLHFTPTVLSPGRI 328
           GQ A F  GG+     V   T                 V   +YG+ L+F P VL  GRI
Sbjct: 300 GQEAKFYVGGEFRLAGVQEITTEEDEATGESVPVVEREVEDAEYGIRLNFKPVVLGAGRI 359

Query: 329 GLRIQTEVSEPVIGVN-----------AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDD 377
            L I+TEVSEP    +                  R R+A T+VELPSGG+IV+AGL++D+
Sbjct: 360 SLAIETEVSEPTYEGSVVTGNSFRDIPGNTFLGIRRREASTSVELPSGGSIVIAGLVQDN 419

Query: 378 IQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVE 437
           I+Q   G+P  SKIPILG LFR+  F R E+E+ I ATP+LV+PVA   LSRPDD+++  
Sbjct: 420 IRQAMSGLPGASKIPILGTLFRSKDFQRNESELVIIATPYLVRPVARSALSRPDDNFNPA 479

Query: 438 DDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
           +D ++FF  RVN+IYG  EA+   G+ Y G +GFIYK
Sbjct: 480 NDLESFFVGRVNRIYGRPEAAPPVGR-YHGNVGFIYK 515


>gi|163757627|ref|ZP_02164716.1| putative pilus assembly transmembrane protein [Hoeflea
           phototrophica DFL-43]
 gi|162285129|gb|EDQ35411.1| putative pilus assembly transmembrane protein [Hoeflea
           phototrophica DFL-43]
          Length = 496

 Score =  362 bits (928), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 213/493 (43%), Positives = 297/493 (60%), Gaps = 27/493 (5%)

Query: 5   QRTFFTMMSIFLFSSN--------PSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNK 56
           +    ++  I L  S         P+  +L    +A+  +I I     G  K++ +GLNK
Sbjct: 8   KSLLSSIAGIALVGSVLVTGVLVDPTTGRLATPAQASQNIIKIKKSGPGVSKRVKLGLNK 67

Query: 57  VIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILI 116
            I++ +P D  D+LV+DP  AD V  + R +YLFGK VGQ N+ + G +G++++ +++ I
Sbjct: 68  AIVVDLPTDAHDILVADPALADAVTRTSRRLYLFGKTVGQTNIFVFGPNGEEIIAIELEI 127

Query: 117 ERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFL-------- 168
           ERD+A LE+ L RF+ DSNI+VE++SD +VL G VRT QD+ +A  L+E FL        
Sbjct: 128 ERDVAGLEVHLARFLPDSNIQVEIISDNIVLTGSVRTPQDASQAARLAEIFLTGGEATTR 187

Query: 169 -------SQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITG 221
                           +    K++NLL I GEDQVTLKVTIAEV R +LKQ+GF  +I+G
Sbjct: 188 VTTATSEGGDAAINAEDRQKSKIVNLLKIDGEDQVTLKVTIAEVSRQVLKQLGFNTTISG 247

Query: 222 SSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAIS 281
             S    +  + +           SV G +        + ALERA  IRTLAEP+LTAIS
Sbjct: 248 DGSSSFGNSPSPWL-SVPGLASVGSVAGTISGARISADISALERAGVIRTLAEPSLTAIS 306

Query: 282 GQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVI 341
           G+ A F+ GG    ++     G T     +YG+ L FTP VL+PGRI LRI+TEVSEP  
Sbjct: 307 GEVARFSVGGSFEIESERDEDG-TIFEEKEYGIKLEFTPVVLAPGRISLRIKTEVSEPTF 365

Query: 342 GVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNS 401
              +  +PS + R+A+T+VELPSGG++VLAGL++D  +Q   G+P  SKIP+LG+LFR+ 
Sbjct: 366 EGQS-PLPSIQKREAETSVELPSGGSMVLAGLVRDSYRQTISGMPGASKIPVLGSLFRSK 424

Query: 402 RFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVE 461
            F R ETE+ I ATP+LVKPVA  +LSRPDD+++   D   FF  RVN++YG  E     
Sbjct: 425 EFLRNETELVIIATPYLVKPVARNELSRPDDNFNAPSDGAGFFLGRVNRVYGQMETGLPA 484

Query: 462 GQNYKGAIGFIYK 474
           G+ Y GA+GFIYK
Sbjct: 485 GR-YHGAVGFIYK 496


>gi|163742213|ref|ZP_02149601.1| bacterial type II/III secretion system protein [Phaeobacter
           gallaeciensis 2.10]
 gi|161384543|gb|EDQ08924.1| bacterial type II/III secretion system protein [Phaeobacter
           gallaeciensis 2.10]
          Length = 484

 Score =  361 bits (927), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 124/484 (25%), Positives = 231/484 (47%), Gaps = 35/484 (7%)

Query: 7   TFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDV 66
            F   ++  L   +     +      N   +    V+ G    + + +N+ ++++  V  
Sbjct: 18  AFRRYVAAALTGLSLVCFPVADAAWGNGLRV----VKKGTAANLEVPMNRAVVVESDVPF 73

Query: 67  QDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMT 126
            ++ +++P+ AD+   S RT+Y+ GK+ G   + L+   G+ + N+D+ +  D++  +  
Sbjct: 74  SELSIANPSIADISSLSDRTIYVLGKSPGLTTLTLLDASGRLITNVDVRVAADVSEFKER 133

Query: 127 LRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMN 186
           LR+ +    I V   +D +VL G+V +    QRA++L+E +            + ++V N
Sbjct: 134 LRQILPGEKIEVRTANDGIVLSGVVSSSARLQRALDLAERY------------APERVSN 181

Query: 187 LLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITG-------------SSSGPSKSFAAD 233
           L+++ G  QV LKV  AE++R + K +     + G             ++ G   +  + 
Sbjct: 182 LMSVGGVQQVMLKVRFAEMQRTVSKSLSASLGVKGGNSVGVNGGTSTLNTQGALTNSLSG 241

Query: 234 FGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQH 293
                    G F        F    +L ALE+   +RTLAEP L+A+SGQ A F +GG++
Sbjct: 242 NIPAANDNTGAFVFGFNAGAFQVNLLLEALEQKGVVRTLAEPNLSALSGQEAKFLAGGEY 301

Query: 294 LYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGV----NAGDMP 349
               V+   G  ++    +G+ L+F P V+    I L ++  VS          N   + 
Sbjct: 302 PIP-VAQEDGVITIEFKPFGIELNFIPRVVDADVINLEMKAAVSAIDPTNSIELNGLSIA 360

Query: 350 SYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETE 409
           ++  R++ TTVE+  G +  +AGL++D+ +     +P +  +P+LG+LFR++ + R +TE
Sbjct: 361 AFSRRESVTTVEMRDGESFAIAGLIRDEFRDNSSQLPWIGDVPVLGSLFRSANYQRAQTE 420

Query: 410 IFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAI 469
           + I  +  LV P     LS P D      +++ F   RV K      ASEV  Q++ G+ 
Sbjct: 421 LVIIVSAHLVTPTRGEALSLPTDRIRPPSESELFLMGRVAKGQ-KGPASEVAKQDFNGSY 479

Query: 470 GFIY 473
           G++ 
Sbjct: 480 GYVM 483


>gi|84501676|ref|ZP_00999848.1| bacterial type II/III secretion system protein [Oceanicola
           batsensis HTCC2597]
 gi|84390297|gb|EAQ02856.1| bacterial type II/III secretion system protein [Oceanicola
           batsensis HTCC2597]
          Length = 474

 Score =  360 bits (923), Expect = 4e-97,   Method: Composition-based stats.
 Identities = 132/490 (26%), Positives = 233/490 (47%), Gaps = 39/490 (7%)

Query: 7   TFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDV 66
           T+ + +   LF    +    P   +A      ++ V      ++++ +N+ ++++  V  
Sbjct: 2   TYSSYLRAALFGMTLATGSFPVTAQAE----RLTIVNRNSESRLNVAINRAVVVESDVSF 57

Query: 67  QDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMT 126
            ++ +++P  AD+   S  ++Y+ GK  G   + L+  +G+ + N+D+++  DI+  +  
Sbjct: 58  AELSIANPQIADISSLSDTSIYVLGKTPGITTLTLLDAEGRLISNVDVVVSADISEFKER 117

Query: 127 LRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMN 186
           LR+ + D  I V   +D +V+ G+V + Q  QRA++L+E +            + ++V N
Sbjct: 118 LRQILPDEKIEVRTANDGIVMSGVVSSSQKLQRALDLAERY------------APERVSN 165

Query: 187 LLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFG----------- 235
           L+++ G  QV LKV  AE++R + K +    +  GS  G +   +   G           
Sbjct: 166 LMSVGGVQQVMLKVRFAEMQRSVSKSLSASLAADGSIFGGNVGVSGGTGRYSNAGNQGNG 225

Query: 236 -----GKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSG 290
                    +  G   +           +L ALE    +RTLAEP LTA+SGQ A F +G
Sbjct: 226 LGGNLPTPNTNSGATLLGFNAGAVQVGVLLEALEAKGVVRTLAEPNLTALSGQEAKFLAG 285

Query: 291 GQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGV----NAG 346
           G++    V+   G  +V    +GV ++F P V+    I L +Q  VS          NA 
Sbjct: 286 GEYPVP-VAQDGGTVTVEFKPFGVEMNFIPRVVDDDIINLELQAAVSAIDPNNGFELNAF 344

Query: 347 DMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNRE 406
            + ++  R+  TTVEL  G +  +AGLL+DD +     +P L  IP++GALFR++ + R 
Sbjct: 345 RIDAFTRRETSTTVELRDGDSFAVAGLLQDDFRDTNSQVPWLGDIPVIGALFRSADYQRN 404

Query: 407 ETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYG--PKEASEVEGQN 464
           ++E+ I  T  LV P     L+ P D      +   F F R  K        A EV  Q+
Sbjct: 405 QSELVIIITAHLVSPTRGEALALPTDRVKPPSEKDLFLFGRTAKDTRKLRGAAKEVAKQD 464

Query: 465 YKGAIGFIYK 474
           + G+ G++ +
Sbjct: 465 FNGSYGYVME 474


>gi|126729098|ref|ZP_01744912.1| bacterial type II/III secretion system protein [Sagittula stellata
           E-37]
 gi|126710088|gb|EBA09140.1| bacterial type II/III secretion system protein [Sagittula stellata
           E-37]
          Length = 473

 Score =  360 bits (923), Expect = 4e-97,   Method: Composition-based stats.
 Identities = 129/488 (26%), Positives = 225/488 (46%), Gaps = 38/488 (7%)

Query: 7   TFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDV 66
           TF   +   L      +A + P   A++  +    V  G    +S+ +N+ ++++     
Sbjct: 2   TFDGYLKAALCGLALGIATMSPPAHADSIRV----VRTGTESVLSVPMNRAVVVESDTPF 57

Query: 67  QDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMT 126
            ++ +++P+ AD+   S RT+Y+ GK  G   + ++   G+ + N+D+ +  D+   +  
Sbjct: 58  AELSIANPSIADISSLSDRTIYVLGKQPGTTTLTILDPQGQLITNVDVRVAADVTEFKER 117

Query: 127 LRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMN 186
           L + + +  I V   +D +VL G V +I   +RA++L++ +            +  +V N
Sbjct: 118 LTQILPEERIEVRTANDGIVLSGTVSSIARMERALDLAQRY------------APDRVSN 165

Query: 187 LLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFV------- 239
           L+ + G  QV LKV  AE+RR + K +    +  GS+            G          
Sbjct: 166 LMVVGGIQQVMLKVRFAEMRRSVSKALRASLATGGSTGDLGVELGTGNAGTLAERDLVAD 225

Query: 240 -------SEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQ 292
                     G               +L ALE    +RTLAEP LTA+SGQ ASF +GG+
Sbjct: 226 KLFPRRLGTEGAVLFGFNAGGLEVGILLEALESKGMVRTLAEPNLTALSGQEASFLAGGE 285

Query: 293 HLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVN----AGDM 348
           +   T       T V    +GV L F P V+    I L ++  VS              +
Sbjct: 286 YPVPTAQGDNSVT-VEFKPFGVELAFVPRVIDGDLINLELEAAVSSVDSANGITFQDVTI 344

Query: 349 PSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREET 408
             +  R+A TTVEL  G +  +AGLL+++   L   +P +  +PILGALFR++ + RE++
Sbjct: 345 AGFARREAKTTVELRDGESFAIAGLLQENFADLNGQVPWIGDVPILGALFRSTEYQREQS 404

Query: 409 EIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVN---KIYGPKEASEVEGQNY 465
           E+ I  TP LV P     L+ P D  ++  + + F   +++   +      A+EV  Q++
Sbjct: 405 ELVIIVTPHLVTPTRGEALALPTDRVTLPSERQLFLNGKIDGNGRRPRSGAAAEVANQDF 464

Query: 466 KGAIGFIY 473
            G+ G++ 
Sbjct: 465 NGSYGYVM 472


>gi|260574616|ref|ZP_05842619.1| type II and III secretion system protein [Rhodobacter sp. SW2]
 gi|259023033|gb|EEW26326.1| type II and III secretion system protein [Rhodobacter sp. SW2]
          Length = 470

 Score =  359 bits (921), Expect = 6e-97,   Method: Composition-based stats.
 Identities = 138/492 (28%), Positives = 240/492 (48%), Gaps = 44/492 (8%)

Query: 4   LQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVP 63
             R F+T     L     +   L P+        ++  +E    + + + LN+ ++++  
Sbjct: 2   FMRNFWT---AGLLGLALATTALSPVAAQ-----SLRVMEGSASRALEVPLNRAVVVESD 53

Query: 64  VDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHL 123
           V   ++ +++P  AD+   S +++Y+ GK  G+  + L+G DG+ + N+++ +  D+A  
Sbjct: 54  VPFAELSIANPGIADISTLSDKSIYVLGKAPGRTTLTLLGPDGRLISNVEVQVSPDVAEF 113

Query: 124 EMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKK 183
           +  LR+ +    I V   +D +VL G V +     RA++L+E +            + ++
Sbjct: 114 KERLRQILPGELIEVRTANDGIVLSGTVSSTAKLDRALDLAERY------------APER 161

Query: 184 VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPS---------------- 227
           V NL+++ G  QV LKV  AE++R + K +    +I GS+ G +                
Sbjct: 162 VSNLMSVGGTQQVMLKVRFAEMQRSVAKNLSASLAINGSTGGGNVGVNAGSGQFTAGGTR 221

Query: 228 -KSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSAS 286
              FA        +  G  ++        F  +L ALE    +RTLAEP LTA+SGQ A 
Sbjct: 222 DGVFAGTSQSGADNSEGVATIGFSAGSLQFAVLLEALESKGVVRTLAEPNLTALSGQEAK 281

Query: 287 FTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVN-- 344
           F +GG++    V+  +G+ SV    +GV ++FTP V+    I L I   VS     V   
Sbjct: 282 FLAGGEYPIP-VADGSGSISVEYKPFGVEMNFTPVVVDGDIINLTINAAVSSIDSTVTVQ 340

Query: 345 --AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSR 402
                + +++ R+  TTVE+  G +  +AGLL+DD + L   +P L  IPILGALFR++ 
Sbjct: 341 NAGFTLNAFKRRETSTTVEMRDGESFAIAGLLQDDFRDLNGQVPWLGDIPILGALFRSAE 400

Query: 403 FNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEG 462
           + R ++E+ I  TP LV P     L+ P D   +  + + F F + +   G     EV  
Sbjct: 401 YQRAQSELVIIVTPHLVTPTRGEALALPTDRIRIPTERELFLFGKTSGARG--ATGEVAR 458

Query: 463 QNYKGAIGFIYK 474
           Q++ G+ G++ +
Sbjct: 459 QDFSGSYGYVME 470


>gi|150398541|ref|YP_001329008.1| type II and III secretion system protein [Sinorhizobium medicae
           WSM419]
 gi|150030056|gb|ABR62173.1| type II and III secretion system protein [Sinorhizobium medicae
           WSM419]
          Length = 524

 Score =  358 bits (919), Expect = 9e-97,   Method: Composition-based stats.
 Identities = 210/507 (41%), Positives = 308/507 (60%), Gaps = 37/507 (7%)

Query: 3   YLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQV 62
             + +     S +L  S  ++    P + A+++V+ I +   G  K I++GLNK +++ +
Sbjct: 20  RFRASLAAGFSFWLIFSGMALPTAAPAEAASSSVVRIVNSGPGARKTINLGLNKAVVVDL 79

Query: 63  PVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAH 122
           P D  D+LV+DP+ AD +  + R +YLFGK+VGQ N+ + G  G+++++L++ +ERD+A 
Sbjct: 80  PSDAHDILVADPSLADAITRTSRRIYLFGKSVGQTNIFVFGPGGEEIVSLEVAVERDVAG 139

Query: 123 LEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQ------- 175
           LE  LRRFI D++I+VE++SD VVL G VRT  DS RAV+L+  FL              
Sbjct: 140 LESNLRRFIPDADIKVEIISDNVVLTGTVRTPLDSTRAVDLARAFLKGGEATTRNITAQG 199

Query: 176 --------YANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPS 227
                     +  S +++NLL I G+DQVTLKVT+AEV R +LKQ+GF   ++   SG S
Sbjct: 200 NNGDADIFAEDRQSSQIVNLLTIEGDDQVTLKVTVAEVSRQVLKQLGFNGRVSDGESGIS 259

Query: 228 KSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASF 287
               A+ G   +  G +  +KG +   +  + ++A+E+A  +RTLAEP+LTAISGQ A F
Sbjct: 260 FRNPANLG-DMIGIGTNALIKGSIGGTTISSYINAMEQAGVMRTLAEPSLTAISGQEAKF 318

Query: 288 TSGGQH---------LYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE 338
             GG+                 +T    V   +YG+ L+F P VL PGRI L+I+T+VSE
Sbjct: 319 YVGGEFRLAGVQEVSTDDDSGETTVEREVNDVEYGIRLNFKPVVLGPGRISLQIETDVSE 378

Query: 339 PV------IGVNAGDMPS-----YRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPL 387
           P        G    ++P       R R+A T+VELPSGG+IV+AGL++D+I+Q   G+P 
Sbjct: 379 PTYEGSVVTGNGTVNIPGNTFLGIRRREASTSVELPSGGSIVIAGLVQDNIRQAMSGLPA 438

Query: 388 LSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNR 447
            SKIPILG LFR+  F R ETE+ I ATP+LV+PVA   +SRPDD+++  +D ++FF  R
Sbjct: 439 ASKIPILGTLFRSKDFQRSETELVIIATPYLVRPVARSAISRPDDNFNPANDLESFFLGR 498

Query: 448 VNKIYGPKEASEVEGQNYKGAIGFIYK 474
           VN+IYG  EA    G+ Y G +GFIYK
Sbjct: 499 VNRIYGRAEAQPPAGR-YHGNVGFIYK 524


>gi|114764946|ref|ZP_01444119.1| bacterial type II/III secretion system protein [Pelagibaca
           bermudensis HTCC2601]
 gi|114542658|gb|EAU45682.1| bacterial type II/III secretion system protein [Roseovarius sp.
           HTCC2601]
          Length = 471

 Score =  358 bits (919), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 132/455 (29%), Positives = 227/455 (49%), Gaps = 32/455 (7%)

Query: 38  NISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQA 97
           ++  V  G    +S+ +N+ ++++      ++ +++P  AD+   S RT+Y+ GK  G  
Sbjct: 29  SLRVVRTGTESVLSVPMNRAVVVESDRPFAELSIANPAIADISSLSDRTIYVLGKTPGTT 88

Query: 98  NVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDS 157
            + ++  +G+ + N+D+ +  D+   +  LR+ + +  I V   +D +VL G + + Q  
Sbjct: 89  TLTILDANGRLITNVDVRVAADVTEFKERLRQILPNEPIEVRTANDGIVLSGTISSAQKL 148

Query: 158 QRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQH 217
           QRA++L+E +            + ++V NL+ + G  QV LKV  AE++R + K +    
Sbjct: 149 QRALDLAERY------------APERVSNLMTVGGVQQVMLKVRFAEMQRSVAKNLRSSL 196

Query: 218 SITGSSSGPSKSFAADFGGKFVSEGGD------------FSVKGVLDRFSFETVLHALER 265
           S+TG+  G  ++  A   G  + + G+            F +           +L ALE 
Sbjct: 197 SVTGTLFGNDETTLASETGTLIGQSGNTSINVNDDAEGAFLLGFNSGALQVGILLEALES 256

Query: 266 ATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSP 325
               RTLAEP LTA+SGQ A F +GG++    VS   G T V+   +GV L+F P V+  
Sbjct: 257 KGISRTLAEPNLTALSGQEARFLAGGEYPVP-VSQDDGTTIVSYKPFGVELNFVPRVVDG 315

Query: 326 GRIGLRIQTEVSEPVI----GVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQL 381
             I L ++  VS              + ++R R+  TTVE+  G +  +AGLL+DD + L
Sbjct: 316 DLINLELEAAVSSIDSSNGITTGEITIDAFRRRETSTTVEMRDGESFAIAGLLQDDFRDL 375

Query: 382 KEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAK 441
              +P L  IP+LGALFR++ + RE++E+ I  TP LV P     L+ P D      +  
Sbjct: 376 NGQVPWLGDIPVLGALFRSAEYEREQSELVIIVTPHLVTPTRGEVLALPTDRVRPPTEKD 435

Query: 442 AFFFNRV---NKIYGPKEASEVEGQNYKGAIGFIY 473
            F + R     +      A+EV  Q++ G+ G++ 
Sbjct: 436 LFLYGRTASDTRRPQSGGAAEVAKQDFTGSYGYVM 470


>gi|222147182|ref|YP_002548139.1| component of type IV pilus [Agrobacterium vitis S4]
 gi|221734172|gb|ACM35135.1| component of type IV pilus [Agrobacterium vitis S4]
          Length = 525

 Score =  358 bits (918), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 213/522 (40%), Positives = 299/522 (57%), Gaps = 51/522 (9%)

Query: 1   MRYLQRTFFTMMSIFLFSSNPSVAKLP----------PIKEANAAVINISDVEIGKGKKI 50
           MR      F MM     S   S++ LP           +     +++ I+    G  + +
Sbjct: 7   MRLSSARLFRMMITGSLSLGLSISGLPGENMLVWRADALAAGAQSLVRIAQTGPGVRRDL 66

Query: 51  SIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQML 110
            +GLNK I++ +P D  D+LV+DP  AD V  + R +YLFGK VGQ N+ + G DG++++
Sbjct: 67  KLGLNKAIVVDLPEDAHDILVADPELADAVTRTSRRIYLFGKKVGQTNIFIFGADGREIV 126

Query: 111 NLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQ 170
           +LD+ IERDI  L+  L RFI +SNI+VE++SD VVL G VRT QDS RAV L++ FL  
Sbjct: 127 SLDLQIERDIEGLQTNLSRFIPESNIKVEIISDNVVLSGTVRTPQDSSRAVSLAKAFLQG 186

Query: 171 SGRNQYANSSSKK------------------VMNLLNIAGEDQVTLKVTIAEVRRDILKQ 212
                   +++                    ++N+L I GEDQVTLKVT+AEV R +LKQ
Sbjct: 187 GEATTRGETATSNSSGDGAVAIYAEDRQTSQIVNMLTIEGEDQVTLKVTVAEVSRQVLKQ 246

Query: 213 IGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTL 272
           +G   S T  +SG S +  ++ G      GG  ++      F     ++A+E+A  +RTL
Sbjct: 247 LGVSASATDGTSGISYANPSNLGNSVD-VGGTATISKTFGSFGISAYVNAMEQAGVMRTL 305

Query: 273 AEPTLTAISGQSASFTSGGQH---------LYKTVSSSTGATSVTTHDYGVVLHFTPTVL 323
           AEP+LTAISG+ A F  GG++            T    T + + +T DYG+ L+F P VL
Sbjct: 306 AEPSLTAISGEQAKFYVGGEYRLAAGQEISTDSTTGQKTVSRTTSTVDYGIQLNFRPVVL 365

Query: 324 SPGRIGLRIQTEVSEPV-----------IGVNAGDMPSYRVRKADTTVELPSGGTIVLAG 372
           SPGRI L I+T VSEP              +      S R R+A TTVELPSGG+IV+AG
Sbjct: 366 SPGRISLAIETNVSEPTYEGSVVEGNSDSSIPGSTYLSIRKREASTTVELPSGGSIVIAG 425

Query: 373 LLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDD 432
           L++D+++Q   G+P +SKIPI G LFR+  F R ETE+ I ATP+LV+PV    L+RPDD
Sbjct: 426 LVQDNVRQAMSGLPGISKIPIFGTLFRSKDFVRNETELVIIATPYLVRPVTRNALARPDD 485

Query: 433 HYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
           +++   D   +F NRVNK+YG KEA+      Y G +G+IYK
Sbjct: 486 NFNPAGDGAMYFLNRVNKVYGRKEAT--ANGAYHGTVGYIYK 525


>gi|163745846|ref|ZP_02153205.1| bacterial type II/III secretion system protein [Oceanibulbus
           indolifex HEL-45]
 gi|161380591|gb|EDQ05001.1| bacterial type II/III secretion system protein [Oceanibulbus
           indolifex HEL-45]
          Length = 478

 Score =  356 bits (914), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 127/488 (26%), Positives = 222/488 (45%), Gaps = 35/488 (7%)

Query: 8   FFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQ 67
               +   L         L     ++A    +  V+ G    + + +N+ ++++  +   
Sbjct: 3   IDRFLKAALLGLTLGAMPLALTLPSSAGADTLRVVKRGTNSSLDVPMNRAVVVESDIPFA 62

Query: 68  DVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTL 127
           ++ +++P  AD+   S RT+Y+ GK+ G   + L+   G+ + N+D+ +  D++  +  L
Sbjct: 63  ELSIANPGIADISSLSDRTIYVLGKSPGLTTLTLLDAGGQLITNVDVRVAADVSEFKERL 122

Query: 128 RRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNL 187
           R+ +    I V   +D +VL G+V + Q  QRA++L+E +            + ++V NL
Sbjct: 123 RQILPGEKIEVRTANDGIVLSGIVSSTQRLQRALDLAERY------------APERVSNL 170

Query: 188 LNIAGEDQVTLKVTIAEVRRDILKQIGFQHSIT-----------GSSSGPSKSFAADFGG 236
           +++ G  QV +KV  AE++R++ K +G   +I              S+  S   A+  GG
Sbjct: 171 MSVGGIQQVMMKVRFAEMQRNVSKSLGSSLAINGAIGGTGINGGTGSTNSSGGVASSLGG 230

Query: 237 KFVS---EGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQH 293
              S     G               +L ALE    +R LAEP L A+SGQ A F +GG++
Sbjct: 231 TIPSSNQNAGAVLFGFNAGSTQVGILLEALEEKGVVRFLAEPNLVALSGQEAKFLAGGEY 290

Query: 294 LYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGV-----NAGDM 348
               V+ +    +V    +GV L F P V+    I L +   VS           N  ++
Sbjct: 291 PVP-VAQTGDTIAVEFKPFGVELAFIPRVVDKDIINLEMNAAVSAIDGSNSIALGNGIEI 349

Query: 349 PSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREET 408
            ++  R+  TTVE+  G +  +AGLL DD       +P +  +P+LGALFR++ + R +T
Sbjct: 350 SAFTRRETSTTVEMRDGESFAIAGLLTDDFTDSTRQLPWIGDVPVLGALFRSADYQRSQT 409

Query: 409 EIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRV---NKIYGPKEASEVEGQNY 465
           E+ I  T  LV P     L  P D      +   F   R     +      A EV  Q++
Sbjct: 410 ELVIIVTAHLVTPTRSEALVLPTDRIKPPSEKDLFLHGRTADGTRTPTRGAAGEVAKQDF 469

Query: 466 KGAIGFIY 473
           +G+ G++ 
Sbjct: 470 RGSYGYVL 477


>gi|260431084|ref|ZP_05785055.1| bacterial type II/III secretion system protein [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260414912|gb|EEX08171.1| bacterial type II/III secretion system protein [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 452

 Score =  356 bits (914), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 130/466 (27%), Positives = 211/466 (45%), Gaps = 31/466 (6%)

Query: 24  AKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHS 83
                   A A  + +     G  + + + +N+ I+++      ++ +++   AD+   S
Sbjct: 1   MSPAGYDAARAENLRVVKK--GTAETLDVPMNRAIVVESETPFAELSIANAGIADISSLS 58

Query: 84  PRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSD 143
            RT+Y+ GK  G   + L    G  + N+ + +  D+   +  LR+ + +  I V   +D
Sbjct: 59  DRTIYVLGKAPGLTTLTLFDGAGNLIANVRVRVAPDVTEFKERLRQILPNERIEVRTAND 118

Query: 144 TVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIA 203
            +VL G V +     RA+EL+E +            + ++V NL+N+ G  QV LKV  A
Sbjct: 119 GIVLSGTVSSSAKLARALELAERY------------APERVSNLMNVGGVQQVMLKVRFA 166

Query: 204 EVRRDILKQIGFQHSITGS-------SSGPSKSFAADFGGKFV---SEGGDFSVKGVLDR 253
           E+ R + K +       GS       S   S S +   G       S  G          
Sbjct: 167 EMNRSVAKSLSASLGFGGSDVTGGINSLNNSFSLSNALGNNIPVSQSNTGAILFGFGAGS 226

Query: 254 FSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYG 313
                +L ALE     R+LAEP L+A+SGQ A+F +GG+     V    G  ++    +G
Sbjct: 227 TQVRLLLEALEAKGLARSLAEPNLSALSGQEATFLAGGEVPIP-VPQDDGVVAIEYKSFG 285

Query: 314 VVLHFTPTVLSPGRIGLRIQTEVSEPVI----GVNAGDMPSYRVRKADTTVELPSGGTIV 369
           V + F P V+    I L +   VS         +N   +PS+  R+  TTVEL  G +  
Sbjct: 286 VEIDFIPRVVDGDLINLEMAASVSAIDTSSDFTINGDSVPSFVTRQTSTTVELRDGESFA 345

Query: 370 LAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSR 429
           +AGL++DD   L   IP L  +P+LGALFR++ + RE++E+ I  T  LV P     L+ 
Sbjct: 346 IAGLIQDDFTDLSNQIPWLGDVPVLGALFRSAEYQREQSELVIIITAHLVSPTRGEALAL 405

Query: 430 PDDHYSVEDDAKAFFFNRVNKIY--GPKEASEVEGQNYKGAIGFIY 473
           P D      +   F   RV++    G   ASEV  Q++  + G++ 
Sbjct: 406 PTDRVKPPSEFDLFLNGRVSRTERAGNGAASEVANQDFGSSYGYVL 451


>gi|254487886|ref|ZP_05101091.1| bacterial type II/III secretion system protein [Roseobacter sp.
           GAI101]
 gi|214044755|gb|EEB85393.1| bacterial type II/III secretion system protein [Roseobacter sp.
           GAI101]
          Length = 486

 Score =  355 bits (912), Expect = 7e-96,   Method: Composition-based stats.
 Identities = 130/489 (26%), Positives = 223/489 (45%), Gaps = 36/489 (7%)

Query: 8   FFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQ 67
               ++  LF        L            +  V  G  + + + +N+ ++++  +   
Sbjct: 10  IDRFITAALFGLTICAMPLALAAPTAVQADTLRVVNRGTNRALEVPMNRAVVVESDIPFA 69

Query: 68  DVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTL 127
           ++ +++P  AD+   S RT+Y+ GK+ G   + L+   G+ + N+D+ +  DI+  +  L
Sbjct: 70  ELSIANPGIADISSLSDRTIYVLGKSPGLTTLTLLDAAGQLITNVDVRVASDISEFKERL 129

Query: 128 RRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNL 187
           R+ +    I V   +D +VL G+V + Q  QRA++L+E +            + ++V NL
Sbjct: 130 RQILPGEKIEVRTANDGIVLSGIVSSTQGLQRALDLAERY------------APERVSNL 177

Query: 188 LNIAGEDQVTLKVTIAEVRRDILKQ----------IGFQHSITGSSSGPSKSFA-----A 232
           +++ G  QV LKV  AE++R + K           +G   +I G ++  + S A      
Sbjct: 178 MSVGGIQQVMLKVRFAEMQRSVSKSLSASLALNGLLGSDLAINGGTNTTNGSTAIANSLN 237

Query: 233 DFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQ 292
                  S  G               +L ALE+  A+R LAEP L A+SGQ A+F +GG+
Sbjct: 238 GSTPTTNSNAGAVLFGFNAGSTQVGLLLEALEQKGAVRFLAEPNLVALSGQEATFLAGGE 297

Query: 293 HLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGV-----NAGD 347
           +      S     SV    +GV + F P V+    I L ++  VS           N  D
Sbjct: 298 YPVPVSQSGD-RISVEYKPFGVEMSFIPRVVDKNLINLELKAAVSAIDPSNSVSLGNGFD 356

Query: 348 MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREE 407
           + ++  R+  TTVE+  G +  +AGLL DD       +P +  +P+LGALFR++ + R +
Sbjct: 357 ISAFTRRETSTTVEMRDGESFAIAGLLTDDFTDTSRQLPWIGDVPVLGALFRSANYQRSQ 416

Query: 408 TEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVN---KIYGPKEASEVEGQN 464
           TE+ I  T  LV P     L+ P D      + + F   R +   K      A EV  Q+
Sbjct: 417 TELVIIITAHLVTPTRGDALALPTDRIKPPTENELFLSGRTSSGGKAPTRGAAGEVAKQD 476

Query: 465 YKGAIGFIY 473
           + G+ G++ 
Sbjct: 477 FSGSYGYVL 485


>gi|254510970|ref|ZP_05123037.1| bacterial type II/III secretion system protein [Rhodobacteraceae
           bacterium KLH11]
 gi|221534681|gb|EEE37669.1| bacterial type II/III secretion system protein [Rhodobacteraceae
           bacterium KLH11]
          Length = 476

 Score =  355 bits (910), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 129/483 (26%), Positives = 221/483 (45%), Gaps = 33/483 (6%)

Query: 7   TFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDV 66
           T  + +S  L   +  V+ +     A     N+  V+ G  + + + +N+ I+++     
Sbjct: 10  TIRSWISATLLGLSLVVSPIGDAAWAQ----NLRVVKKGTAESLDVPVNRAIVVESEQPF 65

Query: 67  QDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMT 126
            D+ +++   AD+   S RT+Y+ G+  G   + +    G  + N+ + +  D+   +  
Sbjct: 66  ADISIANAGIADISTLSDRTIYVLGRAPGITTLTMFDGAGNLITNVRVRVSPDVTEFKER 125

Query: 127 LRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMN 186
           LR+ + +  I V   +D +VL G V +     RA+EL+E +            + ++V N
Sbjct: 126 LRQILPNEQIEVRTANDGIVLSGTVSSSARLARALELAERY------------APERVSN 173

Query: 187 LLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITG----------SSSGPSKSFAADFGG 236
           LLN+ G  QV LKV  AE+ R + K +       G          ++ G   +  A+   
Sbjct: 174 LLNVGGVQQVMLKVRFAEMNRSVAKNLSASLGFGGGDATGGFNSLNNQGALNNALANNIP 233

Query: 237 KFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYK 296
              +  G               +L ALE    +R+LAEP L+A+SGQ A F +GG+    
Sbjct: 234 FVQTNSGAVLFGFGAGSTQVRLLLEALETKGLVRSLAEPNLSALSGQEAEFLAGGEVPIP 293

Query: 297 TVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVI----GVNAGDMPSYR 352
            V    G  ++    +GV L F P V+    I L +   VS         +N   +PS+ 
Sbjct: 294 -VPQGDGVVAIEYRQFGVQLLFVPRVVDGNLINLELGASVSSIDQSSDFTINGDSVPSFI 352

Query: 353 VRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFI 412
            R+  TT+EL  G +  +AGL++DD   L   +P L  +P+LGALFR++++ RE++E+ I
Sbjct: 353 TRQTRTTIELRDGESFAIAGLIQDDFTDLNTQVPWLGDVPVLGALFRSAQYQREQSELII 412

Query: 413 AATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIY--GPKEASEVEGQNYKGAIG 470
             T  LV P     L+ P D      +   F   +V +    G   ASEV  Q++  + G
Sbjct: 413 IITAHLVSPTRGEALALPTDRVKPPSEFDLFVNGKVARTERAGNGAASEVAKQDFGTSYG 472

Query: 471 FIY 473
           ++ 
Sbjct: 473 YVL 475


>gi|92116013|ref|YP_575742.1| type II and III secretion system protein [Nitrobacter hamburgensis
           X14]
 gi|91798907|gb|ABE61282.1| type II and III secretion system protein [Nitrobacter hamburgensis
           X14]
          Length = 486

 Score =  355 bits (910), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 172/486 (35%), Positives = 269/486 (55%), Gaps = 28/486 (5%)

Query: 4   LQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVP 63
           LQ      +S    ++      L P+  ++  V   +       + +S+G+ K +++ +P
Sbjct: 10  LQAIVARSLSFAAIAAFTLNPALTPVFASDYRVPAATAGAKMHAQSLSLGIGKSVVVDLP 69

Query: 64  VDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHL 123
            DV+DVLV+DP  A+ VV S +  Y+ G  VGQ N+I     G+Q+   DI + RD+  L
Sbjct: 70  RDVKDVLVADPKIANAVVRSAQRAYIIGAAVGQTNIIFFDGSGQQISAYDIAVTRDLNGL 129

Query: 124 EMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKK 183
              L++ + +++I+++ + D VVL G  ++  +SQ+A +L+                + K
Sbjct: 130 RAALKQILPNADIKIDGLGDGVVLSGWAQSPVESQQAADLAARLAGG----------ADK 179

Query: 184 VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFG-------- 235
           V+N + + G DQV LKV +AEV+RDI+KQ+G   S   S      +F             
Sbjct: 180 VVNSIAVRGRDQVMLKVVVAEVQRDIIKQLGVDLSANLSYGTAVVNFNNSNPFLATGSAL 239

Query: 236 --GKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQH 293
             G  V  G   S+   +   + +  L A+E +  IRTLAEP+LTAISG+SA+F +GG+ 
Sbjct: 240 VPGNSVVGGFGKSIINGVTMPTVQATLRAMENSGVIRTLAEPSLTAISGESANFLAGGEF 299

Query: 294 LYKTVSS---STGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEP----VIGVNAG 346
              +  S    T   +VT   +G+ L+FTP VLS GRI LR+ TE SE      I ++  
Sbjct: 300 PIPSGVSCTNGTCTPTVTFKKFGISLNFTPVVLSEGRISLRVATEASEVNNENAIQISGT 359

Query: 347 DMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNRE 406
            +PS + R+ADTT+E+PSGG++V+AGL+K   +Q   G+P +S+IP+LG LFR+  +   
Sbjct: 360 AVPSIKTRRADTTLEIPSGGSMVMAGLIKQQTKQSISGMPGVSQIPVLGTLFRSRDYVNN 419

Query: 407 ETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYK 466
            TE+ I  TP++V+ VA +DLSRPDD ++   D +A     +N+IYG    +E   Q Y+
Sbjct: 420 NTELMILVTPYVVRAVAQKDLSRPDDGFADASDPQADLLGSINRIYGVPGRAEPARQ-YR 478

Query: 467 GAIGFI 472
           G  GFI
Sbjct: 479 GTYGFI 484


>gi|85859139|ref|YP_461341.1| flp pilus assembly protein, secretin [Syntrophus aciditrophicus SB]
 gi|85722230|gb|ABC77173.1| flp pilus assembly protein, secretin [Syntrophus aciditrophicus SB]
          Length = 503

 Score =  355 bits (910), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 134/509 (26%), Positives = 229/509 (44%), Gaps = 49/509 (9%)

Query: 5   QRTFFTMMSIFLFSSNPSVAKL-PPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVP 63
            R    +   F+     S+A          AA  +   V   + +K+++ + K  I++ P
Sbjct: 1   MRPCPGLKVHFVACCLISIALCFLIALPCVAAGPDRVVVNTSRPQKLTLTVGKSTIVECP 60

Query: 64  VDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHL 123
            +++ V ++ P  AD++  SPR +YL GK  G  N+ L   D   M  +D+ +  D+  L
Sbjct: 61  QNLKRVSIAAPDYADILTLSPRQIYLTGKMAGNTNLTLWRSDNSVMSVIDVEVLPDVVGL 120

Query: 124 EMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSK 182
           +  +   + D  +IRV    D + L G V +  +  + + L+ ++  +          + 
Sbjct: 121 KEKIHSMMPDEKDIRVTATPDAITLSGTVSSAANMNQVMSLANSYAPK------GKDKTG 174

Query: 183 KVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSK-------------- 228
            V N L + G  QV L+V ++E+ R ++K++G   +                        
Sbjct: 175 GVNNFLEVGGVHQVMLEVRVSEMSRSLIKKLGINWNYLSEGGNTFGMSMLDNLTYTVSPS 234

Query: 229 ------------SFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPT 276
                       S  A   G  VS     + +      ++   + A++    ++ LAEPT
Sbjct: 235 DANIQPMTHLSASEGAVSVGTLVSSSVGLAFRFFGGGATWTLFIDAMKDQGLLKVLAEPT 294

Query: 277 LTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEV 336
           L  +SG++ASF +GG+             ++    +GV L+FTPTVLS  +I +++  EV
Sbjct: 295 LLTLSGKTASFLAGGEFPIPVPQEEN--ITIEYKPFGVGLNFTPTVLSNKKISMQVSPEV 352

Query: 337 SEPV----IGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIP 392
           S+      + V    +PS   R+  TTVEL  G +  +AGLLKDDI+Q+   +PLL  IP
Sbjct: 353 SDLDYTNAVAVGGYAVPSITTRRVATTVELADGQSFAIAGLLKDDIRQIVRKVPLLGDIP 412

Query: 393 ILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIY 452
           +LG+LFR+S+F + ETE+ I  TP LVKP+ M   + P D Y   +D + +    +    
Sbjct: 413 VLGSLFRSSQFRKNETELVIIVTPRLVKPLDMTKQTLPTDQYVEPNDFEFYLLGSLEGKG 472

Query: 453 GPKEASEVE---------GQNYKGAIGFI 472
               A+                +G  G+I
Sbjct: 473 ENDSATPTPVSSALPGDKTGGLEGDFGYI 501


>gi|325291659|ref|YP_004277523.1| component of type IV pilus [Agrobacterium sp. H13-3]
 gi|325059512|gb|ADY63203.1| component of type IV pilus [Agrobacterium sp. H13-3]
          Length = 527

 Score =  354 bits (907), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 207/494 (41%), Positives = 302/494 (61%), Gaps = 41/494 (8%)

Query: 20  NPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADV 79
           +P+  ++   +  +A+++ I++   G  K++ +GLNK +++ +P D  D+LV+DP+ AD 
Sbjct: 36  SPAFLRISEAEAQSASIVRITESGSGIRKRLKLGLNKALVIDLPEDAHDILVADPSLADA 95

Query: 80  VVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVE 139
           V  + + +YLFGK VGQ N+ + G  G+++++LD+ +ERDI+ LE  +RRFI +S+I+VE
Sbjct: 96  VTRTSKRIYLFGKTVGQTNIFIFGDGGREIVSLDLEVERDISGLEANIRRFIPESDIKVE 155

Query: 140 MVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQ-----------------YANSSSK 182
           +VSD +VL G VRT QDS RAV+L+E FL                          N  + 
Sbjct: 156 IVSDNIVLTGSVRTPQDSARAVQLAEAFLKGGEATTRNISLTGGNNGGDAAIFAENRQTS 215

Query: 183 KVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFA--ADFGGKFVS 240
           +++N+L I GEDQVTLKVT+AEV R +LKQ+GF  SI+ S+S     F+  ++ G     
Sbjct: 216 QIVNMLTIEGEDQVTLKVTVAEVSRQVLKQLGFNGSISSSTSNNGFEFSNPSNLGNAISG 275

Query: 241 EGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYK---- 296
                S        +F + L+A+E+A  +RTLAEP+LTAISG+ A F  GG         
Sbjct: 276 ASRIASGAIGSGSLNFASYLNAMEQAGVVRTLAEPSLTAISGEQAKFYVGGDFRLPAEQE 335

Query: 297 -----TVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVN------- 344
                     T   +  T DYG+ L+F P VLSPGRI L+I+T VSEP    N       
Sbjct: 336 VTIDKDTGQPTITRTTNTVDYGITLNFRPVVLSPGRISLKIETNVSEPTYEGNVVTGNAG 395

Query: 345 ----AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRN 400
                    S R R+  TTVELPSGG+IV+AGL++D+I+Q   G+P +SK+PI G LFR+
Sbjct: 396 RTIPGSTYMSIRKRETSTTVELPSGGSIVIAGLVQDNIRQAMSGLPGISKVPIFGTLFRS 455

Query: 401 SRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEV 460
             F R ETE+ I ATP+LV+PVA   ++RPDD+++ E+DA  +F NRVNK+YG K+   V
Sbjct: 456 KDFIRNETELVIIATPYLVRPVARNQIARPDDNFNPENDAAMYFMNRVNKVYGRKDQ--V 513

Query: 461 EGQNYKGAIGFIYK 474
           +   Y+G++GFIYK
Sbjct: 514 QAAPYQGSVGFIYK 527


>gi|153008059|ref|YP_001369274.1| type II and III secretion system protein [Ochrobactrum anthropi
           ATCC 49188]
 gi|151559947|gb|ABS13445.1| type II and III secretion system protein [Ochrobactrum anthropi
           ATCC 49188]
          Length = 507

 Score =  353 bits (906), Expect = 3e-95,   Method: Composition-based stats.
 Identities = 192/509 (37%), Positives = 285/509 (55%), Gaps = 37/509 (7%)

Query: 1   MRYLQRTFFTMMSIFLFSSNPSVAKLPPIKE-ANAAVINISDVEIGKGKKISIGLNKVII 59
           MR  +R       + L +S  +   LP     A AA   +      + + I +GLNK ++
Sbjct: 1   MRKTKRVRPYSAKVALLTSALAAFSLPLTDMSAMAAAGVVKVGSQQRSQTIKLGLNKSVV 60

Query: 60  LQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERD 119
           L +P D  DVLVS+PT AD V  + R +YLFGK VGQ N+ + G +G+Q+ ++D+ IERD
Sbjct: 61  LDLPQDAYDVLVSNPTIADAVTRTSRRIYLFGKQVGQTNIFVFGPNGEQVASIDVEIERD 120

Query: 120 IAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYA-- 177
           ++ +   L+R I  S+IRVE+++D VVL G V+T QDS +A +L+  F+S          
Sbjct: 121 VSGISSQLKRLIPGSDIRVELINDNVVLTGTVQTPQDSAQAAKLAGLFVSGGEATTGQFT 180

Query: 178 -------------------NSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHS 218
                              N  +  ++N+L I GEDQVTLKVT+AEV R ++KQ+G   +
Sbjct: 181 TTASAPTDGGGVAINNPDRNRRASAIVNMLTIVGEDQVTLKVTVAEVSRSVMKQLGVNMA 240

Query: 219 ITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLT 278
            +G S+G S    ++     +      +  G+    +F   L A+E A  ++TLAEPTLT
Sbjct: 241 GSGVSNGISYGGISESIAGAIGNNLSDTGFGLATS-NFSAYLRAMESAGVMKTLAEPTLT 299

Query: 279 AISGQSASFTSGGQHLYKTV----SSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQT 334
           AISG+ A+F  GG++                 +   +YG+ L F PTVL PGRI L+I+T
Sbjct: 300 AISGEKAAFNVGGEYNVINSVKYDDDGKRTNELAKINYGIGLEFMPTVLGPGRISLKIRT 359

Query: 335 EVSEPVIGVNAGD---------MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGI 385
            VSEP                 + S R R ADTTVELPSGG++++ GL++D+++Q   G 
Sbjct: 360 SVSEPTTEGAGTTNKMDGVGASVLSLRKRVADTTVELPSGGSMMIGGLIRDEVRQSVSGF 419

Query: 386 PLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFF 445
           P L+KIP+LGALFR+  F R E+E+ +  TP+L +PVA + L+RPDD+ +   D   +  
Sbjct: 420 PGLTKIPVLGALFRSKDFIRNESELVVIVTPYLARPVARQQLARPDDNLNPASDGAGYIL 479

Query: 446 NRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
            +VN++YG  E     G+ Y G +G+IYK
Sbjct: 480 GKVNRVYGTMETKLPPGR-YNGVVGYIYK 507


>gi|83943939|ref|ZP_00956396.1| bacterial type II/III secretion system protein [Sulfitobacter sp.
           EE-36]
 gi|83954512|ref|ZP_00963223.1| bacterial type II/III secretion system protein [Sulfitobacter sp.
           NAS-14.1]
 gi|83840796|gb|EAP79967.1| bacterial type II/III secretion system protein [Sulfitobacter sp.
           NAS-14.1]
 gi|83845186|gb|EAP83066.1| bacterial type II/III secretion system protein [Sulfitobacter sp.
           EE-36]
          Length = 479

 Score =  353 bits (906), Expect = 3e-95,   Method: Composition-based stats.
 Identities = 123/486 (25%), Positives = 224/486 (46%), Gaps = 36/486 (7%)

Query: 11  MMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVL 70
            +   L                +A    +  V+ G  + + + +N+ ++++  +   ++ 
Sbjct: 6   FIKAALLGLTIGAMPFALTAPIDAQANTLRVVKKGTNRVLEVPMNRAVVVESDIPFAELS 65

Query: 71  VSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRF 130
           +++P  AD+   S RT+Y+ GK+ G   + L+   G+ + N+D+ +  D++  +  LR+ 
Sbjct: 66  IANPGIADISSLSDRTIYVLGKSPGLTTLTLLDAAGQLITNVDVRVAADVSEFKERLRQI 125

Query: 131 IADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNI 190
           +    I V   +D +VL G+V + Q  QRA++L+E +            + ++V NL+++
Sbjct: 126 LPGEKIEVRTANDGIVLSGIVSSTQRLQRALDLAERY------------APERVSNLMSV 173

Query: 191 AGEDQVTLKVTIAEVRRDILKQIGFQHSITG---------------SSSGPSKSFAADFG 235
            G  QV +KV  AE+ R + K +    ++ G               +++G   +      
Sbjct: 174 GGIQQVMMKVRFAEMSRSVSKSLSASLALNGLVGNDLAINGGTNTTNTAGAIANSLGGTT 233

Query: 236 GKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLY 295
               S  G               +L ALE+  A+R LAEP L A+SGQ A+F +GG++  
Sbjct: 234 PASNSNAGAVLFGFNAGSTQVGLLLEALEQKGAVRFLAEPNLVALSGQEATFLAGGEYPV 293

Query: 296 KTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGV-----NAGDMPS 350
             V+ +    SV    +GV + F P V+    I L ++  VS           N  D+ +
Sbjct: 294 P-VAQTGDQISVQYKPFGVEMSFIPRVVDKDLINLELKAAVSAIDASNSVSLGNGFDISA 352

Query: 351 YRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEI 410
           +  R+  TTVE+  G +  +AGLL DD       +P +  +P+LGALFR++ + R ++E+
Sbjct: 353 FTRRETSTTVEMRDGESFAIAGLLTDDFTDNSSQLPWIGDVPVLGALFRSANYQRSQSEL 412

Query: 411 FIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPK---EASEVEGQNYKG 467
            I  T  LV P     L+ P D      +++ F   R +K         A EV  Q++ G
Sbjct: 413 VIIITAHLVTPTRGEALALPTDRIKPPTESELFLSGRTSKGSTAPTKGAAGEVAKQDFSG 472

Query: 468 AIGFIY 473
           + G++ 
Sbjct: 473 SYGYVL 478


>gi|254440636|ref|ZP_05054129.1| Putative phospholipid-binding domain family [Octadecabacter
           antarcticus 307]
 gi|198250714|gb|EDY75029.1| Putative phospholipid-binding domain family [Octadecabacter
           antarcticus 307]
          Length = 474

 Score =  353 bits (906), Expect = 3e-95,   Method: Composition-based stats.
 Identities = 135/489 (27%), Positives = 223/489 (45%), Gaps = 39/489 (7%)

Query: 7   TFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDV 66
           T+   +   L         LP   +A    +            +++ +N+ ++++  V  
Sbjct: 2   TYDRFLKATLTGLAIMFTNLPVQLQAETLRVMRG----APSSALNVPMNRAVVVESDVPF 57

Query: 67  QDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMT 126
            ++ +++P+ AD+   S RT+Y+ GK  G+  + L+G DG+ + N+++ +  DIA  +  
Sbjct: 58  TELSIANPSIADISSLSDRTIYVLGKEPGRTTLTLLGGDGRLITNVEVHVTPDIAEFKER 117

Query: 127 LRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMN 186
           L + +   NI V   +D +VL G V +I    RA+EL+  +            +  +V N
Sbjct: 118 LEQILPGENIEVRTANDGIVLSGTVSSIARLDRALELANRY------------APDRVSN 165

Query: 187 LLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGS----------------SSGPSKSF 230
           L+++ G  QV L+V  AE++R + K +    ++ GS                 +    S 
Sbjct: 166 LMSVGGTQQVMLRVRFAEMQRSVSKSLSSSLALGGSTLGGDLGLALGTGATVGNTGRLST 225

Query: 231 AADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSG 290
            +          G F             +L ALE    +RTLAEP LTA+SGQ ASF +G
Sbjct: 226 LSGATPANNDNAGAFLFGFNAGGVEVGILLEALENRGVVRTLAEPNLTALSGQEASFLAG 285

Query: 291 GQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGV----NAG 346
           G++        +  T V    +G+ L FTP V+    I L +   VS          N  
Sbjct: 286 GEYPVPISQDGSAIT-VEYKPFGISLSFTPRVIDGDIINLELHASVSSLDPTNGFSQNGF 344

Query: 347 DMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNRE 406
            + ++R R+  TTVE+  G +  +AGLL DD   L   +P    IP+LGALFR++ ++R+
Sbjct: 345 SIDAFRTRETSTTVEMRDGESFAIAGLLSDDFVDLSGQVPWAGDIPVLGALFRSAEYSRQ 404

Query: 407 ETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRV--NKIYGPKEASEVEGQN 464
           +TE+ I  TP LV P     L+ P D      +   F F RV          A EV  Q+
Sbjct: 405 QTELVIIVTPHLVTPTRGDALALPTDRVRPPTERDLFLFGRVTAEDAPQSGGAGEVARQD 464

Query: 465 YKGAIGFIY 473
           + G+ G++ 
Sbjct: 465 FSGSYGYVL 473


>gi|110679396|ref|YP_682403.1| type II/III secretion system protein, putative [Roseobacter
           denitrificans OCh 114]
 gi|109455512|gb|ABG31717.1| type II/III secretion system protein, putative [Roseobacter
           denitrificans OCh 114]
          Length = 463

 Score =  353 bits (906), Expect = 4e-95,   Method: Composition-based stats.
 Identities = 123/471 (26%), Positives = 218/471 (46%), Gaps = 22/471 (4%)

Query: 11  MMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVL 70
           ++   L     SV+ +      +A    +  +     + +++  N+ ++++  +   ++ 
Sbjct: 6   ILKAALLGLAISVSPIAFTAPLSAQAEALRIIARETSETLNVSQNRAVVVESEIPFAELS 65

Query: 71  VSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRF 130
           +++P  AD+   S R++Y+ GK  G   + L+   G+ + N+++ +  D+   +  LR+ 
Sbjct: 66  IANPGIADISSLSDRSIYVLGKVPGITTLTLLDAAGQLITNVEVRVAPDLTEFKERLRQI 125

Query: 131 IADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNI 190
           +    I V   +D +VL G V + Q   +A+EL+  +            +  +V NL+ +
Sbjct: 126 LPGEAIEVRTANDGIVLSGQVSSSQRLSKALELAARY------------APDRVSNLMTV 173

Query: 191 AGEDQVTLKVTIAEVRRDILKQIGFQHSITGS--SSGPSKSFAADFGGKFVSEGGDFSVK 248
            G  QV LKV  AE+ R + KQ+     I GS   +G  +           S  G     
Sbjct: 174 GGVQQVMLKVRFAEMSRGVSKQLQSSLRIGGSDAQAGIGRGIGGIPNLAADSAQGAVFFD 233

Query: 249 GVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVT 308
             L     + +L ALE   A+RTLAEP L ++SGQ A+F +GG++       S    SV 
Sbjct: 234 FGLGSTQVQLLLEALETKGAVRTLAEPNLVSLSGQEANFLAGGEYPVPV--QSEDGISVD 291

Query: 309 THDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVN-----AGDMPSYRVRKADTTVELP 363
              +G+ L+F P V+    I L++    S               + ++  R+A TTVE+ 
Sbjct: 292 FKPFGIELNFVPRVVDGDLINLQLSAATSSIDPSNGISVGDGFTVDAFIRREASTTVEMR 351

Query: 364 SGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVA 423
            G +  +AGLL+D+       +P +S +PILGALFR++ + R +TE+ I  T  LV P  
Sbjct: 352 DGESFAIAGLLEDNFNDNITQVPWISDVPILGALFRSTDYMRNQTELVIIITAHLVTPTR 411

Query: 424 MRDLSRPDDHYSVEDDAKAFFFNR-VNKIYGPKEASEVEGQNYKGAIGFIY 473
              L+ P D      +   F   R +  +     A EV  Q++ G+ G++ 
Sbjct: 412 GEALALPTDRIRPPSEKDLFLNGRTIETLNARGSAGEVAKQDFSGSYGYVM 462


>gi|239833237|ref|ZP_04681566.1| type II and III secretion system protein [Ochrobactrum intermedium
           LMG 3301]
 gi|239825504|gb|EEQ97072.1| type II and III secretion system protein [Ochrobactrum intermedium
           LMG 3301]
          Length = 507

 Score =  353 bits (905), Expect = 5e-95,   Method: Composition-based stats.
 Identities = 192/509 (37%), Positives = 281/509 (55%), Gaps = 37/509 (7%)

Query: 1   MRYLQRTFFTMMSIFLFSSNPSVAKLPPIKE-ANAAVINISDVEIGKGKKISIGLNKVII 59
           MR   R       I L +   +   LP     A AA   +      + + I +GLNK ++
Sbjct: 1   MRKTNRVRPYSARIALLAGALATVSLPLADMTAMAAAGIVKVGSQQRSQTIKLGLNKSVV 60

Query: 60  LQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERD 119
           L +P D  DVLVS+PT AD V  + R +YLFGK VGQ N+ + G +G+Q+ ++D+ IERD
Sbjct: 61  LDLPQDAYDVLVSNPTIADAVTRTSRRIYLFGKQVGQTNIFVFGQNGEQVASIDVEIERD 120

Query: 120 IAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYA-- 177
           ++ L   L+R I  S+IRVE+++D VVL G V+T QDS +A +L+  F+S          
Sbjct: 121 VSGLSSQLKRLIPGSDIRVELINDNVVLTGTVQTPQDSAQAAKLAGLFVSGGEATTGQYS 180

Query: 178 -------------------NSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHS 218
                                    ++N+L I GEDQVTLKVT+AEV R ++KQ+G   +
Sbjct: 181 TTASAPTDGGGVAINNPDWGRRQSAIVNMLTIVGEDQVTLKVTVAEVSRSVMKQLGVNMT 240

Query: 219 ITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLT 278
            +G S+G S    ++     +      +  G+    +F   L A+E A  ++TLAEPTLT
Sbjct: 241 GSGVSNGISYGGISENIAGAIGNNLSDTGFGLATS-NFSAYLRAMESAGVMKTLAEPTLT 299

Query: 279 AISGQSASFTSGGQHL----YKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQT 334
           AISG+ A+F  GG++                 +   +YG+ L F PTVL PGRI L+I+T
Sbjct: 300 AISGEKAAFNVGGEYNVINSVTYDDDGKRTNQLAKINYGIGLEFMPTVLGPGRISLKIRT 359

Query: 335 EVSEPVIGVNAGD---------MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGI 385
            VSEP                 + S R R ADTTVELPSGG++++ GL++D+++Q   G 
Sbjct: 360 SVSEPTTEGAGTTNKMEGVGASVLSLRKRVADTTVELPSGGSMMIGGLIRDEVRQSVSGF 419

Query: 386 PLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFF 445
           P L+KIP+LGALFR+  F R E+E+ +  TP+L +PVA + L+RPDD+ +   D   +  
Sbjct: 420 PGLTKIPVLGALFRSKDFIRNESELVVIVTPYLARPVARQQLARPDDNLNPASDGAGYIL 479

Query: 446 NRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
            +VN++YG  E     G+ Y G +G+IYK
Sbjct: 480 GKVNRVYGTMETKLPPGR-YNGVVGYIYK 507


>gi|254463467|ref|ZP_05076883.1| bacterial type II/III secretion system protein [Rhodobacterales
           bacterium HTCC2083]
 gi|206680056|gb|EDZ44543.1| bacterial type II/III secretion system protein [Rhodobacteraceae
           bacterium HTCC2083]
          Length = 474

 Score =  352 bits (904), Expect = 5e-95,   Method: Composition-based stats.
 Identities = 137/492 (27%), Positives = 230/492 (46%), Gaps = 42/492 (8%)

Query: 5   QRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPV 64
            +   T+ + FL  +    A + P       ++       G    + I +N+ ++++  V
Sbjct: 1   MKKLNTLRAAFLGCAVLFTASVAPAHADTLRIVRS-----GSSSTLPIPMNRAVVVESDV 55

Query: 65  DVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLE 124
              ++ +++P+ AD+   S RT+Y+ GK+ G   + L+   G+ + N+D+ +  D++  +
Sbjct: 56  PFAELSIANPSIADISTLSDRTVYVLGKSPGLTTLTLLDDAGRLITNVDVRVSADVSEFK 115

Query: 125 MTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKV 184
             LR+ +    I V   +D +VL G V +     RA++L++ +            + ++V
Sbjct: 116 ERLRQILPGEKIEVRTANDGIVLSGTVSSAGKVDRAMDLAQRY------------APERV 163

Query: 185 MNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGG-------- 236
            NLL+++G  QV LKV  AE++R + K +    ++ GS+ G + S               
Sbjct: 164 TNLLSVSGVQQVMLKVRFAEMQRSVSKSLSSSLALGGSALGGNLSVRGGTNTLASGAASS 223

Query: 237 --------KFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFT 288
                      +  G               +L ALE    +RTLAEP LTA+SGQ A F 
Sbjct: 224 AAIAGTAPANNANNGATLFGFNAGGLEVGILLEALESKGMVRTLAEPNLTALSGQEAKFL 283

Query: 289 SGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVN---- 344
           +GG++     SSS     +    +GV L F P VL    I L +  EVS           
Sbjct: 284 AGGEYPIPVQSSSG--VQIQFKPFGVQLAFIPRVLDDKVINLELNAEVSSLDAANGIVSD 341

Query: 345 AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFN 404
              +   +VR+  TTVE+  G +  +AGLL+DD   L   +P L  IP+LGALFR++ + 
Sbjct: 342 GFAISGLKVRRTSTTVEMRDGESFAIAGLLQDDFTDLSGQVPWLGDIPVLGALFRSADYK 401

Query: 405 REETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRV---NKIYGPKEASEVE 461
           RE++E+ I  TP LV P     L+ P D  S   +   F F RV   ++      A+EV 
Sbjct: 402 REQSELVIIVTPHLVTPTRGEALALPTDRISPPTEKDLFLFGRVTGDSRRPKKGAAAEVA 461

Query: 462 GQNYKGAIGFIY 473
            Q++ G+ G++ 
Sbjct: 462 RQDFTGSYGYVM 473


>gi|149200847|ref|ZP_01877822.1| bacterial type II/III secretion system protein [Roseovarius sp.
           TM1035]
 gi|149145180|gb|EDM33206.1| bacterial type II/III secretion system protein [Roseovarius sp.
           TM1035]
          Length = 472

 Score =  352 bits (902), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 126/466 (27%), Positives = 213/466 (45%), Gaps = 35/466 (7%)

Query: 28  PIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTM 87
             + A A  I +          +S+ +N+ ++++      ++ +++P  AD    S RT+
Sbjct: 21  APQPAQAESIRVVRNGTSSA--LSVAMNRAVVVESDSPFAELSIANPAIADFSTLSERTI 78

Query: 88  YLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVL 147
           Y+ GK  G+  + L    GK + N+D+ +  DI   +  L++ +    I V   +D +V+
Sbjct: 79  YVLGKTPGRTTLSLFDGLGKLITNIDVHVSTDIEEFKERLKQILPGEPIEVRSANDGIVI 138

Query: 148 HGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRR 207
            G V +    QRA++L+E +            + ++V NL++++G+ QV LKV  AE++R
Sbjct: 139 SGTVSSTSRMQRALDLAERY------------APERVSNLMSVSGKQQVMLKVRFAEMQR 186

Query: 208 DILKQIGFQHSITGSSSGPSKSFAADFGGKFVS---------------EGGDFSVKGVLD 252
            + K +    SI    +                                   F+    + 
Sbjct: 187 SVSKALSSSLSIDARGANSVGVIGGTNTTNTQGGVLGTLAGAIPGTNENNAAFAFGFDVG 246

Query: 253 RFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDY 312
                 +L ALE    +RTLAEP LTA+SGQ A F +GG+     V+     TS+    +
Sbjct: 247 SVEVGILLEALETKGVVRTLAEPNLTALSGQEAKFLAGGEFPVP-VAQDNDTTSIEFKPF 305

Query: 313 GVVLHFTPTVLSPGRIGLRIQTEVSEPVIGV----NAGDMPSYRVRKADTTVELPSGGTI 368
           GV L+F P V+  G I L +   VS          N   +P++R R   TTV L  G + 
Sbjct: 306 GVELNFVPRVVDDGIINLEMAAAVSSIDTANSLVSNGFAIPAFRRRDTSTTVALRDGESF 365

Query: 369 VLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLS 428
            +AGLL+DD +     +P L  +P+LGALFR++ + R +TE+ I  +  LV P     L+
Sbjct: 366 AIAGLLQDDFRDNAGQVPWLGDVPVLGALFRSADYQRSQTELVIIVSAHLVSPSRGEALA 425

Query: 429 RPDDHYSVEDDAKAFFFNRVNK-IYGPKEASEVEGQNYKGAIGFIY 473
            P D   +  +   F   RV + +       EV  Q++ G+ G++ 
Sbjct: 426 LPTDRVKLPSEKDLFLNGRVARGVSDKGPVGEVAKQDFTGSYGYVM 471


>gi|86137993|ref|ZP_01056569.1| bacterial type II/III secretion system protein [Roseobacter sp.
           MED193]
 gi|85825585|gb|EAQ45784.1| bacterial type II/III secretion system protein [Roseobacter sp.
           MED193]
          Length = 459

 Score =  352 bits (902), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 128/476 (26%), Positives = 226/476 (47%), Gaps = 32/476 (6%)

Query: 12  MSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLV 71
           M+  L   +     +P +  AN   +    V+ G    + + +N+ ++++      ++ +
Sbjct: 1   MAAALTGLSLLSIAVPEMGLANGLRV----VKRGTSVTLDVPMNRAVVVESDDPFAELSI 56

Query: 72  SDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFI 131
           ++P  AD+   S RT+Y+ GK+ G   + L+   GK + N+++ +  D++  +  LR+ +
Sbjct: 57  ANPNIADISSLSDRTIYVLGKSPGLTTLTLLDASGKLITNVNVRVAADVSEFKERLRQIL 116

Query: 132 ADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIA 191
               I V   +D +VL G V +    QRA++L+E +            + ++V NL+++ 
Sbjct: 117 PGEQIEVRTANDGIVLSGNVSSAARLQRALDLAERY------------APERVSNLMSVG 164

Query: 192 GEDQVTLKVTIAEVRRDILKQI------GFQHSITGSSSGPSKSFAADFGGKFV----SE 241
           G  QV LKV  AE++R + K +      G Q+      +G         G   +      
Sbjct: 165 GVQQVMLKVRFAEMQRSVSKALHSSVALGSQNGNASGETGQWLFGNNGLGNTPIEVKDGI 224

Query: 242 GGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSS 301
            G  + +  +       +L ALE+   +RTLAEP L+A+SGQ A F +GG++        
Sbjct: 225 AGALAFQFGVGSLQVGLLLEALEQKGVVRTLAEPNLSALSGQEAKFLAGGEYPIPVSQDG 284

Query: 302 TGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS----EPVIGVNAGDMPSYRVRKAD 357
              T V    +G+ L+F P V+    I L ++  VS       +  N   + ++  R+  
Sbjct: 285 GTVT-VEFKPFGIELNFIPRVVDGDVINLELKAAVSAIDTSNTVTANGLSIAAFSRRETS 343

Query: 358 TTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPF 417
           TTVEL  G +  +AGL++DD       IP +  +P+LGALFR++ + RE+TE+ I  +  
Sbjct: 344 TTVELRDGESFAVAGLVQDDFLDNTSQIPWIGDVPVLGALFRSADYQREQTELVIIVSAH 403

Query: 418 LVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIY 473
           LV P     LS P D      +++ F   R         ASEV  Q++ G+ G++ 
Sbjct: 404 LVTPTRGEALSLPTDRIKPPSESELFLLGRTVHSQ-KGPASEVAKQDFNGSYGYVM 458


>gi|149915642|ref|ZP_01904168.1| bacterial type II/III secretion system protein [Roseobacter sp.
           AzwK-3b]
 gi|149810534|gb|EDM70377.1| bacterial type II/III secretion system protein [Roseobacter sp.
           AzwK-3b]
          Length = 467

 Score =  351 bits (901), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 127/479 (26%), Positives = 225/479 (46%), Gaps = 32/479 (6%)

Query: 11  MMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVL 70
           +    L       +      +A     N+  V  G  + +++ +N+ ++++  V   ++ 
Sbjct: 6   LFKAALLGLAVVFSGFVTELQAE----NLQVVRNGAARDLNVTMNRAVVVESDVPFAELS 61

Query: 71  VSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRF 130
           +++P+ AD    S RT+Y+ GK  G+  + L+   G+ + N++I +  D++  +  L++ 
Sbjct: 62  IANPSIADFSTLSDRTIYVLGKAPGRTTLTLLDDSGRLITNVEIHVSTDVSEFKERLQQI 121

Query: 131 IADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNI 190
           + +  I V   +D +VL G V +    +RA+ L++ +            +  +V NL+ +
Sbjct: 122 LPNERIEVRTANDGIVLSGSVSSTARMERALSLAQRY------------APDRVSNLMVV 169

Query: 191 AGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADF----------GGKFVS 240
           AG  QV LKV  AE++R + KQ+    ++       + +  A            G    +
Sbjct: 170 AGNQQVMLKVRFAEMQRSVSKQLSTSLAVDALGVSGNGAALAGSNLPSAGANRVGITANN 229

Query: 241 EGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSS 300
             G       +       +L ALE    +RTLAEP LTA+SGQ A F +GG++    V+ 
Sbjct: 230 NAGVAFFGFDIGSVEIGILLEALETKGVVRTLAEPNLTALSGQEAKFLAGGEYPVP-VAQ 288

Query: 301 STGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIG----VNAGDMPSYRVRKA 356
               TS+    +GV L+F P V+    I L +   VS           A ++ ++R R  
Sbjct: 289 DNNTTSIEFKPFGVELNFIPRVVDGDIINLEMAAAVSSIDPTNGINTGAFNVDAFRRRDT 348

Query: 357 DTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATP 416
            TTV+L  G +  +AGLL+DD +     +P L  +PILGALFR++ + R +TE+ I  + 
Sbjct: 349 STTVQLRDGESFAIAGLLQDDFRDTNAQVPWLGDVPILGALFRSADYARAQTELVIIVSA 408

Query: 417 FLVKPVAMRDLSRPDDHYSVEDDAKAFFFNR-VNKIYGPKEASEVEGQNYKGAIGFIYK 474
            LV P     L+ P D   +  +   F   R +N       A EV  Q++ G+ G++ +
Sbjct: 409 HLVTPTRGEALALPTDRVRLPSEMDLFLNGRVLNSNIPSGTAGEVARQDFTGSYGYVME 467


>gi|222084469|ref|YP_002542998.1| pilus assembly secretion protein [Agrobacterium radiobacter K84]
 gi|221721917|gb|ACM25073.1| pilus assembly secretion protein [Agrobacterium radiobacter K84]
          Length = 505

 Score =  350 bits (899), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 219/487 (44%), Positives = 307/487 (63%), Gaps = 26/487 (5%)

Query: 9   FTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQD 68
           F++    L  +   V     + +A+ A   ++   +   + + +GLNK +++ +P D  D
Sbjct: 24  FSVAFAGLPIAEAPVFLRTAVAKADGADSIVTISGLNTKRTLKLGLNKALVVDLPADAHD 83

Query: 69  VLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLR 128
           +LVSDP  AD V  + R +YLFGK VGQ N+ + G +G+++++LD+ IERDI+ L+  L+
Sbjct: 84  ILVSDPKMADAVTRTSRRIYLFGKTVGQTNIFVFGANGQEIVSLDLQIERDISGLQANLK 143

Query: 129 RFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSK------ 182
           RFI DS+I VE+VSD +VL G VRT QDS RA +L+  FL          ++S       
Sbjct: 144 RFIPDSDINVEIVSDNIVLTGSVRTPQDSSRAQQLAGAFLKGGEATTRTETASGTGGDSS 203

Query: 183 -----------KVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFA 231
                      +++NLL I GEDQVTLKVT+AEV+R +LKQIGF  ++  +SSG + +  
Sbjct: 204 VALFAEGRQTSQIVNLLQIEGEDQVTLKVTVAEVKRSVLKQIGFD-NLVSNSSGLTVAQL 262

Query: 232 ADFGGKFVSEGGDFSVKGVL----DRFSFETVLHALERATAIRTLAEPTLTAISGQSASF 287
            +      +  G+  +  +      +++  + L+A+E+A A+RTLAEPTLTAISGQ+A+F
Sbjct: 263 GNISSDSTAATGNGGLSALFKTALGKYNVSSYLNAMEQAGAVRTLAEPTLTAISGQAATF 322

Query: 288 TSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGD 347
            SGGQ LY  V  S G  ++T + YG+ L FTP VLS GRI L +QT+VSEP     A  
Sbjct: 323 NSGGQTLYS-VIDSDGNVTITPYTYGISLAFTPVVLSAGRISLHVQTQVSEPTGTTGAAT 381

Query: 348 MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREE 407
              Y  R ADT+VELPSGG+I LAGLL D++QQ   G P  SKIPILGALFR   F R+E
Sbjct: 382 ---YNRRAADTSVELPSGGSIALAGLLSDNVQQSTTGTPGASKIPILGALFRQKTFQRDE 438

Query: 408 TEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKG 467
           +E+ I ATP+LV+PVA   ++RPDD++S  +DA  FF NRVNKIYG K+A  V   ++ G
Sbjct: 439 SELVIIATPYLVRPVARNQIARPDDNFSPTNDAGVFFMNRVNKIYGRKDAPPVADADFHG 498

Query: 468 AIGFIYK 474
            +GFIYK
Sbjct: 499 TVGFIYK 505


>gi|99082186|ref|YP_614340.1| type II and III secretion system protein [Ruegeria sp. TM1040]
 gi|99038466|gb|ABF65078.1| Hypothetical 443 kDa protein y4xJ [Ruegeria sp. TM1040]
          Length = 497

 Score =  350 bits (898), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 124/461 (26%), Positives = 222/461 (48%), Gaps = 32/461 (6%)

Query: 31  EANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLF 90
            + A    IS ++ G    + + +N+ ++++  V   ++ +++P+ AD+   S RT+Y+ 
Sbjct: 50  PSPAVAQGISVLKKGTNAVLDVPMNRAVVVEADVPFAELSIANPSIADISSLSDRTIYVL 109

Query: 91  GKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGM 150
           GK+ G   + L+   G  + N+D+ +  D++  +  L++ + +  I V   +D +VL G 
Sbjct: 110 GKSPGLTTLTLLDGSGGLITNVDVRVAADVSEFKQRLQQILPNEKIEVRTANDGIVLSGT 169

Query: 151 VRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDIL 210
           V + Q  QRA++L+E +            +  +V NL+ + G  QV LKV  AE+ R + 
Sbjct: 170 VSSAQRLQRALDLAERY------------APDRVSNLMTVGGIQQVMLKVRFAEMERSVS 217

Query: 211 KQIGFQHSITGSSSGPSKSFAADFGGKFVSEG--------------GDFSVKGVLDRFSF 256
           K +G    I  S    +     + GG     G              G       +    F
Sbjct: 218 KSLGGSMLIRSSDGAIATGSFQNRGGNGNIFGDSVTSPVQLQSETLGAALFGFDIGAVQF 277

Query: 257 ETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVL 316
             +L ALE+   +RTLAEP L+A+SGQ A+F +GG++    V+   G  +V    +G+ L
Sbjct: 278 NVLLEALEQKGLVRTLAEPNLSALSGQEANFLAGGEYPVP-VAQEDGVITVEFKPFGIEL 336

Query: 317 HFTPTVLSPGRIGLRIQTEVSEPVIGVN----AGDMPSYRVRKADTTVELPSGGTIVLAG 372
           +F P V+    I L ++  VS      +       + ++  R+  TTVEL  G +  +AG
Sbjct: 337 NFIPRVVDGDLINLELKAAVSAIDTTNSATFDGFSINAFSRRETATTVELRDGESFAIAG 396

Query: 373 LLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDD 432
           L++D+ +     +P L  +P+LGALFR++ + R ++E+ I  +  LV P     L+ P D
Sbjct: 397 LIEDEFRDGAAQVPWLGDVPVLGALFRSADYARNQSELVIIVSAHLVTPTRGEALALPTD 456

Query: 433 HYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIY 473
                 +   F F +  +      A EV  Q++ G+ G++ 
Sbjct: 457 RIRPPSEKNLFLFGQTERAQ-AGAAGEVANQDFNGSYGYLL 496


>gi|126737254|ref|ZP_01752989.1| bacterial type II/III secretion system protein [Roseobacter sp.
           SK209-2-6]
 gi|126721839|gb|EBA18542.1| bacterial type II/III secretion system protein [Roseobacter sp.
           SK209-2-6]
          Length = 446

 Score =  350 bits (898), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 125/462 (27%), Positives = 217/462 (46%), Gaps = 29/462 (6%)

Query: 24  AKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHS 83
             LP  + A A  + +     G    + + +N+ I+++      ++ +++P  AD+   S
Sbjct: 1   MALPVAEPAQANGLRVVKQ--GTSITLDVPMNRAIVVESDAPFAELSIANPNIADISSLS 58

Query: 84  PRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSD 143
            RT+Y+ GK+ G   + L+   GK + N+++ +  D++  +  LR+ +    I V   +D
Sbjct: 59  DRTIYVLGKSPGLTTLTLLDGAGKLITNVNVRVAADVSEFKERLRQILPGEKIEVRTAND 118

Query: 144 TVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIA 203
            +VL G V +    QRA++L+E +            + ++V NL+++ G  QV LKV  A
Sbjct: 119 GIVLSGTVSSSARLQRALDLAERY------------APERVSNLMSVGGVQQVMLKVRFA 166

Query: 204 EVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEG--------GDFSVKGVLDRFS 255
           E+ R + K +    +   S     ++     G   +           G  ++      F 
Sbjct: 167 EMERSVSKTLSSSLAFGNSGDVIGETGTWLDGNNGLGNPVQVTQGTEGAVAISFGAGSFR 226

Query: 256 FETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVV 315
              +L ALE+   +RTLAEP L+A+SGQ ASF +GG++    V +      +    +G+ 
Sbjct: 227 VGVLLEALEQKGIVRTLAEPNLSALSGQEASFLAGGEYPIPVVDADG--IGIEYKPFGIE 284

Query: 316 LHFTPTVLSPGRIGLRIQTEVSEPVIGV----NAGDMPSYRVRKADTTVELPSGGTIVLA 371
           L F P V+    I L ++  VS          N   +  +  R   TTVEL  G +  +A
Sbjct: 285 LDFIPRVVDQDVINLELEAVVSAIDPTTTVVQNGLTINGFTRRATSTTVELRDGESFAIA 344

Query: 372 GLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPD 431
           GL++D+       +P +  IPI+GALFR++ + RE+TE+ I  +  LV P     L+ P 
Sbjct: 345 GLVQDEFTDSNGQVPWVGDIPIIGALFRSASYQREQTELVIIVSAHLVTPTRGEALTLPT 404

Query: 432 DHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIY 473
           D      + + F F R          +EV GQ+Y G+ G++ 
Sbjct: 405 DRVKPPSENELFLFGRTEH-NRSGPVNEVAGQDYNGSYGYVL 445


>gi|126725970|ref|ZP_01741812.1| Outer membrane general secretion pathway protein, Secretin
           [Rhodobacterales bacterium HTCC2150]
 gi|126705174|gb|EBA04265.1| Outer membrane general secretion pathway protein, Secretin
           [Rhodobacterales bacterium HTCC2150]
          Length = 466

 Score =  350 bits (897), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 128/482 (26%), Positives = 230/482 (47%), Gaps = 42/482 (8%)

Query: 17  FSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTK 76
              + +V+  P    A    +            +++ +N+ I+++      +V V++P+ 
Sbjct: 1   MGLSLAVSTAPLSGYAETLKVVKGS----PSNSLNVPMNRAIVVETETSFGEVSVANPSI 56

Query: 77  ADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNI 136
           AD+   S +T+Y+ GK  G+  + L+   G+ + N+D+ +  D+A  +  L++ +    I
Sbjct: 57  ADISTLSDKTIYVLGKAPGRTTLTLLDGTGRLISNVDVHVTPDVAEFKERLQQILPGEPI 116

Query: 137 RVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQV 196
            V   +D +V+ G V +I    RA++L+  +            +  +V NL+++ G  QV
Sbjct: 117 EVRTANDGIVMSGTVSSIGKLDRALDLANRY------------APNRVSNLMSVGGTQQV 164

Query: 197 TLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGD------------ 244
            LK+  AE++R + K +    + +GS  G + +  A       S   +            
Sbjct: 165 MLKIRFAEMQRSVAKNLTGSLAFSGSLGGNAGATGASQTFSDGSNLANLYDGDSSTSATS 224

Query: 245 -------FSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKT 297
                  FS+        F+ +L ALE    +RTLAEP LTA+SGQ A F +GG++    
Sbjct: 225 SQDRDGLFSIGFSNGTIGFQVLLEALETKGVVRTLAEPNLTALSGQKADFLAGGEYPTPA 284

Query: 298 VSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVN-----AGDMPSYR 352
           +    G+  +    +G+ + FTPTV+    I L+++T VS     ++        +  ++
Sbjct: 285 I-DDNGSPIIEYKPFGIEMEFTPTVVDGDLINLQLKTSVSSLDTSISAQNSAGFTVFGFK 343

Query: 353 VRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFI 412
            RKA TTVE+  G +  +AGLL+DD       +P L  +PI+GALFR+S + R+++E+ +
Sbjct: 344 TRKASTTVEMRDGQSFAIAGLLQDDFTDQSGQVPWLGDVPIIGALFRSSEYERKQSELVV 403

Query: 413 AATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYG-PKEASEVEGQNYKGAIGF 471
             TP LV P     L+ P D   +  + + F F  V         A EV  Q++ G+ G+
Sbjct: 404 IVTPHLVTPTRGEALALPTDRVQIPTERELFLFGNVAGKKKIKGAAGEVARQDFSGSYGY 463

Query: 472 IY 473
           + 
Sbjct: 464 VM 465


>gi|15887573|ref|NP_353254.1| component of type IV pilus [Agrobacterium tumefaciens str. C58]
 gi|15155110|gb|AAK86039.1| component of type IV pilus [Agrobacterium tumefaciens str. C58]
          Length = 527

 Score =  350 bits (897), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 209/494 (42%), Positives = 300/494 (60%), Gaps = 41/494 (8%)

Query: 20  NPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADV 79
           +P   +    +  +A+++ I++   G  K++ +GLNK +++ +P D  D+LV+DP+ AD 
Sbjct: 36  SPDFLRTSEAEAQSASIVRITESGTGIRKRLKLGLNKALVIDLPEDAHDILVADPSLADA 95

Query: 80  VVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVE 139
           V  + R +YLFGK VGQ N+ + G  G+++++LD+ +ERDI+ LE  +RRFI +S+I+VE
Sbjct: 96  VTRTSRRIYLFGKMVGQTNIFIFGDGGREIVSLDLEVERDISGLEANIRRFIPESDIKVE 155

Query: 140 MVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQ-----------------YANSSSK 182
           +VSD +VL G VRT QDS RAV+L++ FL                               
Sbjct: 156 IVSDNIVLTGSVRTPQDSARAVQLADAFLKGGEATTRNISLTGGNNGGDAAIFAERRQVS 215

Query: 183 KVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFA--ADFGGKFVS 240
           +++N+L I GEDQVTLKVT+AEV R +LKQ+GF  SI+ S+SG    FA  ++ G     
Sbjct: 216 QIVNMLTIEGEDQVTLKVTVAEVSRQVLKQLGFNGSISSSTSGNGFEFANPSNLGNAIDG 275

Query: 241 EGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQH------- 293
                S         F + L+A+E+A  +RTLAEP+LTAISG+ A F  GG         
Sbjct: 276 ASRIASGAIGSGSLRFASYLNAMEQAGVMRTLAEPSLTAISGEQAKFYVGGDFRLAAEQE 335

Query: 294 --LYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVN------- 344
             + K     T   +  T DYG+ L+F P VLSPGRI L+I+T VSEP    N       
Sbjct: 336 VDIDKETGRPTITRTTNTVDYGITLNFKPVVLSPGRISLKIETNVSEPTYEGNVVTGNGG 395

Query: 345 ----AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRN 400
                    S R R+  TTVELPSGG+IV+AGL++D+++Q   G+P +SKIPI G LFR+
Sbjct: 396 RTIPGSTYMSVRKRETSTTVELPSGGSIVIAGLVQDNVRQAMSGLPGMSKIPIFGTLFRS 455

Query: 401 SRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEV 460
             F R ETE+ I ATP+LV+PVA   ++RPDD+++ E+DA  +F NRVNK+YG K+   V
Sbjct: 456 KEFLRNETELVIIATPYLVRPVARNQIARPDDNFNPENDAAMYFMNRVNKVYGRKDQ--V 513

Query: 461 EGQNYKGAIGFIYK 474
           +   Y+G++GFIYK
Sbjct: 514 QAAPYQGSVGFIYK 527


>gi|146338123|ref|YP_001203171.1| putative pilus assembly protein CpaC [Bradyrhizobium sp. ORS278]
 gi|146190929|emb|CAL74934.1| putative Pilus assembly protein cpaC; putative signal peptide
           [Bradyrhizobium sp. ORS278]
          Length = 500

 Score =  350 bits (897), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 163/493 (33%), Positives = 265/493 (53%), Gaps = 32/493 (6%)

Query: 1   MRYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIIL 60
           +R L     ++ +    + NP++A +       AA    +       + +++G+ K +++
Sbjct: 17  LRTLMVRALSLSAAAALTLNPALAPVIAADYRPAAAAPPAADGQINARFLALGVGKSVVI 76

Query: 61  QVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDI 120
            +P D++DVLV+DP  A+ VV S +  Y+ G  VGQ N++     G+Q+   DI ++RD+
Sbjct: 77  DLPRDIKDVLVADPKIANAVVRSSQRAYIIGAAVGQTNIVFFDAQGQQIAAYDIAVKRDL 136

Query: 121 AHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSS 180
                 L++ + +++I++E + D +VL G   +  ++Q+A EL+                
Sbjct: 137 NGARAALKQLLPNADIQIEGLGDGIVLTGSASSQIEAQQAGELAARLAGG---------- 186

Query: 181 SKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVS 240
           ++KV+N + + G DQV LKVT+AEV+R ++KQ+G   S   +       FA         
Sbjct: 187 AEKVVNSITVRGRDQVMLKVTVAEVQRSVVKQLGIDLSGQLNYGTAVVKFANSNPFTAYG 246

Query: 241 EG---GDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKT 297
                 +          S +  L A+E A  IRTLAEP LTAISG+SA+F +GG+     
Sbjct: 247 SNLVSNNAVSAAFGSTPSVQATLRAMENAGVIRTLAEPNLTAISGESATFIAGGEFPVPA 306

Query: 298 VSSSTGATSVT-----THDYGVVLHFTPTVLSPGRIGLRIQTEVSEP------------- 339
             S    T V         +G+ L+FTP VLS GRI +R+ TEVSE              
Sbjct: 307 GYSCDPTTHVCTTQISFKKFGISLNFTPIVLSEGRISMRVMTEVSELSNENSITLSQAVS 366

Query: 340 VIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFR 399
              VN+  +PS + R+A+TT+E+PSGG + +AGL++   +Q   G+P L ++P+LGALFR
Sbjct: 367 STTVNSLTVPSIKTRRAETTLEIPSGGAMAMAGLIQQQTKQAISGMPGLMQLPVLGALFR 426

Query: 400 NSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASE 459
           +  +   +TE+ +  TPF+V+ V+ +DLSRPDD ++   D +A     +N+IYG    +E
Sbjct: 427 SRDYVNNQTELMVLVTPFVVRAVSQKDLSRPDDGFAAASDPQADLLGSINRIYGVPGRTE 486

Query: 460 VEGQNYKGAIGFI 472
             G+NY+G  GFI
Sbjct: 487 P-GRNYRGTYGFI 498


>gi|84516633|ref|ZP_01003992.1| Outer membrane general secretion pathway protein, Secretin
           [Loktanella vestfoldensis SKA53]
 gi|84509669|gb|EAQ06127.1| Outer membrane general secretion pathway protein, Secretin
           [Loktanella vestfoldensis SKA53]
          Length = 476

 Score =  349 bits (895), Expect = 6e-94,   Method: Composition-based stats.
 Identities = 131/478 (27%), Positives = 218/478 (45%), Gaps = 35/478 (7%)

Query: 18  SSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKA 77
           +       +     A A    +  +       + + +N+ ++++  V   ++ +++P  A
Sbjct: 10  ALAGVALSMTAAAPAMAQDSTLRVLRGAASNALDVPMNRAVVVESDVPFTELSIANPGIA 69

Query: 78  DVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIR 137
           D+   S RT+Y+ GK  G+  + L+  DG+ + N+++ +  D+A  +  L + +   NI 
Sbjct: 70  DISSLSDRTIYVLGKEPGRTTLTLLSADGRLITNVEVHVSPDMAEFKERLTQILPGENIE 129

Query: 138 VEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVT 197
           V   +D +VL G V +     RA++L++ +            +  +V NL+++ G  QV 
Sbjct: 130 VRTANDGIVLSGTVSSTARLDRALDLAQRY------------APDRVSNLMSVGGTQQVM 177

Query: 198 LKVTIAEVRR-------------DILKQIGFQHSITGSSSGPSKSFAADFGGKFVS---E 241
           LKV  AE++R                 Q G       +++               +    
Sbjct: 178 LKVRFAEMQRSVSKALSSSLSLNGTSLQNGRNIRGGSNTTVGQAGITNTLNNIVPTANDN 237

Query: 242 GGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSS 301
            G F             +L ALE    +R+LAEP LTA+SGQ A+F +GG++    VSS 
Sbjct: 238 NGAFLFGFGAGGVEVGVLLEALESRGVVRSLAEPNLTALSGQQATFLAGGEYPVP-VSSE 296

Query: 302 TGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGV----NAGDMPSYRVRKAD 357
            GA SV    +GV L+FTP V+    I L +   VS          N  ++ ++  R+  
Sbjct: 297 DGAISVEYKPFGVELNFTPRVVDGDVINLELLAAVSAIDPSNSFSANGFEISAFSRRETS 356

Query: 358 TTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPF 417
           TTVE+  G +  +AGLL DD   L   +P +  +PILGALFR++ + R +TE+ I  TP 
Sbjct: 357 TTVEMRDGESFAIAGLLSDDFTDLSGQVPWIGDVPILGALFRSAEYARRQTELVIIVTPH 416

Query: 418 LVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGP--KEASEVEGQNYKGAIGFIY 473
           LV P     L+ P D      +   F F RV     P    A EV  Q++ G+ G++ 
Sbjct: 417 LVSPTRGTALALPTDRVRPPSEQDLFLFGRVTAASAPTRGGAGEVARQDFMGSYGYVM 474


>gi|254501806|ref|ZP_05113957.1| Putative phospholipid-binding domain family [Labrenzia alexandrii
           DFL-11]
 gi|222437877|gb|EEE44556.1| Putative phospholipid-binding domain family [Labrenzia alexandrii
           DFL-11]
          Length = 483

 Score =  349 bits (895), Expect = 6e-94,   Method: Composition-based stats.
 Identities = 166/482 (34%), Positives = 273/482 (56%), Gaps = 21/482 (4%)

Query: 2   RYLQRTFFTMMS-IFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIIL 60
           + ++R+     +   +      +A     +EA  + I+++  E    + +++G+ + +++
Sbjct: 14  KSIRRSGLRFCAFAAVMGLVSFMAPASWSQEAFPSQIHVAAGERATDRILNVGIGRSVVI 73

Query: 61  QVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDI 120
            +  D  DVLVS+P  AD V+ +PR +++ G   GQA ++L G  G+++ + DI +E+D 
Sbjct: 74  NLAEDAADVLVSNPQIADAVLRTPRRIFVLGNTAGQARLVLFGRSGRELASFDIRVEKDT 133

Query: 121 AHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSS 180
           + +   +RR I  ++++ E ++  VVL G  ++  ++Q+A +++  F      +      
Sbjct: 134 SDITRIIRRLIPGTSVQAESINGKVVLSGTAKSTLEAQQAADIAAKFQGDETGSA----- 188

Query: 181 SKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVS 240
              ++NL+ ++G DQV LKVT+AEV R I+KQ+G         +G    F ++F    V+
Sbjct: 189 ---IVNLIAVSGSDQVHLKVTVAEVERSIIKQLGVSFQA-NLGAGNFFPFGSNFPNFNVN 244

Query: 241 EG----GDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYK 296
                     V       S    + AL+R   IRTLAEPTLTA SG++ASF +GG+    
Sbjct: 245 PSIVNQATGGVTFSSGTSSLTAQVEALQRDGVIRTLAEPTLTATSGENASFLAGGEFPIP 304

Query: 297 TVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPV----IGVNAGDMPSYR 352
                    SV    +GV L FTP VL+ GRI LR++TEVSE      +      + + +
Sbjct: 305 IA-QEDNQISVEFKKFGVGLDFTPIVLTGGRISLRVKTEVSELSNEGAVSAGGITISALK 363

Query: 353 VRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFI 412
           VR+A++T+ELPSGGT+V+AGLL++  QQ  EG+P L +IP+LGALF++  F +++TE+ +
Sbjct: 364 VRRAESTMELPSGGTLVMAGLLEESYQQAVEGVPGLMQIPVLGALFKSRDFLKQQTELAV 423

Query: 413 AATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFI 472
             TP++VKPVA + + RPD +     DA+A F NR+NKI+    A E     Y G +GFI
Sbjct: 424 FVTPYVVKPVAAQKMVRPDKNLFAPSDAEAIFLNRLNKIF--NPAGEQAQGTYHGQVGFI 481

Query: 473 YK 474
           YK
Sbjct: 482 YK 483


>gi|27376550|ref|NP_768079.1| pilus assembly protein [Bradyrhizobium japonicum USDA 110]
 gi|27349691|dbj|BAC46704.1| pilus assembly protein [Bradyrhizobium japonicum USDA 110]
          Length = 496

 Score =  349 bits (895), Expect = 6e-94,   Method: Composition-based stats.
 Identities = 160/493 (32%), Positives = 261/493 (52%), Gaps = 34/493 (6%)

Query: 1   MRYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIIL 60
           MR       +  +      NP++  +       AA +  +       + +S+G+ K I++
Sbjct: 15  MRTSMVRALSFSAALALVLNPALTPVVAADYRPAAPV--AADGQMNARFLSLGVGKSIVI 72

Query: 61  QVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDI 120
            +P D++DVLV+DP  A+ VV S +  Y+ G  VGQ N++     G+Q+   DI ++RD+
Sbjct: 73  DLPRDIKDVLVADPKIANAVVRSSQRAYIIGAAVGQTNIVFFDSAGQQIAAYDIAVKRDL 132

Query: 121 AHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSS 180
             +   L++ + +S+I+++ + + +VL G      ++Q+A +L+                
Sbjct: 133 NGVRAALKQILPNSDIQIDGLGEGIVLTGTAANPMEAQQANDLAARLAGG---------- 182

Query: 181 SKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVS 240
           + KV+N + + G DQV LKVT+AEV R I+KQ+G   +   +      +F+       + 
Sbjct: 183 ADKVVNSIVVRGRDQVMLKVTVAEVARSIVKQLGIDLTANLNYGTSVVTFSNSNPFTALG 242

Query: 241 EG---GDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKT 297
           +    G+          S +  L A+E A  IRTLAEP LTAISG+SA+F +GG+     
Sbjct: 243 KNLVDGNSLTTKFGATPSVQATLRAMETAGVIRTLAEPNLTAISGESATFIAGGEFPVPA 302

Query: 298 VSSSTGATSVT-----THDYGVVLHFTPTVLSPGRIGLRIQTEVSEP------------- 339
             +    T V         +G+ L+FTP VL+ G+I LR+ TEVSE              
Sbjct: 303 GYACDPTTHVCTTQISFKKFGISLNFTPVVLTEGKISLRVMTEVSELSNENAITLSQAVT 362

Query: 340 VIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFR 399
              VN+  +PS + R+A+T++E+PSGG + +AGL++   +Q   G+P L ++PILG LFR
Sbjct: 363 STSVNSLTVPSIKTRRAETSLEIPSGGAMAMAGLIQQQTKQAVSGLPGLMQLPILGTLFR 422

Query: 400 NSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASE 459
           +  F    TE+ +  TP++V+ VA +DLSRPDD +S   D +      +N+IYG    +E
Sbjct: 423 SRDFVNNATELVVIVTPYIVRAVAQKDLSRPDDGFSAPADPQVELLGNINRIYGVPGRTE 482

Query: 460 VEGQNYKGAIGFI 472
             G+NY+G  GFI
Sbjct: 483 P-GRNYRGTYGFI 494


>gi|126733573|ref|ZP_01749320.1| bacterial type II/III secretion system protein [Roseobacter sp.
           CCS2]
 gi|126716439|gb|EBA13303.1| bacterial type II/III secretion system protein [Roseobacter sp.
           CCS2]
          Length = 476

 Score =  349 bits (895), Expect = 6e-94,   Method: Composition-based stats.
 Identities = 130/478 (27%), Positives = 219/478 (45%), Gaps = 35/478 (7%)

Query: 18  SSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKA 77
           +       L     + A    +  +       +S+ +++ ++++  V   ++ +++P  A
Sbjct: 10  AIAGLTLSLTAAAPSIAPAETLRVLRGAASSALSVPMSRAVVVESDVPFTELSIANPGIA 69

Query: 78  DVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIR 137
           D+   S RT+Y+ GK  G+  + L+G +G+ + N++I +  D+A  +  L + +   NI 
Sbjct: 70  DISSLSDRTIYVLGKEPGRTTLTLLGENGRLITNVEIHVSPDMAEFKERLTQILPGENIE 129

Query: 138 VEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVT 197
           V   +D +VL G V +I    RA++L+E +            + ++V NL+ + G  QV 
Sbjct: 130 VRTANDGIVLSGTVSSIARLDRALDLAERY------------APERVSNLMMVGGTQQVM 177

Query: 198 LKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFG----------------GKFVSE 241
           LKV  AE++R + K +    +++G       S                          + 
Sbjct: 178 LKVRFAEMQRSVSKALSTSVALSGLGFDDDVSITGGTNRTIGQSAINGALSGSVPGSNAN 237

Query: 242 GGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSS 301
            G               +L ALE    +R+LAEP LTA+SGQ A+F +GG++   T +  
Sbjct: 238 NGAVLFGFGAGGLEVGILLEALETRGVVRSLAEPNLTALSGQEATFLAGGEYPVPTANDG 297

Query: 302 TGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGV----NAGDMPSYRVRKAD 357
            G  SV    +GV L F P V+    I L +   VS          N   + ++  R+  
Sbjct: 298 -GTISVEFRPFGVELSFVPRVVDHDIINLELSAAVSAIDPSNGFQANGFSVDAFTRRETS 356

Query: 358 TTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPF 417
           TTVE+  G +  +AGLL DD   L   +P +  IP+LGALFR++ + R +TE+ I  TP 
Sbjct: 357 TTVEMRDGESFAIAGLLSDDFTDLNGQLPWVGDIPVLGALFRSAEYARRQTELVIIVTPH 416

Query: 418 LVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGP--KEASEVEGQNYKGAIGFIY 473
           LV P     L+ P D      +   F F +V    GP    A EV  Q++ G+ G++ 
Sbjct: 417 LVSPTRGEALALPTDRVRPPTEQGLFLFGQVANEGGPSSGGAGEVARQDFSGSYGYVL 474


>gi|154250689|ref|YP_001411513.1| type II and III secretion system protein [Parvibaculum
           lavamentivorans DS-1]
 gi|154154639|gb|ABS61856.1| type II and III secretion system protein [Parvibaculum
           lavamentivorans DS-1]
          Length = 491

 Score =  349 bits (895), Expect = 7e-94,   Method: Composition-based stats.
 Identities = 162/470 (34%), Positives = 256/470 (54%), Gaps = 29/470 (6%)

Query: 23  VAKLPPIKEANAAVINISDVEIG-KGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVV 81
           V+        +A ++ I    IG   + I +GLNK  I+++P+  +DVLVS+P   D VV
Sbjct: 31  VSPAGGAFAGDARLVKIDQGGIGQSSRSIVLGLNKAAIVELPIAARDVLVSNPAIVDAVV 90

Query: 82  HSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMV 141
            + +  YL G  VGQ N       G+Q+LNL+I + RD+  L  +LR++   + I VE +
Sbjct: 91  RTNKRTYLIGLAVGQTNAFFFNEAGQQILNLEIRVARDLTGLRESLRQYFPKARIDVESI 150

Query: 142 SDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVT 201
           +D VVL GMV +  D+ +A + +  ++             + V+N+L I G++QV LKVT
Sbjct: 151 NDHVVLSGMVASATDASKAQDFAARYIGGDK---------EHVLNMLGIEGKEQVMLKVT 201

Query: 202 IAEVRRDILKQIGFQHSITGS---------SSGPSKSFAADFGGKFVSEGGDFSVKGVLD 252
           +AE++R+++KQ+G   S   +         +S          GG   +       +    
Sbjct: 202 VAEMQRNVIKQLGVDLSTAANFGDFALRLATSNSFSVQGGSLGGLTTAADAADPTRYQSG 261

Query: 253 RFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDY 312
             + ++ + ALER   +RTLAEP LTAISG+SA F +GG+    T     G   +    +
Sbjct: 262 DVTVDSAIRALERDGILRTLAEPNLTAISGESAKFLAGGEFPVPTSRDRDGNVQLEFKPF 321

Query: 313 GVVLHFTPTVLSPGRIGLRIQTEVSEPV---------IGVNAGDMPSYRVRKADTTVELP 363
           GV L+FTP VLS GRI L+I TEVSE              +   +P  +VR+A+TT+ELP
Sbjct: 322 GVGLNFTPVVLSEGRISLKISTEVSELTSEGAFVFQSTSADGVTVPGLKVRRAETTLELP 381

Query: 364 SGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVA 423
           SGG++V+AGLL D ++Q  +G+P +  +P+LG LFR+  + + ETE+ +  TP+LV P +
Sbjct: 382 SGGSLVMAGLLSDTMRQNIDGVPGVKDVPVLGQLFRSRDYQKNETELVVIVTPYLVDPTS 441

Query: 424 MRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIY 473
            ++L  P D ++   D       R+N  YG + A+  +  + +G +GFI 
Sbjct: 442 RKNLVLPTDGFAPASDMDTILMGRLNATYGARGAAPGD-HSLQGPVGFIV 490


>gi|159043678|ref|YP_001532472.1| type II and III secretion system protein [Dinoroseobacter shibae
           DFL 12]
 gi|157911438|gb|ABV92871.1| type II and III secretion system protein [Dinoroseobacter shibae
           DFL 12]
          Length = 474

 Score =  349 bits (894), Expect = 7e-94,   Method: Composition-based stats.
 Identities = 131/468 (27%), Positives = 222/468 (47%), Gaps = 37/468 (7%)

Query: 29  IKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMY 88
              A A V+ + + +      + + +N+ ++++  +   ++ V++P  AD+   S R++Y
Sbjct: 22  TAPAMAQVLRVQEGQAD--STLQVPMNRAVVVESDIPFAELSVANPGIADIATLSDRSIY 79

Query: 89  LFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLH 148
           + GK+ G+  + L+G DG+ + N+D+ +  DIA  +  L + +   NI V   +D VVL 
Sbjct: 80  VLGKSQGRTTMTLLGADGRLITNVDVQVTPDIAEFKERLEQILPGENIEVRTANDGVVLS 139

Query: 149 GMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRD 208
           G   ++    RA++L++ +            +  +V NL++I G  QV LKV  AE++R 
Sbjct: 140 GTASSVTAMDRALDLAQRY------------APDRVSNLMSIGGSQQVMLKVRFAEMQRS 187

Query: 209 ILKQIGFQHSITGSSSGPSKSFAADFGGKFVS----------------EGGDFSVKGVLD 252
           + KQ+    +   S +  + S     GG                      G   +   + 
Sbjct: 188 VSKQLSGGLTAIYSGTDGAFSVGLGSGGLTDGGSIGGANSTEFTLNPEAAGTIGLGFNIG 247

Query: 253 RFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDY 312
             S   +L ALE    +RTLAEP LT +SGQ ASF +GG++    V+   G  SV    +
Sbjct: 248 NVSLGILLEALESKGVVRTLAEPNLTTLSGQEASFLAGGEYPIP-VADGDGGISVEYKPF 306

Query: 313 GVVLHFTPTVLSPGRIGLRIQTEVSEPVIG----VNAGDMPSYRVRKADTTVELPSGGTI 368
           GV L F PTVL    I L +   VS          ++  +  +  R+  TTV+L  G + 
Sbjct: 307 GVELDFIPTVLDDDVINLELGAAVSALDSSASIITDSLTVQGFSRRETLTTVQLRDGDSF 366

Query: 369 VLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLS 428
            +AGLL+DD +     +P L  IP+LGALFR++ + R ++E+ I  T  LV P     L 
Sbjct: 367 AIAGLLEDDFRDFAGQVPWLGDIPVLGALFRSADYARSQSELVIIVTAHLVSPTRGEALV 426

Query: 429 RPDDHYSVEDDAKAFFFNRV--NKIYGPKEASEVEGQNYKGAIGFIYK 474
            P D   +  + + F    +          A EV  Q++ G+ G++ +
Sbjct: 427 LPTDRVRIPSEREFFLNGNLVREDTPRRGAAGEVAQQDFSGSYGYVLE 474


>gi|241207157|ref|YP_002978253.1| type II and III secretion system protein [Rhizobium leguminosarum
           bv. trifolii WSM1325]
 gi|240861047|gb|ACS58714.1| type II and III secretion system protein [Rhizobium leguminosarum
           bv. trifolii WSM1325]
          Length = 499

 Score =  349 bits (894), Expect = 7e-94,   Method: Composition-based stats.
 Identities = 223/483 (46%), Positives = 307/483 (63%), Gaps = 25/483 (5%)

Query: 12  MSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLV 71
            S  + +S   +      +  + +++ IS       +++ +GLNK +++ +P D  D+LV
Sbjct: 22  ASGMVPASFAPLFGAGEARADSDSLVRISQTGSNAHRRLKLGLNKAVVVDLPEDAHDILV 81

Query: 72  SDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFI 131
           SDPT AD V  + R +YLFGK VGQ N+ + G  G++++NLDI IERD++ LE+ LRRFI
Sbjct: 82  SDPTMADAVTRTSRRIYLFGKKVGQTNIFVFGAGGQEIVNLDIEIERDVSGLEVNLRRFI 141

Query: 132 ADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSS----------- 180
            DSNI VE+VSD +VL G VRT QD+ +A +L++ FL          ++           
Sbjct: 142 PDSNINVEIVSDNIVLTGTVRTPQDATQAADLAQVFLKGGEATTRTETASGTGGDSSVAL 201

Query: 181 ------SKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQH---SITGSSSGPSKSFA 231
                 S +V+NLL I GEDQVTLKVTIAEVRR++LKQ+GF +   + +G +     S +
Sbjct: 202 FAEGRQSSQVVNLLQIEGEDQVTLKVTIAEVRREVLKQLGFDNLVSNSSGMTVAQLGSPS 261

Query: 232 ADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGG 291
           AD     V  G     K  + ++   T L+ALE+A  ++TLAEPTLTAISGQ+A+F SGG
Sbjct: 262 ADSAASTVGGGLAALFKSSIGKYDISTYLNALEQAKVVKTLAEPTLTAISGQAATFNSGG 321

Query: 292 QHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGDMPSY 351
           Q LY T   S G  +V   +YG+ L F P VLS GRI L+I+T VSEPV G        Y
Sbjct: 322 QQLYSTT-DSDGNVTVVPFNYGISLAFKPVVLSSGRISLQIKTNVSEPVAGSGNAT---Y 377

Query: 352 RVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIF 411
           + R A+T+VELPSGG+I LAGL++D++ Q   G P +SKIP+LG LFR   F R+ETE+ 
Sbjct: 378 QRRSAETSVELPSGGSIALAGLIRDNVSQTMGGTPGVSKIPLLGTLFRQKGFERQETELV 437

Query: 412 IAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGF 471
           I ATP+LV+PVA   L+RPDD++S E+D   FF NRVNK+YG +EA   + Q + G+IGF
Sbjct: 438 IIATPYLVRPVARNQLNRPDDNFSPENDGATFFLNRVNKVYGRREAPVADAQ-FHGSIGF 496

Query: 472 IYK 474
           IYK
Sbjct: 497 IYK 499


>gi|86748907|ref|YP_485403.1| type II and III secretion system protein [Rhodopseudomonas
           palustris HaA2]
 gi|86571935|gb|ABD06492.1| type II and III secretion system protein [Rhodopseudomonas
           palustris HaA2]
          Length = 479

 Score =  349 bits (894), Expect = 9e-94,   Method: Composition-based stats.
 Identities = 164/481 (34%), Positives = 269/481 (55%), Gaps = 25/481 (5%)

Query: 6   RTFFTMMS-IFLFSSNPSVAKLPPIKEANAAVINISDVEIGK---GKKISIGLNKVIILQ 61
           R   T+       S+  ++  LPP     A+    +  + G     + +++G+ K +++ 
Sbjct: 8   RFIRTLTGTAMAVSAVVALTMLPPWTPVKASDYRATTTQTGGGMNARPLALGIGKSVVID 67

Query: 62  VPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIA 121
           +P D++DVLV+DP  A+ VV S +  Y+ G  VGQ N++     G+Q+   DI + RD+ 
Sbjct: 68  LPRDIKDVLVADPKIANAVVRSSQRAYIIGAAVGQTNIVFFDSTGQQIAAYDIAVTRDLN 127

Query: 122 HLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSS 181
            +   L++ I +++IRVE + D V+L G V T  ++Q+A +L+                +
Sbjct: 128 GIRAALQQSIPNADIRVEGLGDGVILMGSVATPIEAQQAADLAARLAGD----------A 177

Query: 182 KKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSE 241
            KV+N + I G DQV LK+T+AEV+RDI+KQ+G   +   S      SF          +
Sbjct: 178 SKVVNNIAIRGRDQVMLKITVAEVQRDIVKQLGVDLTANLSYGTSVVSFTNTNPFTQSGQ 237

Query: 242 G---GDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTV 298
               G+       +  S    L A+E A  +RTLAEP LTAISG+ ASF +GG+    + 
Sbjct: 238 ALVSGNALTTSFGNGPSITATLKAMESAGVVRTLAEPNLTAISGEPASFLAGGEFPVPSG 297

Query: 299 SSSTG---ATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEV----SEPVIGVNAGDMPSY 351
            + T      SV+   +GV+L+FTP VLS GRI L++ TEV    S+  + ++   +PS 
Sbjct: 298 VTCTNAVCTPSVSYKKFGVLLNFTPVVLSEGRISLKVATEVSEVSSDNSVTISGTTVPSI 357

Query: 352 RVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIF 411
           + R+ D+TVE+PSGG++ +AGL+++  +Q   G+P +++IPILG LFR+  +   ++E+ 
Sbjct: 358 KTRRVDSTVEIPSGGSLAMAGLIQEQTKQAINGMPGMTQIPILGTLFRSRDYINRQSELM 417

Query: 412 IAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGF 471
           +  TP++V+ VA +DLSRPDD ++   D ++     +N+IYG    +  + Q Y+G  GF
Sbjct: 418 VLVTPYVVRAVAPKDLSRPDDGFADASDPQSDLLGSINRIYGVPGRT-GQSQTYRGRFGF 476

Query: 472 I 472
           I
Sbjct: 477 I 477


>gi|86355864|ref|YP_467756.1| pilus assembly secretion protein [Rhizobium etli CFN 42]
 gi|86279966|gb|ABC89029.1| pilus assembly secretion protein [Rhizobium etli CFN 42]
          Length = 498

 Score =  348 bits (893), Expect = 9e-94,   Method: Composition-based stats.
 Identities = 225/498 (45%), Positives = 310/498 (62%), Gaps = 30/498 (6%)

Query: 2   RYLQRTFFTMMSIFLFSSNPSVAKLPPI-----KEANAAVINISDVEIGKGKKISIGLNK 56
           R  +      +S+ + ++  + A   P+       A  +++ IS       +++ +GLNK
Sbjct: 6   RRAKLLLTGCLSLAVGATGIAPASFGPLLVVNEARAAESLVRISQTGPDAHRRLKLGLNK 65

Query: 57  VIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILI 116
            +++ +P D  D+LVSDPT AD V  + R +YLFGK VGQ N+ + G  G++++NLDI I
Sbjct: 66  AVVVDLPEDAHDILVSDPTMADAVTRTSRRIYLFGKKVGQTNIFVFGAGGQEVVNLDIEI 125

Query: 117 ERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQY 176
           ERD++ LE  LRRFI DSNI+VE+VSD +VL G VRT QD+ +A +L++ FL        
Sbjct: 126 ERDVSGLETNLRRFIPDSNIKVEIVSDNIVLTGTVRTPQDATQAADLAQVFLKGGEATTR 185

Query: 177 ANSSS-----------------KKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQH-- 217
             ++S                  +V+NLL I GEDQVTLKVTI EVRR++LKQ+GF +  
Sbjct: 186 TETASGTGGDSSVALFAEGRQTSQVVNLLQIQGEDQVTLKVTITEVRREVLKQLGFDNLV 245

Query: 218 -SITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPT 276
            + +G +     S  AD     V  G     K  + ++   T L+ALE+A  +RTLAEPT
Sbjct: 246 SNSSGMTVAQLGSPNADSATATVGGGLAALFKSSIGKYDISTYLNALEQAKVVRTLAEPT 305

Query: 277 LTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEV 336
           LTAISGQ+A+F SGGQ LY T   + G  +V   +YG+ L F P VLS GRI L I+T V
Sbjct: 306 LTAISGQAATFNSGGQQLYSTT-DNNGNVTVVPFNYGINLAFKPVVLSSGRISLEIKTNV 364

Query: 337 SEPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGA 396
           SEPV G        Y+ R A+T+VELPSGG+I LAGL++D++ Q   G P +SKIP+LG 
Sbjct: 365 SEPVAGSGNAT---YQRRSAETSVELPSGGSIALAGLIRDNVSQTMGGTPGVSKIPLLGT 421

Query: 397 LFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKE 456
           LFR   F R+ETE+ I ATP+LV+PVA   L+RPDD++S E+D   FF NRVNK+YG +E
Sbjct: 422 LFRQKGFERQETELVIIATPYLVRPVARNQLNRPDDNFSPENDGATFFLNRVNKVYGRRE 481

Query: 457 ASEVEGQNYKGAIGFIYK 474
           A   + Q + G+IGFIYK
Sbjct: 482 APVADAQ-FHGSIGFIYK 498


>gi|91977985|ref|YP_570644.1| type II and III secretion system protein [Rhodopseudomonas
           palustris BisB5]
 gi|91684441|gb|ABE40743.1| type II and III secretion system protein [Rhodopseudomonas
           palustris BisB5]
          Length = 480

 Score =  348 bits (893), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 158/482 (32%), Positives = 266/482 (55%), Gaps = 23/482 (4%)

Query: 1   MRYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIIL 60
           +R L+ T   + ++   +  P++A +            + +  +   + +++G+ K +++
Sbjct: 10  IRTLKGTAMALSAVVALTLFPTLAPVQASDY-RDTPARMGNSGLN-ARPLALGIGKSVVI 67

Query: 61  QVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDI 120
            +P D++DVLV+DP  A+ VV S +  Y+ G  VGQ N++     G+Q+   DI + RD+
Sbjct: 68  DLPRDIKDVLVADPKIANAVVRSAQRAYIIGAAVGQTNIVFFDSTGQQIAAYDIAVTRDL 127

Query: 121 AHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSS 180
             +   LR+ I +++I+VE + D V+L G V T  ++Q+A +L+                
Sbjct: 128 NGIRTALRQSIPNADIQVEGLGDGVMLIGSVATPIEAQQAADLAARLAGD---------- 177

Query: 181 SKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSI---TGSSSGPSKSFAADFGGK 237
           + KV+N + + G DQV LK+T+AEV+RDI+KQ+G   +     G+S     +        
Sbjct: 178 ASKVVNNIAVRGRDQVMLKITVAEVQRDIVKQLGVDLTASMNYGTSVVKFSNTNPFTQSG 237

Query: 238 FVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKT 297
                 +          S    L A+E A  +RTLAEP LTAISG+ ASF +GG+    +
Sbjct: 238 GPLVANNALTTSFGSGPSVSATLRAMESAGVVRTLAEPNLTAISGEPASFLAGGEFPVPS 297

Query: 298 VSSSTG---ATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVN----AGDMPS 350
             + T      SVT   +GV+L+FTP VL+ GRI L++ TEVSE     +       +PS
Sbjct: 298 GVTCTNSLCTPSVTFKKFGVLLNFTPVVLTEGRISLKVSTEVSEVSSDNSIVIGGLSVPS 357

Query: 351 YRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEI 410
            + R+ ++TVE+PSGG++ +AGL+++  +Q   G+P ++++PILG LFR+  +   +TE+
Sbjct: 358 IKTRRIESTVEIPSGGSLAMAGLIQEQTKQAINGLPGMTQLPILGTLFRSRDYINRQTEL 417

Query: 411 FIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIG 470
            +  TP++V+ VA +DLSRPDD ++   D ++     +N+IYG    +    Q Y+G  G
Sbjct: 418 MVMVTPYVVRAVAQKDLSRPDDGFADASDPQSDLLGNINRIYGVPGRTGPA-QTYRGRFG 476

Query: 471 FI 472
           FI
Sbjct: 477 FI 478


>gi|39936740|ref|NP_949016.1| type II and III secretion system protein [Rhodopseudomonas
           palustris CGA009]
 gi|192292566|ref|YP_001993171.1| type II and III secretion system protein [Rhodopseudomonas
           palustris TIE-1]
 gi|39650596|emb|CAE29119.1| putative exporter protein, cpaC [Rhodopseudomonas palustris CGA009]
 gi|192286315|gb|ACF02696.1| type II and III secretion system protein [Rhodopseudomonas
           palustris TIE-1]
          Length = 480

 Score =  348 bits (893), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 158/476 (33%), Positives = 260/476 (54%), Gaps = 23/476 (4%)

Query: 7   TFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDV 66
           T   + +    +  PS   +       A V   S       + IS+G+ K +++ +P D+
Sbjct: 16  TAIALSAAVALTLIPSWTAVHASDYRAAPVPPASSGL--NAQSISLGIGKSMVIDLPRDI 73

Query: 67  QDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMT 126
           +DVLV+DP  A+ VV S +  Y+ G  VGQ N++     G+Q+   DI + RD+  L   
Sbjct: 74  KDVLVADPKIANAVVRSAQRAYIIGAAVGQTNIVFFDSAGRQIAAYDIAVTRDLNGLRTA 133

Query: 127 LRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMN 186
           L++ + ++ I+VE + D V+L+G V +  D+Q+A +L+   + +           KKV+N
Sbjct: 134 LKQTLPNAEIQVEGLGDGVMLNGWVTSPIDAQQAYDLAVRLVGED----------KKVVN 183

Query: 187 LLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFG---GKFVSEGG 243
            + + G DQV LK+T+AEV+RDI+KQ+G   S   +      +F                
Sbjct: 184 NIAVRGRDQVMLKITVAEVQRDIVKQLGVDLSANMAYGTAVVNFNNSNPFTQSGGPLVSS 243

Query: 244 DFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTG 303
           +          S    L A+E A  +RTLAEP LTAISG+ A+F +GG+    +  + T 
Sbjct: 244 NALTTKFGSLPSVTATLRAMESAGVVRTLAEPNLTAISGEPATFLAGGEFPVPSGVTCTN 303

Query: 304 ---ATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAG----DMPSYRVRKA 356
                SVT   +G++L+FTP V++ GRI L++ TEVSE     +       +PS + R+ 
Sbjct: 304 GVCTPSVTFKKFGILLNFTPVVMTAGRISLKVMTEVSEVSSDNSVIISNMSVPSIKTRRV 363

Query: 357 DTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATP 416
           ++TVE+PSGG++ +AGL+++  +Q   G+P  +++PILG LFR+  +   +TE+ +  TP
Sbjct: 364 ESTVEIPSGGSLAMAGLIQEQTKQAINGMPGAAQLPILGTLFRSRDYINRQTELMVLVTP 423

Query: 417 FLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFI 472
           ++V+ VA +DLSRPDD ++   D ++     +NK+YG    +E   + Y+G  GFI
Sbjct: 424 YVVRAVAQKDLSRPDDGFADASDPQSDLLGSINKLYGVPGRTEPA-RTYRGRFGFI 478


>gi|190889881|ref|YP_001976423.1| pilus assembly secretion protein [Rhizobium etli CIAT 652]
 gi|190695160|gb|ACE89245.1| pilus assembly secretion protein [Rhizobium etli CIAT 652]
 gi|327194694|gb|EGE61540.1| pilus assembly secretion protein [Rhizobium etli CNPAF512]
          Length = 499

 Score =  348 bits (892), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 225/487 (46%), Positives = 308/487 (63%), Gaps = 29/487 (5%)

Query: 12  MSIFLFSSNPSV-AKLPPIKEANA---AVINISDVEIGKGKKISIGLNKVIILQVPVDVQ 67
           ++I +    P+    L  + EA A    +I I+       +++ +GLNK +++ +P D  
Sbjct: 18  LAISVTGMAPATFGPLLAVDEARADSGNLIRIAQTGPDAHRRLKLGLNKAVVVDLPEDAH 77

Query: 68  DVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTL 127
           D+LVSDP+ AD V  + R +YLFGK VGQ N+ + G  G++++NLDI IERD++ LE  L
Sbjct: 78  DILVSDPSMADAVTRTSRRIYLFGKKVGQTNIFVFGAGGQEIINLDIEIERDVSGLEANL 137

Query: 128 RRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSK----- 182
           RRFI DSNI VE+VSD +VL G VRT QD+ +A +L++ FL          ++S      
Sbjct: 138 RRFIPDSNINVEIVSDNIVLTGTVRTPQDATQAADLAQVFLKGGEATTRTETASGTGGDS 197

Query: 183 ------------KVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQH---SITGSSSGPS 227
                       +V+NLL I GEDQVTLKVTIAEVRR++LKQ+GF +   + +G +    
Sbjct: 198 AVALFAEGRQTSQVVNLLKIEGEDQVTLKVTIAEVRREVLKQLGFDNLISNSSGMTVAQL 257

Query: 228 KSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASF 287
            + +AD     V  G     K  + ++   T L+ALE+A  +RTLAEPTLTAISGQ+A+F
Sbjct: 258 GTPSADSATATVGGGLAALFKSSIGKYDISTYLNALEQAKVVRTLAEPTLTAISGQAATF 317

Query: 288 TSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGD 347
            SGGQ LY T   + G  +V   +YG+ L F P VLS GRI L I+T VSEPV G     
Sbjct: 318 NSGGQQLYSTT-DNDGNVTVVPFNYGINLAFKPVVLSSGRISLEIKTNVSEPVAGSGNAT 376

Query: 348 MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREE 407
              Y+ R A+T+VELPSGG+I LAGL++D++ Q   G P +SKIP+LG LFR   F R+E
Sbjct: 377 ---YQRRSAETSVELPSGGSIALAGLIRDNVSQTMGGTPGVSKIPLLGTLFRQKGFERQE 433

Query: 408 TEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKG 467
           TE+ I ATP+LV+PVA   L+RPDD++S E+D   FF NRVNK+YG +EA   + Q + G
Sbjct: 434 TELVIIATPYLVRPVARNQLNRPDDNFSPENDGATFFLNRVNKVYGRREAPVADAQ-FHG 492

Query: 468 AIGFIYK 474
           +IGFIYK
Sbjct: 493 SIGFIYK 499


>gi|209551759|ref|YP_002283676.1| type II and III secretion system protein [Rhizobium leguminosarum
           bv. trifolii WSM2304]
 gi|209537515|gb|ACI57450.1| type II and III secretion system protein [Rhizobium leguminosarum
           bv. trifolii WSM2304]
          Length = 499

 Score =  347 bits (890), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 221/487 (45%), Positives = 307/487 (63%), Gaps = 29/487 (5%)

Query: 12  MSIFLFSSNPSVAKL----PPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQ 67
           +++ +    P+           +  +  ++ IS       +++ +GLNK +++ +P D  
Sbjct: 18  LAVGISGIAPASFAPLLGSSEARADSENLVRISQTGRDAHRRLKLGLNKAVVVDLPEDAH 77

Query: 68  DVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTL 127
           D+LVSDPT AD V  + R +YLFGK VGQ N+ + G  G++++NLDI IERD++ LE+ L
Sbjct: 78  DILVSDPTMADAVTRTSRRIYLFGKKVGQTNIFVFGAGGQEIVNLDIEIERDVSGLEVNL 137

Query: 128 RRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSK----- 182
            RFI DSNI VE+VSD +VL G VRT QD+ +A +L++ FL          ++S      
Sbjct: 138 HRFIPDSNINVEIVSDNIVLTGTVRTPQDATQAADLAQVFLKGGEATTRTETASGTGGDS 197

Query: 183 ------------KVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQH---SITGSSSGPS 227
                       +V+NLL I GEDQVTLKVTIAEVRR++LKQ+GF +   + +G +    
Sbjct: 198 SVALFAEGRQTSQVVNLLQIEGEDQVTLKVTIAEVRREVLKQLGFDNLVSNSSGMTVAQL 257

Query: 228 KSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASF 287
            S +AD     V  G     K  + ++   T L+ALE+A  ++TLAEPTLTAISGQ+A+F
Sbjct: 258 GSPSADSATSVVGGGLAALFKSSIGKYDISTYLNALEQAKVVKTLAEPTLTAISGQAATF 317

Query: 288 TSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGD 347
            SGGQ LY T   S G  +V   +YG+ L F P VLS GRI L+I+T VSEPV G +   
Sbjct: 318 NSGGQQLYSTT-DSNGNVTVVPFNYGINLAFKPVVLSSGRISLQIKTNVSEPVAGSSGAT 376

Query: 348 MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREE 407
              Y+ R A+T+VELPSGG+I LAGL++D++ Q   G P +SKIP+LG LFR   F R+E
Sbjct: 377 ---YQRRSAETSVELPSGGSIALAGLIRDNVSQTMGGTPGVSKIPLLGTLFRQKGFERQE 433

Query: 408 TEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKG 467
           TE+ I ATP+LV+PVA   L+RPDD++S E+D   FF NRVNK+YG +EA   + Q + G
Sbjct: 434 TELVIIATPYLVRPVARNQLNRPDDNFSPENDGATFFLNRVNKVYGRREAPVADAQ-FHG 492

Query: 468 AIGFIYK 474
           +IGFIYK
Sbjct: 493 SIGFIYK 499


>gi|163733542|ref|ZP_02140985.1| type II/III secretion system protein, putative [Roseobacter
           litoralis Och 149]
 gi|161393330|gb|EDQ17656.1| type II/III secretion system protein, putative [Roseobacter
           litoralis Och 149]
          Length = 440

 Score =  347 bits (889), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 121/455 (26%), Positives = 213/455 (46%), Gaps = 24/455 (5%)

Query: 28  PIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTM 87
               A A  + I   E    + +++  N+ ++++  +   ++ +++P  AD+   S R++
Sbjct: 2   APLTAQAEALRIIARET--SETLNVSQNRAVVVESEIPFAELSIANPGIADISSLSDRSI 59

Query: 88  YLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVL 147
           Y+ GK  G   + L+   G+ + N+++ +  D+   +  LR+ +    I V   +D +VL
Sbjct: 60  YVLGKVPGITTLTLLDAAGQLITNVEVRVAPDLTEFKERLRQILPGEAIEVRTANDGIVL 119

Query: 148 HGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRR 207
            G V + Q   +A+EL+  +            +  +V NL+ + G  QV LKV  AE+ R
Sbjct: 120 SGQVSSSQRLSKALELAARY------------APDRVSNLMTVGGVQQVMLKVRFAEMSR 167

Query: 208 DILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEG--GDFSVKGVLDRFSFETVLHALER 265
            + KQ+     I G+ +               ++   G       L     + +L ALE 
Sbjct: 168 GVSKQLQSSLRIGGTEAQAGIGRGIGGIPNLAADTAQGAVFFDFGLGSTQVQLLLEALET 227

Query: 266 ATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSP 325
             A+RTLAEP L ++SGQ A+F +GG++       S    SV    +G+ L+F P V+  
Sbjct: 228 KGAVRTLAEPNLVSLSGQEANFLAGGEYPVPV--QSEDGISVDYKPFGIELNFVPRVVDG 285

Query: 326 GRIGLRIQTEVSEPVIGVN-----AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQ 380
             I L++    S            +  + ++  R+A TTVE+  G +  +AGLL+D+   
Sbjct: 286 DLINLQLSAATSSIDPSNGISVGDSFTVDAFIRREASTTVEMRDGESFAIAGLLEDNFND 345

Query: 381 LKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDA 440
               +P LS +PILGALFR++ + R +TE+ I  T  LV P     L+ P D      + 
Sbjct: 346 NISQVPWLSDVPILGALFRSTDYMRNQTELVIIITAHLVTPTRGEALALPTDRIRPPSEK 405

Query: 441 KAFFFNR-VNKIYGPKEASEVEGQNYKGAIGFIYK 474
             F   R +  +     A EV  Q++ G+ G++ +
Sbjct: 406 DLFLNGRTIQTLNARGAAGEVAKQDFGGSYGYVME 440


>gi|294676059|ref|YP_003576674.1| type II and III secretion system protein [Rhodobacter capsulatus SB
           1003]
 gi|294474879|gb|ADE84267.1| type II and III secretion system protein [Rhodobacter capsulatus SB
           1003]
          Length = 469

 Score =  347 bits (889), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 124/470 (26%), Positives = 219/470 (46%), Gaps = 43/470 (9%)

Query: 28  PIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTM 87
                 A  + I          +++ +N+ ++++      ++ +++P  ADV   S +T+
Sbjct: 20  VTLPVAAETLRIVSGT--GSTPLAVPMNRAVVVESDQPFSELSIANPGIADVTTLSDKTI 77

Query: 88  YLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVL 147
           Y+ GK  G+  + ++G DG  + N+++ +  DIA  +  L++ +   NI V   +D +VL
Sbjct: 78  YVLGKVPGRTTMTILGADGTLLSNVEVQVTPDIAEFKERLKQILPGENIEVRTANDGIVL 137

Query: 148 HGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRR 207
            G V +     RA++L+  +              ++V NL+N+ G  QV LKV  AE++R
Sbjct: 138 SGTVSSSAKLDRALDLARRYAG------------ERVSNLMNVGGTQQVMLKVRFAEMQR 185

Query: 208 DILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEG-------------------GDFSVK 248
            + K +    ++ G+  G +       G    +                     G   + 
Sbjct: 186 SVSKNLASSLAMRGTVGGGNAQTGVITGTGNFTATDAVGNAFDKGTMPISASTQGALGLG 245

Query: 249 GVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVT 308
             +    F  +L ALE    +RTLAEP LTA+SGQ A F +GG++    V       ++ 
Sbjct: 246 FTVGNMEFGVLLEALESKGMVRTLAEPNLTALSGQQAKFLAGGEYPIPVV--DDDGITIE 303

Query: 309 THDYGVVLHFTPTVLSPGRIGLRIQTEVS----EPVIGVNAGDMPSYRVRKADTTVELPS 364
              +GV + F P V+    I L I   VS       +  N   + +++ R+  TTVE+  
Sbjct: 304 YKPFGVEMSFIPRVVDGDLINLEIAAAVSAIDTSVTMTNNGTTVNAFKRRETSTTVEMRD 363

Query: 365 GGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAM 424
           G +  +AGLL+DD   L   IP L  +P+LG+LFR++ F R+++E+ I  TP LV P   
Sbjct: 364 GESFAIAGLLQDDFNDLNTQIPWLGDVPVLGSLFRSTAFERKQSELVIIITPHLVTPTHG 423

Query: 425 RDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
             L+ P D   +  +++ F   +         A EV  Q++ G+ G++ +
Sbjct: 424 EALALPTDRIRLPSESELFLRGKTEG----GAAGEVARQDFSGSYGYVME 469


>gi|220922779|ref|YP_002498081.1| type II and III secretion system protein [Methylobacterium nodulans
           ORS 2060]
 gi|219947386|gb|ACL57778.1| type II and III secretion system protein [Methylobacterium nodulans
           ORS 2060]
          Length = 494

 Score =  345 bits (886), Expect = 6e-93,   Method: Composition-based stats.
 Identities = 151/472 (31%), Positives = 239/472 (50%), Gaps = 20/472 (4%)

Query: 18  SSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKA 77
                 A    +    A V+++   E    ++I +   + +++ +P D ++V V++P  A
Sbjct: 24  GLASPAAAQQRVPAMPAPVLSVGPQEADISRRIDLTQGRSLVVDLPRDAKEVFVANPKVA 83

Query: 78  DVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIR 137
           + VV S R +++ G   G  ++ ++  +G+Q+  LD+ + RD+  L  TL   I      
Sbjct: 84  NAVVRSTRKVFIIGVENGATSIFVMDAEGRQIAALDVTVGRDLNVLRQTLASSIPKGRFE 143

Query: 138 VEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVT 197
           V    D+++L G V +  ++Q+A++++  F+   G       +    +N + I G+DQV 
Sbjct: 144 VRPAGDSILLSGSVNSAAEAQQAIDVANAFVGIGGGGVPGRGAV---INNITIRGKDQVM 200

Query: 198 LKVTIAEVRRDILKQIGFQHSITGSSSG-PSKSFAADFGGKFVSEGGDFSVKGVLDRFSF 256
           L+VT+ EV R +LKQ G   S   S+    + +  A  GG F                S 
Sbjct: 201 LRVTVVEVSRSVLKQFGVNLSGNWSNLNFANVAPLALNGGSFPIGNAISGSINFGGGASL 260

Query: 257 ETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSST--------GATSVT 308
              L A E+A   R LAEPTLTAISG+SA FT+GGQ       + +           SVT
Sbjct: 261 TATLKAFEQAGVSRVLAEPTLTAISGESAKFTAGGQLPVPGNLACSAPSNGVQLCTPSVT 320

Query: 309 THDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVN--------AGDMPSYRVRKADTTV 360
              YGV L FTP VLS  RI +R+ T+V+E     +           +P + VR ++TTV
Sbjct: 321 FKPYGVSLTFTPVVLSENRISIRVGTDVTEIDPQNSMNINFSGTTTAIPGFTVRTSETTV 380

Query: 361 ELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVK 420
           EL SG T++ AGL++   +    G+P L  +PILGALFR+  + R+ETE+ I  TP++ K
Sbjct: 381 ELASGATMMTAGLIQQRNRAAITGLPALMNLPILGALFRSRDYQRDETELMIMVTPYIAK 440

Query: 421 PVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFI 472
            +   ++ RPDD +    D +A    R N++YG   AS +  + Y G  GFI
Sbjct: 441 AMEPAEIKRPDDGFVDATDGQAVLLGRFNRLYGVVGASPLAPKAYHGRFGFI 492


>gi|89068017|ref|ZP_01155434.1| Outer membrane general secretion pathway protein, Secretin
           [Oceanicola granulosus HTCC2516]
 gi|89046256|gb|EAR52313.1| Outer membrane general secretion pathway protein, Secretin
           [Oceanicola granulosus HTCC2516]
          Length = 482

 Score =  345 bits (886), Expect = 7e-93,   Method: Composition-based stats.
 Identities = 130/459 (28%), Positives = 216/459 (47%), Gaps = 43/459 (9%)

Query: 45  GKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGH 104
              + + + +N+ ++++      +V +++P  AD+   S RT+Y+ GK  G+  + L+G 
Sbjct: 36  APSRALQVPMNRAVVVESDTPFTEVSIANPGIADISTLSDRTLYVLGKEPGRTTLTLLGA 95

Query: 105 DGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELS 164
           DG+ + N+++ +  DI   +  L + +   +I V   ++ +VL G V +I    RA+EL+
Sbjct: 96  DGRLITNVEVQVTPDIDEFKERLAQILPGEHIEVRTAANGIVLSGTVSSIARLDRALELA 155

Query: 165 ETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSS 224
           + +            +  +V NL+ + G  QV LKV  AE++R + K +    +  G++ 
Sbjct: 156 QRY------------APDRVSNLMTVGGVQQVMLKVRFAEMQRSVSKSLSSSLTARGTAL 203

Query: 225 GPSKSFAADFGG----------------KFVSEGGDFSVKGVLDRFSFETVLHALERATA 268
           G +    A  G                    +  G   +           +L ALE    
Sbjct: 204 GENLGLTAGTGTLTGNGAIGSALNGNVPAANANNGALLLGFNAGGVEIGMLLEALESRGV 263

Query: 269 IRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRI 328
           +RTLAEP LTA+SGQ A F +GG++    VS   G+ S+    +GV L+F P V+    I
Sbjct: 264 VRTLAEPNLTALSGQEARFLAGGEYPVP-VSQDGGSISIEYKPFGVELNFIPRVVDGDLI 322

Query: 329 GLRIQTEVSEPVIGV----NAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEG 384
            L +Q  VS              + ++R R+  TTVE+  G +  +AGLL DD   L   
Sbjct: 323 NLELQASVSSIDPTNGFVQGGFSIDAFRRRETSTTVEMRDGESFAIAGLLSDDFIDLNSQ 382

Query: 385 IPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFF 444
           +P +  IP+LGALFR++ + R +TE+ I  TP LV P     L+ P D      +   F 
Sbjct: 383 LPFVGDIPVLGALFRSAEYERNQTELVIIVTPHLVTPTRGEALALPTDRVRPPSERDLFL 442

Query: 445 FNRVNKIYGPK----------EASEVEGQNYKGAIGFIY 473
           F RV    G             A+EV  Q++ G+ G++ 
Sbjct: 443 FGRVTAPDGSPIPSSSAPQSGAAAEVARQDFSGSYGYVL 481


>gi|83950066|ref|ZP_00958799.1| bacterial type II/III secretion system protein [Roseovarius
           nubinhibens ISM]
 gi|83837965|gb|EAP77261.1| bacterial type II/III secretion system protein [Roseovarius
           nubinhibens ISM]
          Length = 429

 Score =  345 bits (885), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 131/441 (29%), Positives = 213/441 (48%), Gaps = 34/441 (7%)

Query: 54  LNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLD 113
           +N+ I+++  V   ++ V++ + AD    S RT+YL GK  G+  + L+   G+ + N++
Sbjct: 1   MNRAIVVESDVPFAELSVANASIADFSTLSDRTIYLLGKAPGRTTLTLLDEAGRLITNVE 60

Query: 114 ILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGR 173
           I +  DI+  +  LR+ + +  I V   +D +VL G+V +    QRA++L++ +      
Sbjct: 61  IHVSADISEFKERLRQILPNEKIEVRTANDGIVLSGVVSSTPRMQRALDLAQRY------ 114

Query: 174 NQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAAD 233
                 + ++V NL++++G+ QV LKV  AE++R + K +G    I G S+       + 
Sbjct: 115 ------APERVSNLMSVSGKQQVMLKVRFAEMQRSVSKSLGTSLFIDGLSNAGIGGAIST 168

Query: 234 FG---------------GKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLT 278
            G               G   +  G   +           ++ ALE    +RTLAEP LT
Sbjct: 169 NGIGSSAQTPVGVQPGTGTAGTNNGAAFIGLNAGSAQVGILIQALESKGLVRTLAEPNLT 228

Query: 279 AISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE 338
           A+SGQ A+F +GG++    V+   GA +V    +GV L+F P VL    I L I   VS 
Sbjct: 229 ALSGQEANFLAGGEYPIP-VAQEEGAIAVEFKPFGVQLNFVPYVLDDEVINLEIAAAVSS 287

Query: 339 PVIGVN----AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPIL 394
                        +  +R R   TTV L  G +  +AGLL+DD +     +P L  +PIL
Sbjct: 288 IDPSNGYSDGTITIAGFRTRSTSTTVSLRDGDSFAIAGLLQDDFEDTNGQVPWLGDLPIL 347

Query: 395 GALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNK--IY 452
           GALFR++ + R +TE+ I  T  LV P     L+ P D      +A  F   RV +    
Sbjct: 348 GALFRSANYQRSQTELVIIVTAHLVTPTRGEALALPTDRVLPPSEADLFLNGRVARQVRN 407

Query: 453 GPKEASEVEGQNYKGAIGFIY 473
                 EV  Q++ G+ G++ 
Sbjct: 408 SKGSVGEVAKQDFNGSYGYVM 428


>gi|75674499|ref|YP_316920.1| type II and III secretion system protein [Nitrobacter winogradskyi
           Nb-255]
 gi|74419369|gb|ABA03568.1| type II and III secretion system protein [Nitrobacter winogradskyi
           Nb-255]
          Length = 493

 Score =  345 bits (884), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 161/489 (32%), Positives = 262/489 (53%), Gaps = 35/489 (7%)

Query: 8   FFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIG-KGKKISIGLNKVIILQVPVDV 66
               ++     +    A L P+  ++  V   +        + +S+G+ K +++ +P DV
Sbjct: 14  VARSLAFAAIGAFTLDAALTPVFASDYRVSGAATAGANMHAQSLSLGIGKSVVVDLPRDV 73

Query: 67  QDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMT 126
           +DVLV+DP  A+ VV S +  Y+ G  VGQ N+I     G+Q+   DI + RD+  L   
Sbjct: 74  KDVLVADPKIANAVVRSAQRAYIIGAAVGQTNIIFFDSSGQQISAYDIAVTRDLNGLRTA 133

Query: 127 LRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMN 186
           L++ + ++ I+V+ + D V+L G V    ++Q+A +L+                ++KV+N
Sbjct: 134 LKQLLPNAAIKVDGLGDGVMLSGWVSNPIEAQQAGDLAARLTDG----------AQKVVN 183

Query: 187 LLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSI---------TGSSSGPSKSFAADFGGK 237
            + + G DQV LKVT+AEV R ++KQ+G   S            +++ P  +        
Sbjct: 184 NIAVRGRDQVMLKVTVAEVARTVIKQMGIDLSASMNYGTAVVNFTNANPFTALGRPLTNN 243

Query: 238 FVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKT 297
             +     ++ G     +    L A+E A  IRTLAEP LTAISG+SA+F SGG+     
Sbjct: 244 SAAASFGSTMVGGAPVPAVTATLRAMESAGVIRTLAEPNLTAISGESATFISGGEFPIPA 303

Query: 298 VSSSTGATSVT-----THDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGV--------- 343
             S   AT V         +G+ L+FTP VL+ GRI LR+ TEVSE              
Sbjct: 304 GFSCDPATRVCLTQIRFKKFGISLNFTPVVLTEGRISLRVMTEVSELSNENSMTLNQSVG 363

Query: 344 NAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRF 403
           N+  +PS R R+A+TT+E+PSGG++ +AGL+    +Q+  G+P ++++P+LGALFR+  +
Sbjct: 364 NSLTVPSIRTRRAETTLEIPSGGSMAMAGLIHQQTKQVINGLPGIAQVPVLGALFRSRDY 423

Query: 404 NREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQ 463
              +TE+ +  TP++V+ VA +DLSRPDD ++   D ++     +N+IYG     E   +
Sbjct: 424 VNGQTELMVLVTPYVVRAVAQKDLSRPDDGFADASDPQSDLLGSLNRIYGAPGRVEPA-R 482

Query: 464 NYKGAIGFI 472
           +Y+G  GFI
Sbjct: 483 HYRGTYGFI 491


>gi|259417373|ref|ZP_05741292.1| type II and III secretion system protein [Silicibacter sp.
           TrichCH4B]
 gi|259346279|gb|EEW58093.1| type II and III secretion system protein [Silicibacter sp.
           TrichCH4B]
          Length = 442

 Score =  345 bits (884), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 124/445 (27%), Positives = 217/445 (48%), Gaps = 30/445 (6%)

Query: 45  GKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGH 104
           G    + + +N+ ++++  V   ++ +++P  AD+   S RT+Y+ GK+ G   + L+  
Sbjct: 11  GTNAVLDVPMNRAVVVEADVPFAELSIANPGIADISSLSDRTIYVLGKSPGMTTLTLLDG 70

Query: 105 DGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELS 164
            G  + N+D+ +  D++  +  L++ + +  I V   +D +VL G V + Q  QRA++L+
Sbjct: 71  SGGLITNVDVRVAADVSEFKQRLQQILPNEKIEVRTANDGIVLSGTVSSAQRLQRALDLA 130

Query: 165 ETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSS 224
           E +            +  +V NL+ + G  QV LKV  AE+ R + K +G    I  S  
Sbjct: 131 ERY------------APDRVSNLMTVGGIQQVMLKVRFAEMERSVSKSLGGSMLIGSSDG 178

Query: 225 GPSKSFAAD---FGGKFVSEG---------GDFSVKGVLDRFSFETVLHALERATAIRTL 272
             S     +    GG F ++          G       +    F  +L ALE+   +RTL
Sbjct: 179 NVSTGTFLNRPEGGGVFGTDSPVNLKADTLGAAIFGFDIGAVQFNVLLEALEQKGLVRTL 238

Query: 273 AEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRI 332
           AEP L+A+SGQ ASF +GG++    V+   G  +V    +G+ L+F P V+    I L +
Sbjct: 239 AEPNLSALSGQEASFLAGGEYPVP-VAQEEGVVTVEFKPFGIELNFIPRVVDGDLINLEL 297

Query: 333 QTEVSEPVIGV----NAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLL 388
           +  VS          +   + ++  R+  TTVEL  G +  +AGL++D+ +     +P L
Sbjct: 298 KAAVSAIDTTNAATFDGFSINAFSRRETATTVELRDGESFAIAGLIEDEFRDGAAQVPWL 357

Query: 389 SKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRV 448
             +P+LGALFR++ + R ++E+ I  +  LV P     L+ P D      +   F F R 
Sbjct: 358 GDVPVLGALFRSADYERNQSELVIIVSAHLVTPTRGEALALPTDRIRPPSEKNLFLFGRT 417

Query: 449 NKIYGPKEASEVEGQNYKGAIGFIY 473
            +      A EV  Q++ G+ G++ 
Sbjct: 418 ERAQ-SGAAGEVANQDFNGSYGYLL 441


>gi|148258235|ref|YP_001242820.1| putative pilus assembly protein CpaC [Bradyrhizobium sp. BTAi1]
 gi|146410408|gb|ABQ38914.1| putative Pilus assembly protein cpaC [Bradyrhizobium sp. BTAi1]
          Length = 497

 Score =  345 bits (884), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 163/491 (33%), Positives = 266/491 (54%), Gaps = 31/491 (6%)

Query: 1   MRYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIIL 60
           +R       +  +    + NP++A +       A     +D +I   + +++G+ K +++
Sbjct: 17  LRTAMVRALSFSAAAALTLNPALAPVIAADYHPAVTAAAADGQIN-ARFLALGVGKSVVI 75

Query: 61  QVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDI 120
            +P D++DVLV+DP  A+ VV S +  Y+ G  VGQ N++     G+Q+   DI ++RD+
Sbjct: 76  DLPRDIKDVLVADPKIANAVVRSSQRAYIIGATVGQTNIVFFDAQGQQIAAYDIAVKRDL 135

Query: 121 AHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSS 180
                 L++ + +S+I++E + D++VL G   +  ++Q+A EL+                
Sbjct: 136 NGARAALKQLLPNSDIQIEGLGDSIVLSGSAASQIEAQQAGELAARLAGG---------- 185

Query: 181 SKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSF-AADFGGKFV 239
           + KV+N + + G DQV LKVT+AEV+R ++KQ+G   S   +       F  ++    + 
Sbjct: 186 ADKVVNSITVRGRDQVMLKVTVAEVQRSVVKQLGIDLSGQLNYGTAVVKFANSNPFTAYG 245

Query: 240 SEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVS 299
           S     +        S +  L A+E A  IRTLAEP LTAISG+SA+F +GG+       
Sbjct: 246 SNLVSNNAINASFGSSVQATLRAMENAGVIRTLAEPNLTAISGESATFIAGGEFPVPAGY 305

Query: 300 SSTGATSVT-----THDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVI------------- 341
           S    T V         +G+ L+FTP VL+ GRI LR+ TEVSE                
Sbjct: 306 SCDPTTHVCTTQISFKKFGISLNFTPVVLAEGRISLRVMTEVSELSNENSITLSQAVTSS 365

Query: 342 GVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNS 401
            VN+  +PS + R+A+TT+E+PSGG + +AGL++   +Q   G+P L ++P+LG LFR+ 
Sbjct: 366 TVNSLTVPSIKTRRAETTLEIPSGGAMAMAGLIQQQTKQAISGMPGLMQLPVLGTLFRSR 425

Query: 402 RFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVE 461
            +   +TE+ +  TPF+V+ VA +DLSRPDD ++   D +A     +N+IYG     E  
Sbjct: 426 DYVNNQTELMVLVTPFVVRAVAQKDLSRPDDGFAAASDRQADLLGSINRIYGVPGRVEP- 484

Query: 462 GQNYKGAIGFI 472
           G++Y+G  GFI
Sbjct: 485 GRSYRGTYGFI 495


>gi|170740621|ref|YP_001769276.1| type II and III secretion system protein [Methylobacterium sp.
           4-46]
 gi|168194895|gb|ACA16842.1| type II and III secretion system protein [Methylobacterium sp.
           4-46]
          Length = 501

 Score =  345 bits (884), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 145/460 (31%), Positives = 243/460 (52%), Gaps = 16/460 (3%)

Query: 25  KLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSP 84
           +        A V++I   E    ++I +   + +++ +P D ++V V++P  A+ VV S 
Sbjct: 44  RAEKAPAIAAPVLSIGPQEAEIARRIDLTQGRSLVIDLPRDAKEVFVANPKVANAVVRST 103

Query: 85  RTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDT 144
           R +++ G   G  ++ ++  +G+Q+ +LD+ + RD+  L  TL   +  +   V    D+
Sbjct: 104 RKVFIIGVENGATSIFVMDAEGRQIASLDVTVGRDLNILRQTLATSLPSARFEVRPAGDS 163

Query: 145 VVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAE 204
           ++L G V +  ++Q+A++++  F+           +   V+N + I G+DQV L+VT+ E
Sbjct: 164 ILLSGTVNSATEAQQALDIANAFVG----IAGGTVTRGAVINNITIRGKDQVMLRVTVVE 219

Query: 205 VRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALE 264
           V R +LKQ G   S + S    + +      G                  S +  L A E
Sbjct: 220 VSRTVLKQFGVSLSGSWSGLNLTNATQFALNGDRGLGNLIEGTINGGAGASLKATLKAFE 279

Query: 265 RATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSS----STGATSVTTHDYGVVLHFTP 320
           +A   R LAEPTLTAISG+SA FT+GG+    +  S    +     +T   YGVVL+FTP
Sbjct: 280 QAGVSRILAEPTLTAISGESAKFTAGGEIAVPSGLSCTTANNCIPGITFKQYGVVLNFTP 339

Query: 321 TVLSPGRIGLRIQTEVSEPVI--------GVNAGDMPSYRVRKADTTVELPSGGTIVLAG 372
            VLS  RI +R+ T+V+E           G  +  +P + +RK++TT+EL SG TI+ AG
Sbjct: 340 VVLSENRISIRVGTDVTEIDQQNAYSYNIGTTSTSVPGFTIRKSETTIELASGATIMTAG 399

Query: 373 LLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDD 432
           L++   +    G+P L  +P+LGALFR+  + R+ETE+ I  TP++ K +   ++ RPDD
Sbjct: 400 LIQQKNKAAVMGLPALMNLPVLGALFRSRDYQRDETELMIMVTPYIAKAMDPGEVKRPDD 459

Query: 433 HYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFI 472
            +    D +A    R N++YG   A+ +  + Y+G  GFI
Sbjct: 460 GFVDATDGQAILLGRFNRLYGVVGAAPLAPKAYRGKFGFI 499


>gi|116249981|ref|YP_765819.1| pilus assembly protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115254629|emb|CAK05703.1| putative pilus assembly protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 501

 Score =  345 bits (884), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 223/487 (45%), Positives = 309/487 (63%), Gaps = 29/487 (5%)

Query: 12  MSIFLFSSNPS----VAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQ 67
           ++I +    P+    +      +  + +++ IS       +++ +GLNK +++ +P D  
Sbjct: 20  LAIGVSGMVPASFATLFAAGEARADSDSLVRISQTGSNAHRRLKLGLNKAVVVDLPEDAH 79

Query: 68  DVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTL 127
           D+LVSDPT AD V  + R +YLFGK VGQ N+ + G  G++++NLDI IERD++ LE+ L
Sbjct: 80  DILVSDPTMADAVTRTSRRIYLFGKKVGQTNIFVFGAGGQEIVNLDIEIERDVSGLEVNL 139

Query: 128 RRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSK----- 182
           RRFI DSNI VE+VSD +VL G VRT QD+ +A +L++ FL          ++S      
Sbjct: 140 RRFIRDSNINVEIVSDNIVLTGTVRTPQDATQAADLAQVFLKGGEATTRTETASGTGGDS 199

Query: 183 ------------KVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQH---SITGSSSGPS 227
                       +V+NLL I GEDQVTLKVTIAEVRR++LKQ+GF +   + +G +    
Sbjct: 200 SVALFAEGRQSSQVVNLLQIEGEDQVTLKVTIAEVRREVLKQLGFDNLVSNSSGMTVAQL 259

Query: 228 KSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASF 287
            S +AD     V  G     K  + ++   T L+ALE+A  ++TLAEPTLTAISGQ+A+F
Sbjct: 260 GSPSADSATATVGGGLAALFKSSIGKYDISTYLNALEQAKVVKTLAEPTLTAISGQAATF 319

Query: 288 TSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGD 347
            SGGQ LY T   S G  +V   +YG+ L F P VLS GRI L+I+T VSEPV G     
Sbjct: 320 NSGGQQLYSTT-DSDGNVTVVPFNYGINLAFKPVVLSSGRISLQIKTNVSEPVAGSGNAT 378

Query: 348 MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREE 407
              Y+ R A+T+VELPSGG+I LAGL++D++ Q   G P +SKIP+LG LFR   F R+E
Sbjct: 379 ---YQRRSAETSVELPSGGSIALAGLIRDNVSQTMGGTPGVSKIPLLGTLFRQKGFERQE 435

Query: 408 TEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKG 467
           TE+ I ATP+LV+PVA   L+RPDD++S E+D   FF NRVNK+YG +EA   + Q + G
Sbjct: 436 TELVIIATPYLVRPVARNQLNRPDDNFSPENDGATFFLNRVNKVYGRREAPVADAQ-FHG 494

Query: 468 AIGFIYK 474
           +IGFIYK
Sbjct: 495 SIGFIYK 501


>gi|85705151|ref|ZP_01036251.1| bacterial type II/III secretion system protein [Roseovarius sp.
           217]
 gi|85670473|gb|EAQ25334.1| bacterial type II/III secretion system protein [Roseovarius sp.
           217]
          Length = 428

 Score =  344 bits (883), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 123/440 (27%), Positives = 208/440 (47%), Gaps = 33/440 (7%)

Query: 54  LNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLD 113
           +N+ ++++      ++ +++P  AD    S RT+Y+ GK  G+  + L    G+ + N+D
Sbjct: 1   MNRAVVVESDSPFAELSIANPAIADFSTLSDRTIYVLGKTPGRTTLSLFDGAGQLITNID 60

Query: 114 ILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGR 173
           + +  DI   +  L++ +    I V   +D +V+ G V +    QRA++L+E +      
Sbjct: 61  VHVSTDIEEFKERLKQILPGEPIEVRSANDGIVISGTVSSSSRMQRALDLAERY------ 114

Query: 174 NQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAAD 233
                 + ++V NL++++G+ QV LKV  AE++R + K +    SI    +     F   
Sbjct: 115 ------APERVSNLMSVSGKQQVMLKVRFAEMQRSVSKALSTSLSIDARGANQVGVFGGT 168

Query: 234 FGGKFVS---------------EGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLT 278
                +                  G F+    +       +L ALE    +RTLAEP LT
Sbjct: 169 NTTNTLGGVLGSTAGTIPGANDNNGVFNFGFDVGSVEVGILLEALETKGVVRTLAEPNLT 228

Query: 279 AISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE 338
           A+SGQ A F +GG+     V+     T+V    +GV L+F P V+  G I L +   VS 
Sbjct: 229 ALSGQEAKFLAGGEFPVP-VAQDNDTTTVEFKPFGVELNFVPRVVDDGIINLEMAAAVSS 287

Query: 339 PVIGVN----AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPIL 394
                +       +P++R R   TTV L  G +  +AGLL+DD +     +P L  +P+L
Sbjct: 288 IDTSNSLVSDGFSIPAFRRRDTSTTVALRDGESFAIAGLLQDDFRDNAGQVPWLGDVPVL 347

Query: 395 GALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRV-NKIYG 453
           GALFR++ + R +TE+ I  +  LV P     L+ P D   +  +   F   RV N +  
Sbjct: 348 GALFRSADYQRSQTELVIIVSAHLVSPSRGEALALPTDRVKLPSEKDLFLNGRVANGVSD 407

Query: 454 PKEASEVEGQNYKGAIGFIY 473
                EV  Q++ G+ G++ 
Sbjct: 408 RGAVGEVAKQDFTGSYGYVM 427


>gi|254475652|ref|ZP_05089038.1| type II and III secretion system protein:Transport-associated
           [Ruegeria sp. R11]
 gi|214029895|gb|EEB70730.1| type II and III secretion system protein:Transport-associated
           [Ruegeria sp. R11]
          Length = 452

 Score =  344 bits (883), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 122/465 (26%), Positives = 223/465 (47%), Gaps = 33/465 (7%)

Query: 26  LPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPR 85
           +P  + A A  + +     G    + + +N+ ++++  V   ++ +++P+ AD+   S R
Sbjct: 3   MPSAQGAWAEGLRVVKK--GTSSNLEVPMNRAVVVESDVPFSELSIANPSIADISSLSDR 60

Query: 86  TMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTV 145
           T+Y+ GK+ G  +    G  G+ + N+D+ +  D++  +  LR+ +    I V   +D +
Sbjct: 61  TIYVLGKSPGPDHPHAFGCVGRLITNVDVRVAADVSEFKERLRQILPGEKIEVRTANDGI 120

Query: 146 VLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEV 205
           VL G+V +    QRA++L+E +            +  +V NL+++ G  QV LKV  AE+
Sbjct: 121 VLSGVVSSSARLQRALDLAERY------------APDRVSNLMSVGGVQQVMLKVRFAEM 168

Query: 206 RRDILKQIGFQHSITG-------------SSSGPSKSFAADFGGKFVSEGGDFSVKGVLD 252
           +R + K +     + G             ++ G   +             G F       
Sbjct: 169 QRTVSKSLSASLGVNGGNSVGVNGGTSTLNTQGALTNSLTGNIPAANDNTGAFVFGFNAG 228

Query: 253 RFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDY 312
            F    +L ALE+   +RTLAEP L+A+SGQ A F +GG++    V+   G  ++    +
Sbjct: 229 AFQVNLLLEALEQKGVVRTLAEPNLSALSGQEAKFLAGGEYPIP-VAQEDGVITIEFKPF 287

Query: 313 GVVLHFTPTVLSPGRIGLRIQTEVSEPVIGV----NAGDMPSYRVRKADTTVELPSGGTI 368
           G+ L+F P V+    I L ++  VS          N   + ++  R++ TTVE+  G + 
Sbjct: 288 GIELNFIPRVVDADVINLEMKAAVSAIDPTNSIELNGLSIAAFSRRESVTTVEMRDGESF 347

Query: 369 VLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLS 428
            +AGL++D+ +     +P +  +P+LG+LFR++ + R +TE+ I  +  LV P     LS
Sbjct: 348 AIAGLIRDEFRDNSSQLPWIGDVPVLGSLFRSANYQRAQTELVIIVSAHLVTPTRGEALS 407

Query: 429 RPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIY 473
            P D      +   F F  V +      ASEV  Q++ G+ G++ 
Sbjct: 408 LPTDRIRPPSETDLFLFGNVAR-ERKGPASEVAKQDFNGSYGYVL 451


>gi|110636321|ref|YP_676529.1| type II and III secretion system protein [Mesorhizobium sp. BNC1]
 gi|110287305|gb|ABG65364.1| type II and III secretion system protein [Chelativorans sp. BNC1]
          Length = 516

 Score =  344 bits (883), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 191/495 (38%), Positives = 277/495 (55%), Gaps = 50/495 (10%)

Query: 27  PPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRT 86
           P I  + A    + +V     +++ +GLNK ++L +P D  D+LV++P  AD V  + R 
Sbjct: 25  PVIIPSAARGEGVIEVSGAGTERLKLGLNKTLVLDLPSDAYDILVANPAVADAVTRTARR 84

Query: 87  MYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVV 146
           +YLFGK VG+ N+ + G  G+Q+  +D+ +ERD+A LE  L+RFI +SNI VE+++D VV
Sbjct: 85  IYLFGKQVGETNIFVFGAGGEQIARIDVAVERDVAGLEQYLKRFIPNSNIDVELINDNVV 144

Query: 147 LHGMVRTIQDSQRAVELSETFLSQSGRNQY---------------------ANSSSKKVM 185
           L G V T  D+ RA +L+  F++                            +     K++
Sbjct: 145 LTGTVETPLDASRAAQLATIFVTGGEATTGQYSQTAAAPTDGGGVAISNPDSARQVSKIV 204

Query: 186 NLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDF 245
           N+L I GEDQVTLKVT+AEV R ++KQ+G     +GS  G S     D      +     
Sbjct: 205 NMLQIIGEDQVTLKVTVAEVSRSVMKQLGVNMIGSGSLDGISWGAIVDSPYGLGAPASAS 264

Query: 246 SVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHL----------- 294
            +   L     +  L+A+E+A  ++TL+EPTLTAISG+ A+F  GG+             
Sbjct: 265 QLA--LGGSLLQGYLNAMEQAGVMKTLSEPTLTAISGEKATFKVGGEFNLVTGQKVEQGD 322

Query: 295 YKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVN---------- 344
                +      V   DYG+ L FTPTVLSPGRI L+++T VSEP    +          
Sbjct: 323 ASKGQADQLTYEVEKIDYGIGLEFTPTVLSPGRISLKVRTSVSEPTFEGSFSLGSPSIGG 382

Query: 345 -----AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFR 399
                  +  S R R ADTTVELPSGG++++AGL++DD++Q   G+P LSKIPILG LFR
Sbjct: 383 RFNSPGMNALSIRKRLADTTVELPSGGSMMIAGLVRDDVRQTINGLPGLSKIPILGTLFR 442

Query: 400 NSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASE 459
           +  F R ETE+ I  TP+L +PVA   L+RPDD+++   D    F  RVN+IYG  + + 
Sbjct: 443 SRDFVRNETELVIIITPYLARPVARTALARPDDNFNPPSDGAGIFLGRVNRIYGAMKTNL 502

Query: 460 VEGQNYKGAIGFIYK 474
            +G+ Y G +G+IYK
Sbjct: 503 PKGR-YHGVVGYIYK 516


>gi|90419764|ref|ZP_01227673.1| Flp pilus assembly protein, secretin CpaC (type II and type III
           secretion system) [Aurantimonas manganoxydans SI85-9A1]
 gi|90335805|gb|EAS49553.1| Flp pilus assembly protein, secretin CpaC (type II and type III
           secretion system) [Aurantimonas manganoxydans SI85-9A1]
          Length = 540

 Score =  344 bits (883), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 190/535 (35%), Positives = 279/535 (52%), Gaps = 70/535 (13%)

Query: 1   MRYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIIL 60
           +R   R    +M+    +  P    LP   +A   V+N+        + I++GLNK  ++
Sbjct: 15  LRARLRKLVVVMAAASTALAPLATTLP--AQAEQTVVNVRQG----SQSINLGLNKTKVI 68

Query: 61  QVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDI 120
            +  D  D+LV++P  AD V    R +Y+FGK +GQ N+++     +Q+ ++D+ IERDI
Sbjct: 69  VLEADAHDILVANPAVADAVTRDARRIYIFGKQIGQTNIVVFDRQNRQIASIDLKIERDI 128

Query: 121 AHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQY---- 176
             LE T+R+++  S ++VEM++D VVL+G V+T QD+ +   L+  F++           
Sbjct: 129 NGLEATIRKYVPSSVVQVEMLNDNVVLNGTVQTPQDAAKVERLARLFVTGGEGTTGQYIQ 188

Query: 177 -------------------ANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQH 217
                               +    +++NLL I GEDQVTLKVT+AEV+R ++KQ+G   
Sbjct: 189 QATASGGAGGGDGDVGFAQEDRRQSQIVNLLQIQGEDQVTLKVTVAEVQRSVVKQLGINS 248

Query: 218 SITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTL 277
           +     +          G    S     +  G +  F     L+A+E+A  +RTLAEP+L
Sbjct: 249 TAGKGVTYGQTDSPFALGKALSS--SMLASAGSIGGFDITAQLNAMEQAGVMRTLAEPSL 306

Query: 278 TAISGQSASFTSGGQHLYKTVSSSTGATSV-----------------------------T 308
           TAISG+ ASF  GG+       S    T                               T
Sbjct: 307 TAISGEKASFKVGGEFTVPDAQSYDPGTPARREFQGYDGSGQAIYDTIPAEPPTRSIDKT 366

Query: 309 THDYGVVLHFTPTVLSPGRIGLRIQTEVSEPV---------IGVNAGDMPSYRVRKADTT 359
             +YG+ L FTP VLSPGRI L+I+T VSEP                     R R ADTT
Sbjct: 367 RVEYGIGLDFTPVVLSPGRISLKIRTAVSEPTFEMPFNISGGKDGGVGTVGIRKRLADTT 426

Query: 360 VELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLV 419
           VELPSGG++V+AGL++D+++Q+  G P LSKIP+LG LFR+  F R ETE+ I  TP+LV
Sbjct: 427 VELPSGGSLVIAGLVRDEVRQVMSGFPGLSKIPVLGTLFRSRDFQRYETELVIIVTPYLV 486

Query: 420 KPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
           +PV  + L+RPDD +++  D  A F  RVN++YG  E     G+ Y G +GFIYK
Sbjct: 487 RPVPRQALARPDDGFALSSDGAANFLGRVNRVYGHMETKLPPGR-YHGVVGFIYK 540


>gi|299132286|ref|ZP_07025481.1| type II and III secretion system protein [Afipia sp. 1NLS2]
 gi|298592423|gb|EFI52623.1| type II and III secretion system protein [Afipia sp. 1NLS2]
          Length = 490

 Score =  343 bits (879), Expect = 5e-92,   Method: Composition-based stats.
 Identities = 162/482 (33%), Positives = 259/482 (53%), Gaps = 23/482 (4%)

Query: 8   FFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGK--GKKISIGLNKVIILQVPVD 65
               +S    S+    + L P+   +  V + S         + + +G++K +++ +P D
Sbjct: 13  IARALSFVAVSALILNSSLSPVLATDYQVASASTASADSLNARSLRLGISKSLVVDLPRD 72

Query: 66  VQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEM 125
           V+DVLV+DP  A+ VV S R  Y+ G  VGQ N+I    DG+QM   D+ + RD+  +  
Sbjct: 73  VKDVLVADPKIANAVVRSSRRAYIIGAAVGQTNIIFFDADGQQMAAYDVAVTRDLNGIRT 132

Query: 126 TLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVM 185
            + + +  S+I+VE + D VVL G      ++Q+A EL+   +         + ++  V+
Sbjct: 133 AIHQALPQSDIQVEGLGDGVVLTGSAANQAEAQQAYELAARLIGGP------SKANDLVV 186

Query: 186 NLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVS---EG 242
           N + + G DQV LKVT+AEV+R+I+KQ+G   S   S       F        +      
Sbjct: 187 NNITVRGRDQVMLKVTVAEVQRNIVKQLGVDLSGKFSYGTAVVDFNNANQFSALGHALAP 246

Query: 243 GDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTV---- 298
            +          S +  L A+E A  +RTLAEP LTAISG+SA+F +GG+    T     
Sbjct: 247 DNAISTSFGSAPSVKATLRAMESAGVVRTLAEPNLTAISGESATFIAGGEFPIPTGITCQ 306

Query: 299 ----SSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVI----GVNAGDMPS 350
               +SS    S+    +G+ L+FTP VL+ GRI LR+ TEVSE        V+   +PS
Sbjct: 307 TAAGTSSNCQPSIAFKKFGISLNFTPVVLTEGRISLRVMTEVSEISNDNSLTVSGMTIPS 366

Query: 351 YRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEI 410
            + R+A+TT+E+PSGG++ +AGL+++  +Q   G+P L+++P+LG LFR+  F   +TE+
Sbjct: 367 IKTRRAETTLEIPSGGSMAMAGLIQEQTKQAINGLPGLAQLPVLGTLFRSRDFINNQTEL 426

Query: 411 FIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIG 470
            +  TP++V+ VA +DLSRPDD ++   D +      + +IYG          +Y+G  G
Sbjct: 427 MVLVTPYVVRAVAQKDLSRPDDGFASASDPQTVLLGNITRIYGVPRREGQASSSYRGKYG 486

Query: 471 FI 472
           FI
Sbjct: 487 FI 488


>gi|85713505|ref|ZP_01044495.1| type II and III secretion system protein [Nitrobacter sp. Nb-311A]
 gi|85699409|gb|EAQ37276.1| type II and III secretion system protein [Nitrobacter sp. Nb-311A]
          Length = 477

 Score =  342 bits (878), Expect = 6e-92,   Method: Composition-based stats.
 Identities = 163/486 (33%), Positives = 260/486 (53%), Gaps = 41/486 (8%)

Query: 17  FSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTK 76
             +      L P+  ++  V   +       + +S+G+ K +++ +P DV+DVLV+DP  
Sbjct: 1   MGAFTLNPALAPVFASDYRVSAATTGAKMHTQSLSLGIGKSVVVDLPRDVKDVLVADPKI 60

Query: 77  ADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNI 136
           A+ VV S +  Y+ G  VGQ N+I     G+Q+   DI + RD+  L   L++ + ++ I
Sbjct: 61  ANAVVRSAQRAYIIGAAVGQTNIIFFDSSGQQISAYDIAVTRDLNGLRAALKQLLPNAAI 120

Query: 137 RVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQV 196
           +V+ + D V+L G V +  ++Q+A +L+                 +KV+N + + G DQV
Sbjct: 121 KVDGLGDGVMLSGWVSSPIEAQQAGDLAARLADGV----------QKVVNNIAVRGRDQV 170

Query: 197 TLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAAD--FGGKFVSEGGDFSVKGVLDRF 254
            LKVT+AEV R I+KQ+G   S   +      +F+    F           ++ G     
Sbjct: 171 MLKVTVAEVARTIIKQMGIDLSANMNYGTAVVNFSNSNPFTALGRPLVSGNNLSGSAGLT 230

Query: 255 SF--------------ETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSS 300
           +               +  L A+E A  IRTLAEP LTAISG+SA+F SGG+       S
Sbjct: 231 NLLPGQAGYPGVVPSVQATLRAMESAGVIRTLAEPNLTAISGESATFISGGEFPIPAGYS 290

Query: 301 STGATSVT-----THDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGV---------NAG 346
              AT V         +G+ L+FTP VL+ GRI LR+ TEVSE              N+ 
Sbjct: 291 CDPATRVCLTQIRFKKFGISLNFTPVVLTEGRISLRVMTEVSELSTENAMTITQTIGNSL 350

Query: 347 DMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNRE 406
            +PS R R+A+TT+E+PSGG++ +AGL+++  +Q   G+P L+++P+LGALFR+  +   
Sbjct: 351 TVPSIRTRRAETTLEIPSGGSMAMAGLIQEQTKQAINGLPGLTQLPVLGALFRSRDYVNG 410

Query: 407 ETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYK 466
           +TE+ +  TP++V+ VA +DLSRPDD ++   D ++     +N+IYG     E   ++Y+
Sbjct: 411 QTELVVLVTPYVVRAVAQKDLSRPDDGFADASDPQSDLLGSINRIYGAPGRVEPA-RHYR 469

Query: 467 GAIGFI 472
           G  GFI
Sbjct: 470 GTYGFI 475


>gi|302037439|ref|YP_003797761.1| putative pilus assembly protein CpaC [Candidatus Nitrospira
           defluvii]
 gi|300605503|emb|CBK41836.1| putative Pilus assembly protein CpaC [Candidatus Nitrospira
           defluvii]
          Length = 485

 Score =  342 bits (878), Expect = 6e-92,   Method: Composition-based stats.
 Identities = 135/487 (27%), Positives = 220/487 (45%), Gaps = 41/487 (8%)

Query: 15  FLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDP 74
            L      +  L  +  A A  +   D++    + +S+   K ++L  P+      +++P
Sbjct: 11  TLRGIGSGLFALFLVTVAQAHEVASPDIQTRVPRSLSLITGKSLVLDSPIPFSRASIANP 70

Query: 75  TKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADS 134
             AD +V SP+ +Y+ GK  G  N+ L   +G      D+ +  D+  L+  L +   D 
Sbjct: 71  DIADTLVLSPKQLYVIGKAAGTTNLTLWDAEGSVYALYDLAVSPDLTRLKEHLHQLFPDE 130

Query: 135 N-IRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGE 193
           N ++V    D + L G V +      AV+++ET+            + +KV+NLL + G 
Sbjct: 131 NDLQVMAAHDRLTLTGTVSSATHVSEAVDVAETY------------ARQKVINLLRVGGL 178

Query: 194 DQVTLKVTIAEVRRDILKQIGFQHSITGSSSG-----------------PSKSFAADFGG 236
            QV L+V +AE+ R +L+++G   +                        PS +  A   G
Sbjct: 179 HQVMLEVRVAEMERTLLRRLGVNLAAASGGQSFGVSSLKNLATVLPPTDPSAALVAGPVG 238

Query: 237 KFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYK 296
             VS+  +  ++      S+   + AL+    ++ LAEPTL A+SGQ A F +GG+    
Sbjct: 239 LGVSQAVNALLRFQTGSTSWTGFIDALKEENLVKVLAEPTLVALSGQEAHFLAGGEFPIP 298

Query: 297 TVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVN----AGDMPSYR 352
            V  + G T++    +G+ L+F P VLSP RI + +  EVS+             +P+  
Sbjct: 299 -VPQAFGVTTIQFKKFGIQLNFNPVVLSPTRISVTVAPEVSDLDFANGLSLQGFVVPAIT 357

Query: 353 VRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFI 412
            R+A T VEL  G +  +AGLL+D +++     P+L  IPILGALFR+S F + ETE+ I
Sbjct: 358 TRRASTVVELEDGQSFAVAGLLRDTVRETVSKFPVLGDIPILGALFRSSSFQKNETELVI 417

Query: 413 AATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEG------QNYK 466
             TP LV PV   +L  P   Y   DD   +   R+                        
Sbjct: 418 IVTPHLVTPVTEAELPLPTGQYLEPDDVDFYLMGRLQSRKDKVRTPLPPATQLPFEDRLA 477

Query: 467 GAIGFIY 473
           G +G + 
Sbjct: 478 GPVGHMM 484


>gi|157375508|ref|YP_001474108.1| flp pilus assembly protein, secretin CpaC [Shewanella sediminis
           HAW-EB3]
 gi|157317882|gb|ABV36980.1| flp pilus assembly protein, secretin CpaC [Shewanella sediminis
           HAW-EB3]
          Length = 483

 Score =  342 bits (876), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 113/435 (25%), Positives = 200/435 (45%), Gaps = 20/435 (4%)

Query: 42  VEIGKGKKIS-IGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVI 100
              G  + I  I + K  +L++   +  V V +P   D+ +     +Y+ GK +G  N++
Sbjct: 31  GPTGASRDIKHIPIFKSRVLKLKQAIHRVSVGNPNIGDIKLLPNNELYVLGKKLGSTNIM 90

Query: 101 LIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRA 160
           +   + + +  +DI I  D+  L+  L  F+    + V+     +++ G    +Q    A
Sbjct: 91  VWDKNEQLVDVIDIEITHDLNGLKTRLHEFLPGEKLGVQTSQGQLLISGQASNLQKMNTA 150

Query: 161 VELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSIT 220
           VEL++ +   +      +     V+N++ + G+ QV L+V IAEV++++ +Q   +  I 
Sbjct: 151 VELAQAYADAASV----SKVKSTVLNMMTVGGDHQVMLEVVIAEVQKEVARQFDSKFFIF 206

Query: 221 GSSSGPSKSFAADFGGKFVSEGGDFSVKGVL-----DRFSFETVLHALERATAIRTLAEP 275
                     A   G   +        +G               L   ++    + LAEP
Sbjct: 207 NKGDKGFIGTAGAGGTFDLDPAAAIDSRGFFARYLDGNLMMNFALDVAKQHGLAKVLAEP 266

Query: 276 TLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTE 335
            +TA+SGQSA F SGG+     V  + G+T++   D+GV + F P+VL  G+I L +   
Sbjct: 267 NVTAMSGQSAEFLSGGEFPIP-VPGTNGSTTIQYRDFGVGVKFVPSVLDSGQINLNLNVM 325

Query: 336 VSEPVIGVNAG---------DMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIP 386
           VSE     +            +PS   R   TTVEL  G TI ++GL+ D +++  + +P
Sbjct: 326 VSEVSNANSVTLSGGSNTALVVPSIVKRTTATTVELADGQTIAISGLISDTLRENIDKLP 385

Query: 387 LLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFN 446
            L  IPILG LF +  F   ++E+ I  TP LV+P   + +S P D + +  D + +   
Sbjct: 386 GLGDIPILGQLFTSKSFQSGQSELVILVTPRLVRPFNKKQISLPTDDFVLPSDMEFYLLG 445

Query: 447 RVNKIYGPKEASEVE 461
           +++     +E  E  
Sbjct: 446 KMSHKQSEQEKHETP 460


>gi|89053488|ref|YP_508939.1| type II and III secretion system protein [Jannaschia sp. CCS1]
 gi|88863037|gb|ABD53914.1| type II and III secretion system protein [Jannaschia sp. CCS1]
          Length = 466

 Score =  341 bits (875), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 134/461 (29%), Positives = 224/461 (48%), Gaps = 29/461 (6%)

Query: 27  PPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRT 86
            PI  A A  + + + E      + + +N+ ++++  +   ++ V++P  AD+   S R+
Sbjct: 20  QPISGAQAQGLRVVEGE--STGTLRVPMNRAVVVEAEMLFAELSVANPAIADIATLSERS 77

Query: 87  MYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVV 146
           +Y+ G+  G+  + L+G DG  + N++I +  D+A L   LR  I    + V   +D +V
Sbjct: 78  IYVLGRAPGRTTMTLLGADGSLIANVEIQVVPDVAELRERLREIIPGEPVEVRTANDGIV 137

Query: 147 LHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVR 206
           L G V +     RA+EL+E +            +  ++ NL+ + G+ QV L+V  AE++
Sbjct: 138 LSGTVGSAFAVDRAMELAERY------------APGRISNLMMVGGQQQVMLQVRFAEMQ 185

Query: 207 RDILKQIGFQHSIT------------GSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRF 254
           R + +++     I             G+  G +     +  G      G   V       
Sbjct: 186 RTVRQELSASLGIGSTGGNFGTSVGAGNLQGGTGFGTGNLPGGLDGRNGGIGVSFAAGGL 245

Query: 255 SFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGV 314
               +L ALE    +RTLAEP LTA+SG +ASF +GGQ    T S S G T +   D+GV
Sbjct: 246 QLSVLLEALESNGMVRTLAEPNLTALSGATASFLAGGQFPVPTESESGGTT-IEFVDFGV 304

Query: 315 VLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLL 374
            L FTPTV+    I L +  E+S     +     P+   R A T VE+  G +  +AGLL
Sbjct: 305 QLDFTPTVVGDHVINLALDAEISSIGEIIATTGAPAINTRNASTVVEMRDGDSFAIAGLL 364

Query: 375 KDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHY 434
           +DD       +P L  +P+LGALFR++ ++R ++E+ I  T  LV PV    L+ P D  
Sbjct: 365 QDDFTNSVAEVPWLGDLPVLGALFRSASYSRSQSELVIIITAHLVSPVNGEALALPTDRV 424

Query: 435 SVEDDAKAFFFNRVNKIYGPKE--ASEVEGQNYKGAIGFIY 473
            +  +++ FF  +V          A +V  Q++ G+ G++ 
Sbjct: 425 RIPTESELFFQGQVTGSSPRPGTAAGDVAQQDFSGSYGYVL 465


>gi|118589703|ref|ZP_01547108.1| pilus assembly protein [Stappia aggregata IAM 12614]
 gi|118437789|gb|EAV44425.1| pilus assembly protein [Stappia aggregata IAM 12614]
          Length = 483

 Score =  341 bits (874), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 172/473 (36%), Positives = 273/473 (57%), Gaps = 18/473 (3%)

Query: 9   FTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQD 68
               ++ L       A +   +    + ++I+  E   G+ +++G+ + +++ +  D  D
Sbjct: 22  LAATAVLLGGLMGVSAPVAQAEGNFPSQVHIAAGERATGRILNVGVGRSVVINLAEDAAD 81

Query: 69  VLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLR 128
           VLVS+P  AD V+ +PR +++ G   GQ+ ++L    G+++ + D+ +E+D + +   +R
Sbjct: 82  VLVSNPEIADAVLRTPRRIFVIGNTAGQSRLVLFSRSGRELASFDVRVEKDTSDITRIIR 141

Query: 129 RFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLL 188
           + I  SNI  E ++ +VVL G  ++  ++Q+A +++  F           +S+ +V+NL+
Sbjct: 142 KLIPGSNIFAESINGSVVLSGTAKSTLEAQQAADIAAKF--------QGAASASEVVNLI 193

Query: 189 NIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVK 248
           ++AG+DQV LKVT+AEV R I+KQ+G Q   T      +   ++           + +V 
Sbjct: 194 SVAGKDQVHLKVTVAEVERSIIKQLGVQFQGTIGIGNFTPFMSSLPNFTVNPTIVNQAVG 253

Query: 249 GV---LDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGAT 305
           G        S    + AL+R   IRTLAEPTLTAISG++ASF +GG+          G  
Sbjct: 254 GTQLTAGATSITAQVEALQREGVIRTLAEPTLTAISGENASFLAGGEFPIPIS-QRDGEL 312

Query: 306 SVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPV----IGVNAGDMPSYRVRKADTTVE 361
           SV    +GV L FTP VLS GRI LR++TEVSE      +      + + +VR+A++T+E
Sbjct: 313 SVEFKKFGVGLDFTPVVLSEGRISLRVKTEVSELSNDGAVSAGGITISALKVRRAESTME 372

Query: 362 LPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKP 421
           LPSGGT+V+AGLL++  QQ  EG+P L +IPILGALF++  F RE+TE+ +  TP++V+P
Sbjct: 373 LPSGGTLVMAGLLQESYQQAIEGVPGLMQIPILGALFKSRDFLREQTELAVFVTPYVVQP 432

Query: 422 VAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
           VA+  L RPD +     DA   F NR+NKIY P  A+      Y G +GFIYK
Sbjct: 433 VAVSKLQRPDKNLMAPSDAGTIFLNRLNKIYNPTGAA--AEGTYHGQVGFIYK 483


>gi|316933039|ref|YP_004108021.1| type II and III secretion system protein [Rhodopseudomonas
           palustris DX-1]
 gi|315600753|gb|ADU43288.1| type II and III secretion system protein [Rhodopseudomonas
           palustris DX-1]
          Length = 478

 Score =  340 bits (873), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 148/480 (30%), Positives = 259/480 (53%), Gaps = 21/480 (4%)

Query: 3   YLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQV 62
              R+          ++  ++        A+      +       + +++G+ K +++ +
Sbjct: 8   RSTRSLRGTAIALSTAAVLTLIPAWTAAHASDYRAAPAASGGLNAQSVALGIGKSMVIDL 67

Query: 63  PVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAH 122
           P D++DVLV+DP  A+ V+ S +  Y+ G  VGQ N++     G+Q+   DI + RD+  
Sbjct: 68  PRDIKDVLVADPKIANAVIRSAQRAYIIGAAVGQTNIVFFDSTGRQIAAYDIAVTRDLNG 127

Query: 123 LEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSK 182
           +   L++ +  ++I+VE + + V+L+G V +  ++Q+A +L+   +             K
Sbjct: 128 IRTALKQTLPTADIQVEGLGEGVMLNGSVASPIEAQQAFDLAARLVGDD----------K 177

Query: 183 KVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEG 242
           KV+N + + G DQV LK+T+AEV+RDI+KQ+G   S   +      +F            
Sbjct: 178 KVVNNIAVRGRDQVMLKITVAEVQRDIVKQLGVDLSANMAYGTAVVNFNNTNPFTQSGSA 237

Query: 243 ---GDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVS 299
               +          S    L A+E A  +RTLAEP LTAISG+ A+F +GG+    +  
Sbjct: 238 LVPNNALTTKFGSLPSVTATLRAMESAGVVRTLAEPNLTAISGEPATFLAGGEFPVPSGV 297

Query: 300 SSTG---ATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIG----VNAGDMPSYR 352
           + T      SV    +G++L+FTP V++ GRI L++ TEVSE        +N+  +PS +
Sbjct: 298 TCTNGVCTPSVVFKKFGILLNFTPVVMTAGRISLKVMTEVSEVSSDNAVVINSLSVPSIK 357

Query: 353 VRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFI 412
            R+ ++T+E+PSGG++ +AGL+++  +Q   G+P  +++PILG LFR+  +   +TE+ +
Sbjct: 358 TRRVESTLEIPSGGSLAMAGLIQEQTKQAINGMPGAAQLPILGTLFRSRDYINRQTELMV 417

Query: 413 AATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFI 472
             TP++V+ VA +DLSRPDD ++   D ++     +NK+YG    SE   + Y+G  GFI
Sbjct: 418 LVTPYVVRAVAQKDLSRPDDGFADASDPQSDLLGSLNKLYGAPGRSEPA-RTYRGRFGFI 476


>gi|240139026|ref|YP_002963501.1| putative pilus assembly protein; putative precursor
           [Methylobacterium extorquens AM1]
 gi|240008998|gb|ACS40224.1| putative pilus assembly protein; putative precursor
           [Methylobacterium extorquens AM1]
          Length = 502

 Score =  340 bits (871), Expect = 4e-91,   Method: Composition-based stats.
 Identities = 154/494 (31%), Positives = 252/494 (51%), Gaps = 33/494 (6%)

Query: 9   FTMMSIFLFSSNPSVAKLPPIKEA----NAAVINISDVEIGKGKKISIGLNKVIILQVPV 64
             ++ I       ++   P   +A     + V+ I   E    +++ +   + +I+ +P 
Sbjct: 10  LALLLISGAGLASAMLSGPASAQAGLSGASPVLTIGANEAAVSRRVELSKGRSLIVDLPR 69

Query: 65  DVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLE 124
           D ++V V++P  A+ VV S R ++L G + G  ++ ++  +G+Q+  LD+ I RDI  L 
Sbjct: 70  DAKEVFVANPAVANAVVRSSRKLFLIGIDNGATSIFVMDGEGRQIAALDVTIARDINVLR 129

Query: 125 MTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKV 184
            +L++ +      V+ V D++VL G V +  ++Q+A++++  F+  +     A   +  V
Sbjct: 130 QSLQQSLPGGRFDVKAVGDSLVLSGSVNSTSEAQQALDIANAFVGIAAGGGVATRGA--V 187

Query: 185 MNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGP------SKSFAADFGGKF 238
           +N L I  +DQV ++VT+ EV R +LKQ G   S   S+  P      + +      G  
Sbjct: 188 INNLTIRNKDQVMIRVTVVEVARTVLKQFGISTSGNWSALNPLGGNFLTNNTGFPLTGSR 247

Query: 239 VSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYK-- 296
             +    +       FSF+  L A E+A   R LAEPTLTAISG+SA FT+GG+      
Sbjct: 248 SPDANALTASVQTGGFSFKATLRAFEQAGVSRILAEPTLTAISGESAKFTAGGEIPVPLS 307

Query: 297 ----------TVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVN-- 344
                     T  S     ++T   YGV L FTP V++  RI +RI T+V +     +  
Sbjct: 308 CSAASTVSIGTSVSQGCVVALTYKPYGVSLSFTPVVMAENRISVRIATDVVDLDPQNSFT 367

Query: 345 ------AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALF 398
                    +P    R ++TTVEL SG T++ AGL++   +    G+P L  +PILGALF
Sbjct: 368 YYLNDRPTPVPGTTKRSSETTVELASGATMMTAGLIQQKNRAAISGLPGLMNLPILGALF 427

Query: 399 RNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEAS 458
           R+  + R+ETE+ I  TP++ +P+  R + RPDD +    D +A    R+NKIYG     
Sbjct: 428 RSRDYQRDETELMIMVTPYIAQPMEARQVQRPDDGFVDAPDGQAVLLGRLNKIYGTVGGG 487

Query: 459 EVEGQNYKGAIGFI 472
            + G  Y+G +GFI
Sbjct: 488 TL-GPAYRGRVGFI 500


>gi|294140774|ref|YP_003556752.1| Flp pilus assembly protein CpaC [Shewanella violacea DSS12]
 gi|293327243|dbj|BAJ01974.1| Flp pilus assembly protein CpaC [Shewanella violacea DSS12]
          Length = 484

 Score =  339 bits (869), Expect = 6e-91,   Method: Composition-based stats.
 Identities = 121/436 (27%), Positives = 207/436 (47%), Gaps = 21/436 (4%)

Query: 42  VEIGKGKKISI-GLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVI 100
              G  + I +  + K  IL +   V  V V +P   D+ +     +Y+ GK +G  N++
Sbjct: 31  GPTGASRDIMLIPIFKSRILNLKQTVHRVSVGNPNIGDIKLLPNNELYVLGKKLGSTNIM 90

Query: 101 LIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRA 160
           +   + + +  +DI I  D+  L++ L  F+    + V+     +++ G    +Q    A
Sbjct: 91  IWDENERLVDVIDIEITHDLNGLKLRLHEFLPGEKLGVQTSQGHLLISGQASNLQKMNTA 150

Query: 161 VELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSIT 220
           VEL++ +   +  ++  ++    V+N++ + G+ QV L+V IAEV+R++ +Q   +  I 
Sbjct: 151 VELAKAYADAASVSKVNST----VLNMMTVGGDHQVMLEVVIAEVQREVARQFDSKFFIF 206

Query: 221 GSSSGPSKSFAADFGGKFVSEGGDFSVKGVL-----DRFSFETVLHALERATAIRTLAEP 275
           G  S  S   A       +      S +G       D       L   ++    + LAEP
Sbjct: 207 GQGSKLSGGTAGGGATFDLDPAAAISNRGFFARYINDNLLMNFALDVAKQNGLAKVLAEP 266

Query: 276 TLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTE 335
            +TA+SGQSA F SGG+     V  + G+T++   D+GV + F PTVL  G+I L +   
Sbjct: 267 NVTALSGQSAEFLSGGEFPIP-VPGTNGSTTIQYRDFGVGVRFVPTVLDSGQINLNLNVI 325

Query: 336 VSEPVIGVNAGD----------MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGI 385
           VSE     +             +PS   R   TTVEL  G TI ++GL+ D +++  + +
Sbjct: 326 VSEVSNANSVSLSGGGSNATLIVPSIVKRTTSTTVELADGQTIAISGLINDTLRENIDKL 385

Query: 386 PLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFF 445
           P L  IPILG LF +  F   ++E+ I  TP LV+P   + +S P D + +  D + +  
Sbjct: 386 PGLGDIPILGQLFTSKSFKSGQSELIILVTPRLVRPFNRKHISLPTDDFVLPSDMEFYLL 445

Query: 446 NRVNKIYGPKEASEVE 461
            +++      E SE  
Sbjct: 446 GKMSHKKQDSERSETP 461


>gi|254561621|ref|YP_003068716.1| pilus assembly protein [Methylobacterium extorquens DM4]
 gi|254268899|emb|CAX24860.1| putative pilus assembly protein; putative precursor
           [Methylobacterium extorquens DM4]
          Length = 502

 Score =  339 bits (868), Expect = 8e-91,   Method: Composition-based stats.
 Identities = 153/480 (31%), Positives = 246/480 (51%), Gaps = 29/480 (6%)

Query: 19  SNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKAD 78
             P  A         + V+ I   E    +++ +   + +I+ +P D ++V V++P  A+
Sbjct: 24  MLPGPASAQAGLSGASPVLTIGANEAAVSRRVELSKGRSLIVDLPRDAKEVFVANPAVAN 83

Query: 79  VVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRV 138
            VV S R ++L G + G  ++ ++  +G+Q+  LD+ I RDI  L  +L++ +      V
Sbjct: 84  AVVRSSRKLFLIGIDNGATSIFVMDGEGRQIAALDVTIARDINVLRQSLQQSLPGGRFDV 143

Query: 139 EMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTL 198
           + V D++VL G V +  ++Q+A++++  F+  +     A   +  V+N L I  +DQV +
Sbjct: 144 KAVGDSLVLSGSVNSTSEAQQALDIANAFVGIAAGGGVATRGA--VINNLTIRNKDQVMI 201

Query: 199 KVTIAEVRRDILKQIGFQHSITGSSSGP------SKSFAADFGGKFVSEGGDFSVKGVLD 252
           +VT+ EV R +LKQ G   S   S+  P      + +      G    +    +      
Sbjct: 202 RVTVVEVARTVLKQFGISTSGNWSALNPLGGNFLTNNTGFPLTGSRSPDANALTASVQTG 261

Query: 253 RFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYK------------TVSS 300
            FSF+  L A E+A   R LAEPTLTAISG+SA FT+GG+                T  S
Sbjct: 262 GFSFKATLRAFEQAGVSRILAEPTLTAISGESAKFTAGGEIPVPLSCSAASTVSIGTSVS 321

Query: 301 STGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVN--------AGDMPSYR 352
                ++T   YGV L FTP V++  RI +RI T+V +     +           +P   
Sbjct: 322 QGCVVALTYKPYGVSLSFTPVVMAENRISVRIATDVVDLDPQNSFTYYLNDRPTPVPGTT 381

Query: 353 VRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFI 412
            R ++TTVEL SG T++ AGL++   +    G+P L  +PILGALFR+  + R+ETE+ I
Sbjct: 382 KRSSETTVELASGATMMTAGLIQQKNRAAISGLPGLMNLPILGALFRSRDYQRDETELMI 441

Query: 413 AATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFI 472
             TP++ +P+  R + RPDD +    D +A    R+NKIYG      + G  Y+G +GFI
Sbjct: 442 MVTPYIAQPMEARQVQRPDDGFVDAPDGQAVLLGRLNKIYGTVGGGTL-GPAYRGRVGFI 500


>gi|304392384|ref|ZP_07374325.1| type II and III secretion system protein [Ahrensia sp. R2A130]
 gi|303295488|gb|EFL89847.1| type II and III secretion system protein [Ahrensia sp. R2A130]
          Length = 544

 Score =  338 bits (867), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 184/498 (36%), Positives = 271/498 (54%), Gaps = 30/498 (6%)

Query: 6   RTFFTMMSIFLFSSNPS-----------VAKLPPIKEANAAVINISDVEIGKGKKISIGL 54
           R F         S  P               +     A+   I I+       K + +GL
Sbjct: 48  RGFMAWSLATALSFAPVLHPIHEMGVAKAQTVAGELRADKNHIVITARNARVPKLVRLGL 107

Query: 55  NKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDI 114
           +K +++ +P    DVLV++P  AD V+ + + +YLFGK VGQ NV +  + G Q+  L+I
Sbjct: 108 DKSLVVDLPSVANDVLVANPGVADAVMRTSQRLYLFGKQVGQTNVFVFDNGGNQIAALEI 167

Query: 115 LIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRN 174
           LIERDI+ LE TL R I +S+I+ EM++D +VL G V T  DS +A  L++ F+    + 
Sbjct: 168 LIERDISGLEETLSRLIPNSDIQAEMINDNIVLTGRVSTPSDSTKAQSLAQIFVRGGEQT 227

Query: 175 QY--------ANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGP 226
                      ++ + +++NLL I GEDQV LKV+I E++R ++KQ+G   S+T ++ G 
Sbjct: 228 TNPAQQSSIFGDAPTSEIVNLLKIDGEDQVMLKVSIVEIQRSVVKQLGITTSLTNAAEGG 287

Query: 227 SKSFAADFGG--KFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQS 284
                   G        G   S   V  + + +  L  L+    IR LAEPTLTAISG++
Sbjct: 288 FGFSTIAGGSVRNIAGAGLRGSANIVSGQNTLDAQLRVLDHTGMIRMLAEPTLTAISGEA 347

Query: 285 ASFTSGGQHLYKTV---SSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEP-- 339
           A F +GG +          +  +       YGV L F PTVL+ GRI L+++TEV EP  
Sbjct: 348 AEFRAGGTYQAPQQIERDENGTSIEYEERQYGVSLQFIPTVLTEGRISLKLKTEVKEPSL 407

Query: 340 ---VIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGA 396
                  +   +   R R A TTVELPSGG++ +AGL++DD++Q   G P LSK+PI GA
Sbjct: 408 HGSTGRSSDAGLFGTRERVASTTVELPSGGSMAIAGLIQDDLRQNISGFPGLSKLPIFGA 467

Query: 397 LFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKE 456
           LFR+  F+R ETE+ I  TP+LV+PVA   L+ PD+ +    +    F  RVN++YG K+
Sbjct: 468 LFRSREFHRSETELVIIVTPYLVRPVARAKLANPDEGFQPASEPAGIFMGRVNRVYGTKQ 527

Query: 457 ASEVEGQNYKGAIGFIYK 474
            +  +G+ Y G+IGFI K
Sbjct: 528 GNLPKGR-YTGSIGFILK 544


>gi|260461949|ref|ZP_05810194.1| type II and III secretion system protein [Mesorhizobium
           opportunistum WSM2075]
 gi|259032196|gb|EEW33462.1| type II and III secretion system protein [Mesorhizobium
           opportunistum WSM2075]
          Length = 505

 Score =  338 bits (866), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 191/514 (37%), Positives = 294/514 (57%), Gaps = 49/514 (9%)

Query: 1   MRYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIIL 60
           MR   +     +    F        +  + EA +  +  +       +++ +GLNK +++
Sbjct: 1   MRLSGK--LPAIVAAAFGLLLVGTNVQGVVEAKSTQVTATT----ASQRVKLGLNKSVVI 54

Query: 61  QVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDI 120
            +P D  D+LV++P+ AD V  + R +YLFGK VG+ N+ + G +G+Q+ +LD+ +ERD+
Sbjct: 55  DLPSDAYDILVANPSVADAVTRTARRIYLFGKAVGETNIFVFGPNGEQIASLDLAVERDV 114

Query: 121 AHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYA--- 177
           A LE  +RRFI  S+I+VE+++D VVL G V T  DS+RAV+L+  F+S           
Sbjct: 115 AGLEDYIRRFIPTSDIKVELLNDNVVLTGTVDTPLDSKRAVDLATIFVSGGEATTGQYSQ 174

Query: 178 ------------------NSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSI 219
                                + K++NLL I G+DQVTLKVT+AEV R ++KQ+G     
Sbjct: 175 TAAGGSAQSGVDINNPDQERRTSKIVNLLQIIGDDQVTLKVTVAEVSRSVMKQLGVNMVG 234

Query: 220 TGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTA 279
           +G S+G S    +D          +      ++    +  ++A+E++  ++TLAEPTLTA
Sbjct: 235 SGGSNGISYGALSDPFTGLGKPLSNAGFS--INASGLQAYINAMEQSGVMKTLAEPTLTA 292

Query: 280 ISGQSASFTSGGQHLYKTVSSSTG---------ATSVTTHDYGVVLHFTPTVLSPGRIGL 330
           +SG+ A+F  GG++   T  S+             SV   +YG+ L F P VLSPGRI L
Sbjct: 293 VSGEKATFKVGGEYNMVTGVSANVSADNQTGLKTYSVDKIEYGIGLEFQPVVLSPGRISL 352

Query: 331 RIQTEVSEPVIGVN----------AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQ 380
           +++T VSEP    +            +  S R R ADTTVELPSGG++++AGL++DD++Q
Sbjct: 353 KVRTSVSEPTTEGSVSSSTSNTSVGMNALSLRKRLADTTVELPSGGSMMIAGLVRDDVRQ 412

Query: 381 LKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDA 440
              G+P L+KIP+LGALFR+  F R ETE+ I  TP+LVKPVA  DL++PDD+++   D 
Sbjct: 413 AVNGLPGLTKIPVLGALFRSRDFVRNETELVIIITPYLVKPVARNDLAKPDDNFNAASDG 472

Query: 441 KAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
            A F  +VN++YG  +  +  G+ Y G +G+IYK
Sbjct: 473 AAMFLGKVNRVYGTMQTDKPNGR-YHGVVGYIYK 505


>gi|90425197|ref|YP_533567.1| type II and III secretion system protein [Rhodopseudomonas
           palustris BisB18]
 gi|90107211|gb|ABD89248.1| type II and III secretion system protein [Rhodopseudomonas
           palustris BisB18]
          Length = 492

 Score =  338 bits (866), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 160/495 (32%), Positives = 263/495 (53%), Gaps = 35/495 (7%)

Query: 2   RYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQ 61
           R ++      +     ++      L P   A+   +  +       + +++G++K +++ 
Sbjct: 7   RPMRSPLARALWFSAAAALTINPALAPALAADYRPMAAAADGQLNARFLALGVSKSVVID 66

Query: 62  VPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIA 121
           +P D++DVLV+DP  A+ VV S +  Y+ G  +GQ N++     G Q+   DI + RD+ 
Sbjct: 67  LPRDIKDVLVADPKIANAVVRSAQRAYIIGAAIGQTNIVFFDAAGLQIAAYDIAVTRDLN 126

Query: 122 HLEMTLRRFIADSNIRVEMVS-DTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSS 180
            +   +++ +  ++IRVE V   +V+L G V +  ++Q+A +L+   +            
Sbjct: 127 GIRAAMKQTLPGADIRVEGVGVKSVMLTGSVSSPIEAQQAGDLAARLVDG---------- 176

Query: 181 SKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADF-----G 235
              V+N + + G DQV LKVT+AEV+RDI+KQ+G   +   +      +F         G
Sbjct: 177 PDNVVNSIAVRGRDQVMLKVTVAEVQRDIVKQLGVDLTARMNYGTAVVNFNNSNPFTAYG 236

Query: 236 GKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLY 295
              VS     +  G     S    L A+E A  +RTLAEP LTAISG+SA+F +GG+   
Sbjct: 237 SNLVSGNATTASFGGGTTPSVTATLRAMESAGVVRTLAEPNLTAISGESATFVAGGEFPV 296

Query: 296 KTVSSSTGATSVT-----THDYGVVLHFTPTVLSPGRIGLRIQTEVSEP----------- 339
               S    T V         +G+ L+FTP V+S GRI LR+ TEVSE            
Sbjct: 297 PAGYSCDPVTHVCTTQISFKKFGISLNFTPVVMSEGRISLRVMTEVSEISTDNSITLSQA 356

Query: 340 --VIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGAL 397
                 N+  +PS + R+A+TT+E+PSGG++ +AGL+++  +Q   G+P L+++P+LGAL
Sbjct: 357 VSTTTTNSITVPSIKTRRAETTLEIPSGGSMAMAGLIQEQTKQAMNGLPGLAQLPVLGAL 416

Query: 398 FRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEA 457
           FR+  +    TE+ +  TP++V+ VA +DLSRPDD ++   D +A     +N+IYG +  
Sbjct: 417 FRSRDYVNRNTELLVLVTPYVVRAVAQKDLSRPDDGFAAASDPQADLIGNINRIYGVRGR 476

Query: 458 SEVEGQNYKGAIGFI 472
           +E    NY+G  GFI
Sbjct: 477 TEPAK-NYRGTYGFI 490


>gi|328545279|ref|YP_004305388.1| Pilus assembly protein [polymorphum gilvum SL003B-26A1]
 gi|326415021|gb|ADZ72084.1| Pilus assembly protein [Polymorphum gilvum SL003B-26A1]
          Length = 470

 Score =  338 bits (866), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 168/479 (35%), Positives = 269/479 (56%), Gaps = 18/479 (3%)

Query: 4   LQRTFFTMMSIFLFSSNPSVAKLPPIKEANAA-VINISDVEIGKGKKISIGLNKVIILQV 62
             R F T +   L       A      +      ++++  E    + + +GL + +++ V
Sbjct: 2   SGRRFATGLLAALAVLVTVSAMPAARADDGFPKTVHVAAGERATARLLRVGLGRSVVVNV 61

Query: 63  PVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAH 122
             DV DVLVS+P  AD VV S   +++ G   GQAN++L G +G+++ + ++ +E D + 
Sbjct: 62  AEDVADVLVSNPEIADAVVRSKNRVFVLGNKAGQANLVLFGRNGRELASFNLRVEPDTSD 121

Query: 123 LEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSK 182
           L   L+R + +S+I  E ++  VVL G   +  D+Q A +L+  F         + + + 
Sbjct: 122 LSALLKRVLPNSDIHAESINGNVVLSGTAVSAADAQSAADLATRF-------GGSGAGAL 174

Query: 183 KVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSI---TGSSSGPSKSFAADFGGKFV 239
            V+N++++AG+DQ+ LKVT+AEV R ++KQ+G   S     G+  G   S +       +
Sbjct: 175 PVLNMISVAGKDQIQLKVTVAEVDRSVVKQLGVNLSGSIGIGNYRGTFNSASDFPVNPGI 234

Query: 240 SEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVS 299
           +      +  +    +    + AL+R   IRTLAEPTLTAISG++ASF +GG+     VS
Sbjct: 235 TSQATGGIGFLAGGTNVNAEIQALQRDGVIRTLAEPTLTAISGENASFLAGGEFPVP-VS 293

Query: 300 SSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPV----IGVNAGDMPSYRVRK 355
                  V    +GV L FTP VLS GRI +R++TEVSE      +      + + +VR+
Sbjct: 294 QDNDTIGVEFKKFGVGLDFTPVVLSGGRISMRVKTEVSELTNDGAVTTGGIVISALKVRR 353

Query: 356 ADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAAT 415
           A++TVELPSGGT+V+AGLLK+  +Q   GIP L ++P+LGALF++  F R++TE+ +  T
Sbjct: 354 AESTVELPSGGTLVMAGLLKETYKQAVNGIPGLMQLPVLGALFKSRDFLRQQTELVVFVT 413

Query: 416 PFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
           P++V PVA   L+RPD ++    DA+  F NR+NK++G   A       Y G +G+IY+
Sbjct: 414 PYVVTPVAANALTRPDQNFLPPSDAETVFLNRINKLFGVSGAKVP--GTYHGQVGYIYE 470


>gi|167624205|ref|YP_001674499.1| type II and III secretion system protein [Shewanella halifaxensis
           HAW-EB4]
 gi|167354227|gb|ABZ76840.1| type II and III secretion system protein [Shewanella halifaxensis
           HAW-EB4]
          Length = 478

 Score =  337 bits (865), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 115/425 (27%), Positives = 201/425 (47%), Gaps = 19/425 (4%)

Query: 51  SIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQML 110
            I + K  +L +   +  V V +P+ AD+ +     +Y+ GK +G  N+++   + +   
Sbjct: 36  RIPIFKSRVLMLNGPIHRVSVGNPSIADIKLLPNDELYILGKQLGSTNIMIWDKNEQLAR 95

Query: 111 NLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQ 170
            +DI +  D+  L+  L +F+    + V+     ++L G    +Q    AVEL++ +   
Sbjct: 96  IMDIEVTHDLNGLKTRLHQFLPTEKLGVQTSQGQLLLSGQASNLQKMNTAVELAQGYAEA 155

Query: 171 SGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSF 230
           +      + +  KV+N++ I G+ QV L+V +AEV+R++ +Q   +  I    S  S   
Sbjct: 156 A----AGDRAPSKVLNMMTIGGDHQVMLEVVVAEVQRNVARQFDSKFLIFNQGSNLSGGV 211

Query: 231 AA-----DFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSA 285
                  D G     +G     + +         L   ++    + LAEP +TA+SGQSA
Sbjct: 212 IGGGGGFDPGSIGGVDGKGLFAQYINGDLMMNFALDVAKQNGLAKVLAEPNVTAMSGQSA 271

Query: 286 SFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVI---- 341
            F SGG+     V    G T++   DYGV + F PTVL  G+I L +   VSE       
Sbjct: 272 EFLSGGEFPIP-VPGENGNTTIEYRDYGVGVKFVPTVLDSGQINLNLNVVVSEISTANGF 330

Query: 342 -----GVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGA 396
                   +  +PS   R   TTVEL  G TI ++GL+ D +++  + +P L  +P+LG 
Sbjct: 331 SISGNTSTSLVVPSLVKRSTATTVELADGQTIAISGLISDTLRENIDKLPGLGDVPVLGQ 390

Query: 397 LFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKE 456
           LF +  F   ++E+ I  TP LV+    +D+S P D + +  D + +   +++      +
Sbjct: 391 LFTSKSFQSGQSELVILVTPRLVRAFNRKDISLPTDGFVLPSDVEFYLLGKLSHKENTDD 450

Query: 457 ASEVE 461
            S+  
Sbjct: 451 TSDTP 455


>gi|163851903|ref|YP_001639946.1| type II and III secretion system protein [Methylobacterium
           extorquens PA1]
 gi|163663508|gb|ABY30875.1| type II and III secretion system protein [Methylobacterium
           extorquens PA1]
          Length = 502

 Score =  337 bits (863), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 152/480 (31%), Positives = 245/480 (51%), Gaps = 29/480 (6%)

Query: 19  SNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKAD 78
                A         + V+ I   E    +++ +   + +I+ +P D ++V V++P  A+
Sbjct: 24  MLSGPASAQAGLSGASPVLTIGANEAAVSRRVELSKGRSLIVDLPRDAKEVFVANPAVAN 83

Query: 79  VVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRV 138
            VV S R ++L G + G  ++ ++  +G+Q+  LD+ I RDI  L  +L++ +      V
Sbjct: 84  AVVRSSRKLFLIGIDNGATSIFVMDGEGRQIAALDVTIARDINVLRQSLQQSLPGGRFDV 143

Query: 139 EMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTL 198
           + V D++VL G V +  ++Q+A++++  F+  +     A   +  V+N L I  +DQV +
Sbjct: 144 KAVGDSLVLSGSVNSTSEAQQALDIANAFVGIAAGGGVATRGA--VINNLTIRNKDQVMI 201

Query: 199 KVTIAEVRRDILKQIGFQHSITGSSSGP------SKSFAADFGGKFVSEGGDFSVKGVLD 252
           +VT+ EV R +LKQ G   S   S+  P      + +      G    +    +      
Sbjct: 202 RVTVVEVARTVLKQFGISTSGNWSALNPLGGNFLTNNTGFPLTGSRSPDANALTASVQTG 261

Query: 253 RFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYK------------TVSS 300
            FSF+  L A E+A   R LAEPTLTAISG+SA FT+GG+                T  S
Sbjct: 262 GFSFKATLRAFEQAGVSRILAEPTLTAISGESAKFTAGGEIPVPLSCSAASTVSIGTSVS 321

Query: 301 STGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVN--------AGDMPSYR 352
                ++T   YGV L FTP V++  RI +RI T+V +     +           +P   
Sbjct: 322 QGCVVALTYKPYGVSLSFTPVVMAENRISVRIATDVVDLDPQNSFTYYLNDRPTPVPGTT 381

Query: 353 VRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFI 412
            R ++TTVEL SG T++ AGL++   +    G+P L  +PILGALFR+  + R+ETE+ I
Sbjct: 382 KRSSETTVELASGATMMTAGLIQQKNRAAISGLPGLMNLPILGALFRSRDYQRDETELMI 441

Query: 413 AATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFI 472
             TP++ +P+  R + RPDD +    D +A    R+NKIYG      + G  Y+G +GFI
Sbjct: 442 MVTPYIAQPMEARQVQRPDDGFVDAPDGQAVLLGRLNKIYGTVGGGTL-GPAYRGRVGFI 500


>gi|146342078|ref|YP_001207126.1| putative pilus assembly protein CpaC [Bradyrhizobium sp. ORS278]
 gi|146194884|emb|CAL78909.1| putative Pilus assembly protein cpaC [Bradyrhizobium sp. ORS278]
          Length = 492

 Score =  337 bits (863), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 160/493 (32%), Positives = 263/493 (53%), Gaps = 35/493 (7%)

Query: 3   YLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQV 62
            +       +++    +      L P+K A         V   K   +S+G+ K +++  
Sbjct: 12  KMGTALMRALAMSAAIALVLNPALAPVKAAEDRDAPTVSVGSSKVHYLSLGIGKSVVVDF 71

Query: 63  PVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAH 122
           P DV+DVLV+DP  A+ VV S +  Y+ G  +GQ NV+    +G+Q+   DI I+RD+  
Sbjct: 72  PQDVKDVLVADPKIANAVVRSAKRAYIIGAAIGQTNVVFFDGEGQQVAAYDIAIKRDLNG 131

Query: 123 LEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSK 182
           +   L + I    ++++ V D V+L G V +  ++Q+A E++   +            + 
Sbjct: 132 VRQALSQSIPG--VKIDGVGDGVILTGSVSSPVEAQQAGEIAARLVGG----------AD 179

Query: 183 KVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFG----GKF 238
           KV+N + + G DQV LKV ++EVRR+I+KQ+G   S + +      +F         GK 
Sbjct: 180 KVVNSIVVRGRDQVMLKVNVSEVRREIVKQLGIDLSASMTYGTAVVNFNQTNPFTAYGKS 239

Query: 239 VSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTV 298
           ++ G   S  G  +  S    + A+E A  ++TLAEP LTAISG+SA+F +GG+      
Sbjct: 240 LAAGNGLSAIGGGNLSSVSATMRAMETAGVVKTLAEPNLTAISGESATFIAGGEFPVPGG 299

Query: 299 SSSTGA-----TSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPV------------- 340
            S         TSV    +G+ L+FTP VLS GRI LR+ TEVSE               
Sbjct: 300 YSCDPKTGLCSTSVMFKKFGISLNFTPVVLSEGRISLRVMTEVSELSNDNAITLSYATSA 359

Query: 341 IGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRN 400
              ++  +P+ R R+A+TT+E+PSGG++ +AGL+++  +Q   G+P L+++P+LG LFR+
Sbjct: 360 NSASSVTIPAIRTRRAETTLEIPSGGSMAMAGLIQNQTKQAINGLPGLNQLPVLGQLFRS 419

Query: 401 SRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEV 460
             +   ETE+ +  TP++V+ VA ++LSRPDD ++   D+++    R+N++YG     + 
Sbjct: 420 QDYVNNETELMVLVTPYVVRAVAQKELSRPDDGFAPATDSESALLGRMNRLYGVAAKVDA 479

Query: 461 EGQNYKGAIGFIY 473
                 G  GFI 
Sbjct: 480 VTGQPAG-FGFII 491


>gi|157961834|ref|YP_001501868.1| type II and III secretion system protein [Shewanella pealeana ATCC
           700345]
 gi|157846834|gb|ABV87333.1| type II and III secretion system protein [Shewanella pealeana ATCC
           700345]
          Length = 478

 Score =  336 bits (862), Expect = 4e-90,   Method: Composition-based stats.
 Identities = 124/472 (26%), Positives = 210/472 (44%), Gaps = 33/472 (6%)

Query: 4   LQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVP 63
             R    +  + L   + + A  P     N   +              I + K  +L + 
Sbjct: 3   FLRHCSIVCLLALLQLSTAYAGGPTAGARNDVQL--------------IPIFKSRVLMLK 48

Query: 64  VDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHL 123
             V  V V +P+ AD+ +     +Y+ GK +G  NV++   + +    +DI +  D+  L
Sbjct: 49  GPVHRVSVGNPSIADIKLLPNDELYILGKQLGSTNVMIWDKNEQLARIMDIEVTHDLNGL 108

Query: 124 EMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKK 183
           +  L +F+    + V+     ++L G    +Q    AVEL++ +   +        +  K
Sbjct: 109 KTRLYQFLPTEKLGVQTSQGQLLLSGQASNLQKMNTAVELAQGYAEAA----AGGQAPSK 164

Query: 184 VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGG 243
           V+N++ I G+ QV L+V +AEV+R++ +Q   +  I    S  S       GG      G
Sbjct: 165 VLNMMTIGGDHQVMLEVVVAEVQRNVARQFDSKFFIFNQGSNLSGGLVGGGGGFDPGSIG 224

Query: 244 DFSVKGVL-----DRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTV 298
               KG+              L   ++    + LAEP +TA+SGQSA F SGG+     V
Sbjct: 225 GIDAKGLFAQYINGDLMMNFALDIAKQNGLAKVLAEPNVTAMSGQSAEFLSGGEFPIP-V 283

Query: 299 SSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVI---------GVNAGDMP 349
               G T++   DYGV + F PTVL  G+I L +   VSE                  +P
Sbjct: 284 PGENGNTTIEYRDYGVGVKFVPTVLDSGQINLNLNVVVSEISTANGFAISGNTSTTLVVP 343

Query: 350 SYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETE 409
           S   R   TTVEL  G TI ++GL+ D +++  + +P L  +P+LG LF +  F   ++E
Sbjct: 344 SLVKRSTATTVELADGQTIAISGLISDTLRENIDKLPGLGDVPVLGQLFTSKSFQSGQSE 403

Query: 410 IFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVE 461
           + I  TP LV+    +D+S P D + +  D + +   +++      ++S+  
Sbjct: 404 LVILVTPRLVRAFNRKDISLPTDGFVLPSDVEFYLLGKLSHKENSDDSSDTP 455


>gi|241518288|ref|YP_002978916.1| type II and III secretion system protein [Rhizobium leguminosarum
           bv. trifolii WSM1325]
 gi|240862701|gb|ACS60365.1| type II and III secretion system protein [Rhizobium leguminosarum
           bv. trifolii WSM1325]
          Length = 512

 Score =  336 bits (861), Expect = 5e-90,   Method: Composition-based stats.
 Identities = 203/462 (43%), Positives = 287/462 (62%), Gaps = 23/462 (4%)

Query: 33  NAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGK 92
              VI++++  +   + +SIGLNK +I+++P D  D++VSDP  +D +V + RT++LFGK
Sbjct: 54  AENVISVTETGVNVTRHVSIGLNKTLIVELPQDAHDIVVSDPGVSDAIVRATRTIFLFGK 113

Query: 93  NVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVR 152
            VGQ N+ ++  + + ++N+DI +ERDIA LE  LRR I D+ I+VE++SD +VL G VR
Sbjct: 114 KVGQTNIFILDANKRPIVNIDIAVERDIAGLETDLRRLIPDAAIKVEIISDNIVLTGTVR 173

Query: 153 TIQDSQRAVELSETFLSQSGRNQ-----------------YANSSSKKVMNLLNIAGEDQ 195
           + QDS +A +L+  F+                          +    K++NLL IA +DQ
Sbjct: 174 SAQDSAQAADLASAFVKGGEATTRTQSASSGGSQGSVALVAEDRQESKIINLLRIAADDQ 233

Query: 196 VTLKVTIAEVRRDILKQIGFQH---SITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLD 252
           V LK+TIAEV+R+ILKQ+GF +   +  GS+     + + D        G      G   
Sbjct: 234 VMLKMTIAEVKREILKQLGFDNELKNAGGSTIAQLGTASTDATTATSGGGLSALFSGSFG 293

Query: 253 RFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDY 312
           +    T L+ALE+A  +RTLAEPTLTA+SGQSASF +GG+ LY       G T+ T + Y
Sbjct: 294 KHGLSTTLNALEQAKVVRTLAEPTLTAVSGQSASFQAGGEVLYSNT-DRDGNTTQTPYSY 352

Query: 313 GVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAG 372
           G+ L F P VL+ GRI L+I TEVSEPV  ++    P+Y  R   TTVELPSGG+I LAG
Sbjct: 353 GISLSFKPIVLTSGRISLQISTEVSEPVTSISGSS-PTYGKRSTSTTVELPSGGSIALAG 411

Query: 373 LLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDD 432
           L++D+  +   G P+L+KIP  GALFR + F R ETE+ I ATP+LV+PVA +DL+RPDD
Sbjct: 412 LIRDNFNRTSNGTPVLNKIPGFGALFRQTSFERNETELVIIATPYLVRPVAAKDLNRPDD 471

Query: 433 HYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
           + S  DDA     +R+NK+YG  +  E   Q Y G +GFIYK
Sbjct: 472 NLSPADDASQGLLDRINKLYGNGKTLEPTAQ-YHGTVGFIYK 512


>gi|188581660|ref|YP_001925105.1| type II and III secretion system protein [Methylobacterium populi
           BJ001]
 gi|179345158|gb|ACB80570.1| type II and III secretion system protein [Methylobacterium populi
           BJ001]
          Length = 502

 Score =  336 bits (861), Expect = 5e-90,   Method: Composition-based stats.
 Identities = 154/482 (31%), Positives = 245/482 (50%), Gaps = 29/482 (6%)

Query: 17  FSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTK 76
            S+    A   P     + V+ I   E    +K+ +   + +I+ +P D ++V V++P  
Sbjct: 22  VSTLSGPASAQPGLPGASPVLTIGPNETAVSRKVELSKGRSLIIDLPRDAKEVFVANPAV 81

Query: 77  ADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNI 136
           A+ VV S R ++L G + G  ++ ++  +G+Q+  LD+ I RDI  L  +L++ +     
Sbjct: 82  ANAVVRSSRKLFLIGIDNGATSIFVMDAEGRQIAALDVTIARDINVLRQSLQQSLPSGRF 141

Query: 137 RVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQV 196
            V+ V D++VL G V +  ++Q+A++++  F+  +     A   +  V+N L I  +DQV
Sbjct: 142 DVKAVGDSLVLSGSVNSASEAQQALDIANAFVGIAAGGGVATRGT--VINNLTIRNKDQV 199

Query: 197 TLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFV------SEGGDFSVKGV 250
            ++VT+ EV R +LKQ G   S   ++  P           F        +    +    
Sbjct: 200 MIRVTVVEVARTVLKQFGISTSGNWAALNPLGGNVFTNNTGFPLTGSRSPDANAITASVQ 259

Query: 251 LDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYK------------TV 298
              FSF   L A E+A   R LAEPTLTAISG+SA FT+GG+                T 
Sbjct: 260 TGGFSFRATLRAFEQAGVSRILAEPTLTAISGESAKFTAGGEIPVPLSCAAASTVSIGTS 319

Query: 299 SSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVN--------AGDMPS 350
            S     ++T   YGV L FTP V++  RI +RI T+V +     +           +P 
Sbjct: 320 ISQGCVVALTYKPYGVSLSFTPVVMAENRISVRIATDVVDLDPQNSFTYYLNDRPTPVPG 379

Query: 351 YRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEI 410
              R ++TTVEL SG T++ AGL++   +    G+P L  +PILGALFR+  + R+ETE+
Sbjct: 380 TTRRSSETTVELASGATMMTAGLIQQKNRGAISGLPGLMNLPILGALFRSRDYQRDETEL 439

Query: 411 FIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIG 470
            I  TP++ +P+  R + +PDD Y    D +A    R+NKIYG      + G  Y+G +G
Sbjct: 440 MIMVTPYIAQPMEARQVQKPDDGYVDAPDGQAVLLGRLNKIYGTVGGGTL-GPAYRGRVG 498

Query: 471 FI 472
           FI
Sbjct: 499 FI 500


>gi|319785608|ref|YP_004145084.1| type II and III secretion system protein [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317171496|gb|ADV15034.1| type II and III secretion system protein [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 506

 Score =  335 bits (860), Expect = 8e-90,   Method: Composition-based stats.
 Identities = 181/503 (35%), Positives = 289/503 (57%), Gaps = 43/503 (8%)

Query: 12  MSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLV 71
           +   + ++   +     ++ +     N         +++ +GLNK +++ +P D  D+LV
Sbjct: 7   LPAIVAAAFGLLLVGTNVQGSVVEAKNAQVTASTATQRVKLGLNKSVVIDLPSDAYDILV 66

Query: 72  SDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFI 131
           ++P  AD V  + R +YLFGK VG+ N+ + G +G+Q+++LD+ +ERD+A LE  +RRF+
Sbjct: 67  ANPAVADAVTRTARRIYLFGKAVGETNIFVFGPNGEQIVSLDLAVERDVAGLEDYIRRFL 126

Query: 132 ADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQY--------------- 176
             S ++VE+++D VVL G V T  D++RA +L+  F+S                      
Sbjct: 127 PTSAVKVELLNDNVVLTGTVDTPLDAKRAEQLANMFVSGGEATTGQYSQTAAGGSAQSGV 186

Query: 177 ------ANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSF 230
                     + +++NL+ I G+DQVTLKVT+AEV R ++KQ+G     +G S+G S   
Sbjct: 187 DINNPDQERRTSQIVNLIQIIGDDQVTLKVTVAEVSRSVMKQLGVNMVGSGGSNGISYGA 246

Query: 231 AADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSG 290
            +D       +  +   +  +     +  ++A+E++  ++TLAEPTLTA+SG+ A+F  G
Sbjct: 247 ISDNFTGLGKQLSNSGFQ--IGASGLQAYVNAMEQSGVMKTLAEPTLTAVSGEKATFKVG 304

Query: 291 GQHLYKTVSSSTGATS---------VTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVI 341
           G++   T  S+  +           V   +YG+ L F P VLSPGRI L+++T VSEP  
Sbjct: 305 GEYNMVTGVSANVSQDNQTGLKTYSVEKIEYGIGLEFQPVVLSPGRISLKVRTSVSEPTT 364

Query: 342 GVN----------AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKI 391
             +            +  S R R ADTTVELPSGG++++AGL++DD++Q   G+P L+KI
Sbjct: 365 EGSVSFSSGVTSPGMNALSLRKRLADTTVELPSGGSMMIAGLVRDDVRQAVNGLPGLTKI 424

Query: 392 PILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKI 451
           P+LGALFR+  F R ETE+ I  TP+LVKPVA  DL++PDD+++   D    F  RVN++
Sbjct: 425 PVLGALFRSRDFVRNETELVIIITPYLVKPVARNDLAKPDDNFNAASDGAGMFLGRVNRV 484

Query: 452 YGPKEASEVEGQNYKGAIGFIYK 474
           YG  +  +  G+ Y G +GFIYK
Sbjct: 485 YGTMQTDKPNGR-YHGVVGFIYK 506


>gi|115525749|ref|YP_782660.1| type II and III secretion system protein [Rhodopseudomonas
           palustris BisA53]
 gi|115519696|gb|ABJ07680.1| type II and III secretion system protein [Rhodopseudomonas
           palustris BisA53]
          Length = 486

 Score =  335 bits (859), Expect = 9e-90,   Method: Composition-based stats.
 Identities = 152/489 (31%), Positives = 261/489 (53%), Gaps = 33/489 (6%)

Query: 2   RYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQ 61
           R          ++   S  P+   +     A      +++        +++G++K +++ 
Sbjct: 11  RRFAVRSLAWTAVAALSLQPAALPVI----AADYRPAVANEGQMNAHFLALGISKSVVID 66

Query: 62  VPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIA 121
           +P D++DVLV+DP  A  V+ S +  Y+ G +VGQ N++     G+Q+   DI + RD+ 
Sbjct: 67  LPRDIKDVLVADPKIATAVIRSAQRAYIIGASVGQTNIVFFDAAGQQIAAYDIAVTRDLN 126

Query: 122 HLEMTLRRFIADSNIRVEMVS-DTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSS 180
            +   L++ + +++IRVE V    V+L G V +  ++Q+A E++                
Sbjct: 127 GIRAALKQTLPNTDIRVEGVGPKGVLLSGSVSSPVEAQQAGEVAARLAEG---------- 176

Query: 181 SKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVS 240
           ++ V+N + + G DQV LKVT+AEV+RDI+KQ+G   S + +      +F          
Sbjct: 177 AENVVNSIAVRGRDQVMLKVTVAEVQRDIIKQMGIDLSASMTYGTAVVNFNNTNPFTAFG 236

Query: 241 ---EGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKT 297
                G+          +    L A+E A  +RTLAEP LTAISG+SA+F +GG+    +
Sbjct: 237 RQLVTGNSLATSFGGGPTVTATLRAMESAGVVRTLAEPNLTAISGESATFIAGGEFPVPS 296

Query: 298 VSSST-----GATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVN-------- 344
             +       G T +    +G+ L+FTP V++ GRI LR+ TEVSE     +        
Sbjct: 297 GYNYDPVTHVGTTQIAFKKFGISLNFTPVVMTEGRISLRVMTEVSELSNDNSITLTQSNG 356

Query: 345 -AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRF 403
               +PS + R+A+TT+E+PSGG++ +AGL+++  +Q   G+P +++IP+LG+LFR+  +
Sbjct: 357 DGLTVPSIKTRRAETTLEIPSGGSMAMAGLIQEQTKQAINGLPGMAQIPVLGSLFRSRDY 416

Query: 404 NREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQ 463
              +TE+ +  TP++V+ VA +DLSRPDD ++   D +      +N+IYG       + +
Sbjct: 417 VNRQTELMVLVTPYVVRAVAQKDLSRPDDGFAAVSDPQGDLLGSINRIYGVPGKPGPD-R 475

Query: 464 NYKGAIGFI 472
           NY+G  GFI
Sbjct: 476 NYRGTYGFI 484


>gi|212635453|ref|YP_002311978.1| Flp pilus assembly protein [Shewanella piezotolerans WP3]
 gi|212556937|gb|ACJ29391.1| Flp pilus assembly protein [Shewanella piezotolerans WP3]
          Length = 479

 Score =  335 bits (859), Expect = 9e-90,   Method: Composition-based stats.
 Identities = 116/413 (28%), Positives = 195/413 (47%), Gaps = 20/413 (4%)

Query: 52  IGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLN 111
           I + K  +L +   V  V V +P+ AD+ +     +Y+ GK +G  N+++   D +    
Sbjct: 37  IPIFKSRVLMLEGPVHRVSVGNPSIADIKLLPNDELYILGKQLGSTNIMIWDKDEQLSKI 96

Query: 112 LDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQS 171
           +DI +  D+  L+  L  F+    + V+     ++L G    +Q    AVEL++ +   +
Sbjct: 97  MDIEVTHDLNGLKTRLHEFLPTEKLGVQTSQGQLLLSGQASNLQKMNTAVELAQGYAEAA 156

Query: 172 GRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSS------G 225
                  ++  +V+N++ I G+ QV L+V +AEV+R++ +Q   +  I            
Sbjct: 157 ----AGGTAPSRVLNMMTIGGDHQVMLEVVVAEVQRNVARQFDSKFFIFNQGDHLAGGVI 212

Query: 226 PSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSA 285
                    GG    +G     + V         L   ++    + LAEP +TA+SGQSA
Sbjct: 213 GGGGGGFAPGGIGGVDGKGLFAQYVNGDLLMNFALDVAKQNGLAKVLAEPNVTAMSGQSA 272

Query: 286 SFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVI---- 341
            F SGG+     V    G T+V   DYGV + F PTVL  G+I L +   VSE       
Sbjct: 273 EFLSGGEFPIP-VPGENGNTTVEYRDYGVGVKFVPTVLDSGQINLNLNVVVSEISTANGF 331

Query: 342 -----GVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGA 396
                   +  +PS   R   TTVEL  G TI ++GL+ D +++  + +P L  +P+LG 
Sbjct: 332 TISGNTSTSLVVPSLTKRSTATTVELADGQTIAISGLISDTLRENIDKLPGLGDVPVLGQ 391

Query: 397 LFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVN 449
           LF +  F   ++E+ I  TP LV+P    D+S P D + +  D + +   +++
Sbjct: 392 LFTSKSFQNGQSELVILVTPRLVRPFNRNDISLPTDGFVLPSDVEFYLLGKLS 444


>gi|307943145|ref|ZP_07658490.1| type II and III secretion system protein [Roseibium sp. TrichSKD4]
 gi|307773941|gb|EFO33157.1| type II and III secretion system protein [Roseibium sp. TrichSKD4]
          Length = 482

 Score =  335 bits (859), Expect = 9e-90,   Method: Composition-based stats.
 Identities = 157/471 (33%), Positives = 261/471 (55%), Gaps = 18/471 (3%)

Query: 12  MSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLV 71
             I L  S   V +    + A    ++++  E    + +S+G+ + +I+     V DVLV
Sbjct: 22  AGIALVLSLAGVPEPAAAQGAFEKRVHVASGERVSSRLLSVGVGRSVIIDTAEAVADVLV 81

Query: 72  SDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFI 131
           S+P  AD VV +P  +++ G   GQAN++L    G+++ + ++ +E D + L   +++++
Sbjct: 82  SNPGVADAVVRTPNRIFVLGNKAGQANLVLFSRTGRELASFNLRVEPDTSDLVRFIQKYV 141

Query: 132 ADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIA 191
             SNI  + ++  ++L G      D+QRA +L+  +     +          ++N++ + 
Sbjct: 142 PGSNIEAQSLNGNIILSGTAANAADAQRAADLAARYAGDGKKATD-------ILNMITVD 194

Query: 192 GEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAA----DFGGKFVSEGGDFSV 247
           GEDQV LKVT+AEV R+++KQ+G Q +           FA     + G     +    + 
Sbjct: 195 GEDQVHLKVTVAEVDREVIKQLGVQLNGEIKIGNFGFGFANDTSFNAGTSVAQQTTRLAG 254

Query: 248 KGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSV 307
           + V    +    + AL+R   ++TLAEPTLTAISG++ASF +GG+            T V
Sbjct: 255 ELVSGGTTIGAEVKALQREGIVKTLAEPTLTAISGENASFLAGGEFPIPISQDGNEVT-V 313

Query: 308 TTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPV----IGVNAGDMPSYRVRKADTTVELP 363
               +GV L FTP VLS GRI L+I TEVSE      + +    +P+ +VR+A++T+ELP
Sbjct: 314 EFKKFGVGLDFTPIVLSGGRISLKITTEVSELSSDGAVNIGTLTIPALKVRRAESTLELP 373

Query: 364 SGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVA 423
           SGGT+V+AGLL++  +Q   G+P L  +P+LG+LF++  F R +TE+ +  TP++V P+A
Sbjct: 374 SGGTLVMAGLLQESYRQSVNGVPGLMNLPVLGSLFKSRDFLRSQTELVVFVTPYIVNPIA 433

Query: 424 MRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
              + RPD + +  +D++  F NR+NKIY     +      Y G +GFIYK
Sbjct: 434 ASKVQRPDKNLAPANDSETLFLNRLNKIYRANGQNAQAP--YHGQVGFIYK 482


>gi|218516388|ref|ZP_03513228.1| pilus assembly secretion protein [Rhizobium etli 8C-3]
          Length = 436

 Score =  334 bits (856), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 215/441 (48%), Positives = 288/441 (65%), Gaps = 25/441 (5%)

Query: 54  LNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLD 113
           +NK +++ +P D  D+LVSDP+ AD V  + R +YLFGK VGQ N+ + G  G++++NLD
Sbjct: 1   MNKAVVVDLPEDAHDILVSDPSMADAVTRTSRRIYLFGKKVGQTNIFVFGAGGQEIINLD 60

Query: 114 ILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGR 173
           I IERD++ LE  LRRFI DSNI VE+VSD +VL G VRT QD+ +A +L++ FL     
Sbjct: 61  IEIERDVSGLEANLRRFIPDSNINVEIVSDNIVLTGTVRTPQDATQAADLAQVFLKGGEA 120

Query: 174 NQYANSSSK-----------------KVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQ 216
                ++S                  +V+NLL I GEDQVTLKVTIAEVRR++LKQ+GF 
Sbjct: 121 TTRTETASGTGGDSAVALFAEGRQTSQVVNLLKIEGEDQVTLKVTIAEVRREVLKQLGFD 180

Query: 217 H---SITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLA 273
           +   + +G +     + +AD     V  G     K  + ++   T L+ALE+A  +RTLA
Sbjct: 181 NLISNSSGMTVAQLGTPSADSATATVGGGLAALFKSSIGKYDISTYLNALEQAKVVRTLA 240

Query: 274 EPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQ 333
           EPTLTAISGQ+A+F SGGQ LY T   + G  +V   +YG+ L F P VLS GRI L I+
Sbjct: 241 EPTLTAISGQAATFNSGGQQLYSTT-DNDGNVTVVPFNYGINLAFKPVVLSSGRISLEIK 299

Query: 334 TEVSEPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPI 393
           T VSEPV G        Y+ R A+T+VELPSGG+I LAGL++D++ Q   G P +SKIP+
Sbjct: 300 TNVSEPVAGSGNAT---YQRRSAETSVELPSGGSIALAGLIRDNVSQTMGGTPGVSKIPL 356

Query: 394 LGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYG 453
           LG LFR   F R+ETE+ I ATP+LV+PVA   L+RPDD++S E+D   FF NRVNK+YG
Sbjct: 357 LGTLFRQKGFERQETELVIIATPYLVRPVARNQLNRPDDNFSPENDGATFFLNRVNKVYG 416

Query: 454 PKEASEVEGQNYKGAIGFIYK 474
            +EA   + Q + G+IGFIYK
Sbjct: 417 RREAPVADAQ-FHGSIGFIYK 436


>gi|13474660|ref|NP_106229.1| exporter protein, cpaC [Mesorhizobium loti MAFF303099]
 gi|14025415|dbj|BAB52015.1| exporter protein; CpaC [Mesorhizobium loti MAFF303099]
          Length = 471

 Score =  334 bits (855), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 181/473 (38%), Positives = 279/473 (58%), Gaps = 43/473 (9%)

Query: 42  VEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVIL 101
                 +++ +GLNK +++ +P D  D+LV++PT AD V  + R +YLFGK+VG+ N+ +
Sbjct: 2   TATTATQRVKLGLNKSVVIDLPSDAYDILVANPTVADAVTRTARRIYLFGKSVGETNIFV 61

Query: 102 IGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAV 161
            G +G+Q+ +LD+ +ERD+A LE  +RRF+  S+++VE+++D VVL G V T  D++RAV
Sbjct: 62  FGPNGEQIASLDLAVERDVAGLEDYIRRFLPTSDVKVELLNDNVVLTGTVDTPLDAKRAV 121

Query: 162 ELSETFLSQSGRNQYA---------------------NSSSKKVMNLLNIAGEDQVTLKV 200
           +L+  F+S                                  K++NLL I G+DQVTLKV
Sbjct: 122 DLATIFVSGGEATTGQYSQTAAGGSAQGGVDINNPDQERRVSKIVNLLQIIGDDQVTLKV 181

Query: 201 TIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVL 260
           T+AEV R ++KQ+G      G S+G S    +D       +         +   +    +
Sbjct: 182 TVAEVSRSVMKQLGVNMVGNGGSNGISYGALSDNFTGLGKQLSHSGFN--IGNSALMAYI 239

Query: 261 HALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSST---------GATSVTTHD 311
           +A+E++  ++TLAEPTLTA+SG+ A+F  GG++   T  S              ++   +
Sbjct: 240 NAMEQSGVMKTLAEPTLTAVSGEKATFKVGGEYNLLTGVSQNVSSDNQTGLTTYTINKIE 299

Query: 312 YGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVN----------AGDMPSYRVRKADTTVE 361
           YG+ L F P VLSPGRI L+++T VSEP    +            +M S R R ADTTVE
Sbjct: 300 YGIGLEFQPVVLSPGRISLKVRTSVSEPTTEGSVALSNGVTSPGANMLSLRKRLADTTVE 359

Query: 362 LPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKP 421
           LPSGG++++AGL++DD++Q   G+P L+KIP+LGALFR+  F R E+E+ I  TP+L KP
Sbjct: 360 LPSGGSMMIAGLVRDDVRQAVNGLPGLTKIPVLGALFRSRDFVRNESELVIIITPYLAKP 419

Query: 422 VAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
           VA  DL++PDD+++   D  A F  +VN++YG  +  +  G+ Y G +G+IYK
Sbjct: 420 VARNDLAKPDDNFNPASDGAANFLGKVNRVYGTMQTDKPNGR-YHGVVGYIYK 471


>gi|218530654|ref|YP_002421470.1| type II and III secretion system protein [Methylobacterium
           chloromethanicum CM4]
 gi|218522957|gb|ACK83542.1| type II and III secretion system protein [Methylobacterium
           chloromethanicum CM4]
          Length = 499

 Score =  333 bits (853), Expect = 5e-89,   Method: Composition-based stats.
 Identities = 148/477 (31%), Positives = 247/477 (51%), Gaps = 26/477 (5%)

Query: 19  SNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKAD 78
                A         + V+ I   E    +++ +   + +I+ +P D ++V V++P  A+
Sbjct: 24  MLSGPASAQAGLSGASPVLTIGANEAAVSRRVELSKGRSLIVDLPRDAKEVFVANPAVAN 83

Query: 79  VVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRV 138
            VV S R ++L G + G  ++ ++  +G+Q+  LD+ I RDI  L  +L+  +      V
Sbjct: 84  AVVRSSRKLFLIGIDNGATSIFVMDGEGRQIAALDVTIARDINVLRQSLQLSLPGGRFDV 143

Query: 139 EMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTL 198
           + V D++VL G V +  ++Q+A++++  F+  +     A   +  V+N L I  +DQV +
Sbjct: 144 KAVGDSLVLSGSVNSTSEAQQALDIANAFVGIAAGGGVATRGA--VINNLTIRNKDQVMI 201

Query: 199 KVTIAEVRRDILKQIGFQHSITGSSSGP--------SKSFAADFGGKFVSEGGDFSVKGV 250
           +VT+ EV R +LKQ G   +   ++  P        + +      G +  +G   S    
Sbjct: 202 RVTVVEVARTVLKQFGINVTGNWAALNPLSPTGNVLTNTTPFPLTGAYSPDGNALSASIR 261

Query: 251 LDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKT-----VSSSTGAT 305
               S +  L A E+A   R LAEPTLTAISG+SA FT+GG+    +     V+ +    
Sbjct: 262 SGGVSLQATLRAFEQAGVSRILAEPTLTAISGESAKFTAGGEIPVPSNCSAGVAGAACTV 321

Query: 306 SVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVN----------AGDMPSYRVRK 355
           ++    YGV L FTP V++  RI +R+ T+V+E     +             +P+   R 
Sbjct: 322 ALEFKPYGVSLAFTPIVMAENRISIRVATDVTELDRQNSYSFSFPGSNRVTPVPATTRRS 381

Query: 356 ADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAAT 415
           ++TTVEL SG T++ AGL++   +    G+P L  +PILGALFR+  + R+ETE+ I  T
Sbjct: 382 SETTVELASGATMMTAGLIQQKSRASISGLPGLMNLPILGALFRSRDYQRDETELMIMVT 441

Query: 416 PFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFI 472
           P++ +P+  R + RPDD +    D +A    R+NKIYG      + G  Y+G +GFI
Sbjct: 442 PYIAQPMEARQVQRPDDGFVDAPDGQAVLLGRLNKIYGTVGGGTL-GPAYRGRVGFI 497


>gi|328953626|ref|YP_004370960.1| type II and III secretion system protein [Desulfobacca acetoxidans
           DSM 11109]
 gi|328453950|gb|AEB09779.1| type II and III secretion system protein [Desulfobacca acetoxidans
           DSM 11109]
          Length = 503

 Score =  333 bits (853), Expect = 5e-89,   Method: Composition-based stats.
 Identities = 138/493 (27%), Positives = 213/493 (43%), Gaps = 46/493 (9%)

Query: 11  MMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVL 70
           + ++ L   + +V   P +  A A +  + D ++   + I + + +  +L+    +  + 
Sbjct: 21  LAAMVLILGSAAVYSPPSVLAAQALLERVKDEDLE--QVIRLRVGRSKVLRTSFTISRIS 78

Query: 71  VSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRF 130
           V+DP  AD+++ S R +Y+ G   G  N+ L G   +   +  + +E D++ L+  L + 
Sbjct: 79  VADPEVADIIMISEREVYINGNAPGVTNISLWGK--RSFSSAKVTVEADVSLLKEKLFKV 136

Query: 131 IADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNI 190
           +    I VE   DTVVL G V      + A+ L+  F               KV+NLL+I
Sbjct: 137 LPKEKIAVEAAEDTVVLSGEVSGPVAQETAISLATAFSGGKK---------DKVVNLLHI 187

Query: 191 AGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADF---------------G 235
            G  QV + V +AE+ R + K++G   + +  +     +                     
Sbjct: 188 GGVQQVMVAVRVAEINRSVGKEMGINFAYSNKAGNFGATLLNSLSILKNIDRNLDSVTAP 247

Query: 236 GKFVSEGG-----------DFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQS 284
           G  V+ G            +    G+   F +      L++    R LAEP L   SGQ 
Sbjct: 248 GVLVNPGVTTSSQQFSSSVNAVFGGLYGSFFWTAFFDVLKKNGLGRILAEPNLVTTSGQE 307

Query: 285 ASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIG-- 342
           ASF +GG+     V S  G TS+    +GV L FTPTVL   +I LRI  EVSE      
Sbjct: 308 ASFLAGGEFPIP-VPSGLGTTSIDYKKFGVGLVFTPTVLDNDKIALRINPEVSELDFSSQ 366

Query: 343 ----VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALF 398
               VN   +P  +VR+  T VE+  G T+ +AGLL D  + +    PLL  +PILG LF
Sbjct: 367 TTVVVNNFIVPGLKVRRTTTQVEMKDGQTLAIAGLLSDQHRNVVNKYPLLGDLPILGVLF 426

Query: 399 RNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEAS 458
           R+S F + ETE+ I  TP LVK         P D Y    D + +   R        +  
Sbjct: 427 RSSSFQKSETELVILVTPHLVKSQPPGPHRLPTDKYIEPTDLEFYLLGRSEGRDKKPQPP 486

Query: 459 EVEGQNYKGAIGF 471
                      GF
Sbjct: 487 AASPAREITPPGF 499


>gi|209886530|ref|YP_002290387.1| type II and III secretion system protein [Oligotropha
           carboxidovorans OM5]
 gi|209874726|gb|ACI94522.1| type II and III secretion system protein [Oligotropha
           carboxidovorans OM5]
          Length = 486

 Score =  332 bits (852), Expect = 6e-89,   Method: Composition-based stats.
 Identities = 162/482 (33%), Positives = 267/482 (55%), Gaps = 28/482 (5%)

Query: 9   FTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQD 68
              +S+F+  S PS A       ++A+  +   +     + + +G++K +++ +P DV+D
Sbjct: 13  AAAISVFILGSAPSSALATDYSASSASTSHADSLN---ARALRLGISKSLVVDLPRDVKD 69

Query: 69  VLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLR 128
           VLV+DP  A+ VV S R  Y+ G +VGQ N+I    DG+QM   D+ + RD+  +   + 
Sbjct: 70  VLVADPKIANAVVRSSRRAYIIGASVGQTNIIFFDADGQQMAAYDVAVTRDLNGIRTAIH 129

Query: 129 RFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLL 188
           + +  S+I+VE + D VVL G      ++Q+A EL+   +         + + + ++N +
Sbjct: 130 QALPQSDIQVEGLGDGVVLSGTAANQAEAQQAYELAARLIGGP------SKAGELIVNNI 183

Query: 189 NIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSG-----PSKSFAADFGGKFVSEGG 243
            + G DQV L+VT+AEV+R I+KQ+G   S + +         + +     G + V    
Sbjct: 184 AVRGRDQVMLRVTVAEVQRSIIKQLGVDLSGSFNYGTAVVDFNNTNTFTALGRRLVDNNA 243

Query: 244 DFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTG 303
             +  G     S +  L A+E A  IRTLAEP LTAISG+SA+F +GG+    T  +   
Sbjct: 244 VSAAFGNGTVPSVKATLRAMESAGVIRTLAEPNLTAISGESATFIAGGEFPIPTGITCQT 303

Query: 304 ---------ATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS----EPVIGVNAGDMPS 350
                      S+    +G+ L+FTP VL+ GRI LR+ TEVS    +  I V+   +PS
Sbjct: 304 AAGGSTGPCQPSIAFKKFGISLNFTPVVLTEGRISLRVMTEVSEVSSDNSISVSGLTIPS 363

Query: 351 YRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEI 410
            + R+A+TT+E+PSGG++ +AGL++D  +Q   G+P L+++P+LG LFR+  F   +TE+
Sbjct: 364 IKTRRAETTLEIPSGGSMAMAGLIQDQTKQAINGLPGLAQVPVLGTLFRSRDFINNQTEL 423

Query: 411 FIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIG 470
            +  TP++V+ VA +DLSRPDD ++   D ++     + +IYG          +Y+G  G
Sbjct: 424 MVLVTPYVVRAVAQKDLSRPDDGFASASDPQSVLLGNITRIYGVPRRGGP-VASYRGKYG 482

Query: 471 FI 472
           FI
Sbjct: 483 FI 484


>gi|46580524|ref|YP_011332.1| type II/III secretion system protein [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120602159|ref|YP_966559.1| type II and III secretion system protein [Desulfovibrio vulgaris
           DP4]
 gi|46449943|gb|AAS96592.1| type II/III secretion system protein [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120562388|gb|ABM28132.1| type II and III secretion system protein [Desulfovibrio vulgaris
           DP4]
 gi|311234263|gb|ADP87117.1| type II and III secretion system protein [Desulfovibrio vulgaris
           RCH1]
          Length = 484

 Score =  332 bits (850), Expect = 9e-89,   Method: Composition-based stats.
 Identities = 125/457 (27%), Positives = 204/457 (44%), Gaps = 41/457 (8%)

Query: 45  GKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGH 104
               ++ +   K  ++     V  + ++D   A VVV SP+ +Y+ GK  G   + L   
Sbjct: 38  AASSELQVATGKSSVVSTSRPVGRLAIADEAIAGVVVLSPQQVYVTGKKAGTTTLTLWDG 97

Query: 105 DGKQMLNLDILIERDIAHLEMTLRRFIADSN-IRVEMVSDTVVLHGMVRTIQDSQRAVEL 163
            G  +   D+ +  DIA L+  L R +   N I V  V+DTV L G VR+      A+++
Sbjct: 98  GGAVIGVYDVQVTPDIAQLKEMLHRVLPGENDIMVMGVNDTVTLAGTVRSAASMTTAMDM 157

Query: 164 SETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSS 223
           +  +            +  KV NL+ + G  QV L+V +AE+RR++++++G   +     
Sbjct: 158 ARLY------------APDKVTNLMQVGGVHQVMLEVKVAEMRRNVMERLGIDLTYAWRG 205

Query: 224 SGPSKSFA-------------ADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIR 270
                                A   G  +S   + + +    + S    L  L++   ++
Sbjct: 206 DFIFGMLNQLFTLDSQKGVVDAGPSGAVLSPNVNGAFRITSGQVSIMGFLDVLKQNGLVK 265

Query: 271 TLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGL 330
            LAEPTL   SG+ A F +GG+     V    G  ++   ++GV L F PTV+  GRI +
Sbjct: 266 VLAEPTLVCRSGEKAEFLAGGEIPIP-VPQGLGTVAIEYKEFGVTLQFLPTVVGDGRISM 324

Query: 331 RIQTEVSE----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIP 386
           ++  EVSE     V+ +    +P+   R+A TTVEL  G +  +AGLL+DD++Q     P
Sbjct: 325 KVAPEVSELDYTNVVQIQGFTIPAITSRRASTTVELADGQSFAIAGLLRDDVRQAVNKYP 384

Query: 387 LLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFN 446
           +L  +P+LG LFR+S + + ETE+ I  TP L KP+       P D Y      + F   
Sbjct: 385 VLGDMPVLGTLFRSSNWQKNETELVIIVTPHLAKPLEANATRLPTDAYREPSAFEYFILG 444

Query: 447 RVNKI----------YGPKEASEVEGQNYKGAIGFIY 473
           R+                           +GA G + 
Sbjct: 445 RMEGSRRADATAAAARTYGTTGAGAPSGMEGAFGHML 481


>gi|90411206|ref|ZP_01219219.1| Flp pilus assembly protein [Photobacterium profundum 3TCK]
 gi|90328052|gb|EAS44373.1| Flp pilus assembly protein [Photobacterium profundum 3TCK]
          Length = 489

 Score =  331 bits (849), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 121/447 (27%), Positives = 208/447 (46%), Gaps = 41/447 (9%)

Query: 39  ISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQAN 98
            ++V   + + IS+  NK  ++++P   + + V +P  AD+++     +Y+ GK  G  N
Sbjct: 27  TTNVSATRTESISVPHNKSRLIEIPGRAKKISVGNPAIADILILRSNKIYVLGKQFGTTN 86

Query: 99  VILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQ 158
           VI+     + +  LD+ +  D+  L+  L  F+ +  I V    + +VL G V +     
Sbjct: 87  VIIWDSKDRLITVLDVEVTHDLNALKSKLYEFMPNEKISVYTSQNKLVLSGEVSSADKIA 146

Query: 159 RAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHS 218
            AVE++ TF           ++  +++NL+ + G  QV L+VT+AEV+R ++++   +  
Sbjct: 147 TAVEIANTF-----------TADGEIINLMAVGGSHQVMLEVTVAEVQRSLVREFDSKFV 195

Query: 219 ITGSSSGPSKSFAADFGGKFVSEG------------------GDFSVKGVLDRFSFETVL 260
               S   +   A        + G                         +     F    
Sbjct: 196 FARQSGNWTWGGANGGASVPSNVGILDPILDAAVSNPLNIDDNGLFASFLSSNTLFAAAF 255

Query: 261 HALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTP 320
              +     + LAEPTLTAISG+ A F SGG+      +      ++   ++GV L F P
Sbjct: 256 DIAKTNGLAKVLAEPTLTAISGEEAEFISGGEFPIPVPNDEN--ITIEFKEFGVALKFLP 313

Query: 321 TVLSPGRIGLRIQTEVSEPVIGVNAGD----------MPSYRVRKADTTVELPSGGTIVL 370
           TV+S   I L +  EVSE                   +PS   R A TT+EL +G TI +
Sbjct: 314 TVMSADSINLALNIEVSEISNQNAVSITPGGTNSQFFVPSLSKRGAKTTIELGNGQTIGI 373

Query: 371 AGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRP 430
           AGLL ++I  + + +P L  +PI+G LFR+  F + ETE+ I  TP L KPV  +D++ P
Sbjct: 374 AGLLNENITDVVDKLPGLGDLPIIGQLFRSQSFRKGETELVILVTPRLAKPVRKQDITLP 433

Query: 431 DDHYSVEDDAKAFFFNRVNKIYGPKEA 457
            D++   +D + +   R++++   + A
Sbjct: 434 TDNFVEPNDWEYYLLGRMSELKRNEPA 460


>gi|78357403|ref|YP_388852.1| type II/III secretion system protein [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
 gi|78219808|gb|ABB39157.1| type II/III secretion system protein [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
          Length = 482

 Score =  331 bits (848), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 128/499 (25%), Positives = 220/499 (44%), Gaps = 63/499 (12%)

Query: 6   RTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVD 65
           R F  + ++ L +     A +P                      + +   K ++L+    
Sbjct: 15  RHFPVLAAVLLSAVCAQAAIVPAA--------------------VQLAAGKSVVLETASP 54

Query: 66  VQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEM 125
           V+ V V+ P  A V+V SP  +Y+ G   G   + L    G      DI +  DIA L+ 
Sbjct: 55  VRRVSVAAPEVAQVLVLSPTQVYVTGVKPGGTTLTLWNAAGAVSHVFDIQVSPDIARLKE 114

Query: 126 TLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKV 184
            L + +    +I V  V +++ L G V +      A++++  +            +  KV
Sbjct: 115 MLHKLLPSEKDIMVMTVGESITLAGTVSSPAHIATAMDMARMY------------APDKV 162

Query: 185 MNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSS-------------SGPSKSFA 231
            NL+ + G  Q+ L+V +AE+RR +++++G   +    +                  +  
Sbjct: 163 TNLMKVGGMHQIMLEVKVAEMRRSVMQRLGIDLAAAWGNSFAFTMLNQLFTLDNQDGTIG 222

Query: 232 ADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGG 291
                  +S       +  +   +    L  L+    ++ LAEPTL   SG+ ASF +GG
Sbjct: 223 VGRTAAVLSPNNTGVFQAPVGGMTLTGFLDVLKENGLVKVLAEPTLVCRSGEHASFLAGG 282

Query: 292 QHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGD 347
           +     V    G  ++   +YGV L FTPTVLSP +I L+++ EVSE     VI +N   
Sbjct: 283 EIPIP-VPQGLGTVAIEFKEYGVTLDFTPTVLSPRQISLKVEPEVSELDYANVIQINGFS 341

Query: 348 MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREE 407
           +P    R+A TTVEL  G +  +AGLL+D++++  +  P L  IP+LG LFR+S + + E
Sbjct: 342 IPGISSRRASTTVELGDGQSFAIAGLLRDEVRETIKKYPGLGDIPVLGTLFRSSSWQKNE 401

Query: 408 TEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVN-----------KIYGPKE 456
           TE+ I  TP L KP+ M   + P D +    + + F   ++            +  G  +
Sbjct: 402 TELVIIITPRLAKPLDMTAQTLPTDGFREPTEYEFFIQGKMEGDAPAAAPAAMRGSGDVQ 461

Query: 457 ASEVEGQ-NYKGAIGFIYK 474
           +S+       +G  G + +
Sbjct: 462 SSDGNPPSGMEGEFGHVLR 480


>gi|114705456|ref|ZP_01438364.1| exporter protein, cpaC [Fulvimarina pelagi HTCC2506]
 gi|114540241|gb|EAU43361.1| exporter protein, cpaC [Fulvimarina pelagi HTCC2506]
          Length = 544

 Score =  331 bits (848), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 185/523 (35%), Positives = 275/523 (52%), Gaps = 65/523 (12%)

Query: 15  FLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDP 74
            L  +         + +   A  N+  +  G  + I +GL+K  +L +  D  D+LV++P
Sbjct: 24  ALGLTAAIALAPLALTQTAYAEQNVVQIGAGHTR-IELGLDKSKVLVLSADAHDILVANP 82

Query: 75  TKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADS 134
           + AD +    R +YLFGK VGQ N+I+     +Q+ ++DI IERDIA L   + +++ DS
Sbjct: 83  SIADALTRDRRHIYLFGKQVGQTNLIVFDQANRQIASIDIQIERDIAGLSQAIAKYVPDS 142

Query: 135 NIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQY------------------ 176
           +++VE+++D VVL G VRT  DS+R  +++  +L+                         
Sbjct: 143 DVKVEIMNDNVVLTGRVRTPLDSKRVSQIASAYLTGGEATTGQYIRSASAGGESEGSNGD 202

Query: 177 -----ANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFA 231
                      +++NLL I GEDQVTLKVT+AEV+R I+KQ+G   + +    G +    
Sbjct: 203 VAFASETRRESQIINLLQIEGEDQVTLKVTVAEVQRSIIKQLGLNGATSSVIDGMTFGSL 262

Query: 232 AD--FGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTS 289
            D  FG    +   +F + G +        L A+++A  +RTLAEP LTAISG+SASF  
Sbjct: 263 IDNPFGLGKAASNSNFGLAGTIGDTGIRAQLSAMDQAGVMRTLAEPNLTAISGESASFKV 322

Query: 290 GGQHLYKTVSSSTG-----------------------------ATSVTTHDYGVVLHFTP 320
           GG+ L  T  S                                     T +YG+ L FTP
Sbjct: 323 GGEFLLPTGQSYDYGEEAKREFKGFDGDGRAIYEEVPATRDVRTVETKTIEYGIGLDFTP 382

Query: 321 TVLSPGRIGLRIQTEVSEPVIGV---------NAGDMPSYRVRKADTTVELPSGGTIVLA 371
            VLSPGRI L+++T VSEP                     R R ADTTVELPSGG++V+A
Sbjct: 383 VVLSPGRISLKVRTSVSEPTFETPFGSSGGFDGGVTGIGIRKRLADTTVELPSGGSLVIA 442

Query: 372 GLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPD 431
           GL++D+++Q+  G P LSK+P+LG+LFR+  F R ETE+ +  TP+LV+PVA   L+RPD
Sbjct: 443 GLVRDEVRQVVSGFPGLSKLPVLGSLFRSRDFQRYETELVVIVTPYLVRPVAREALARPD 502

Query: 432 DHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
           D  +   D  + F  ++N++YG  E     G+ Y G +G+IYK
Sbjct: 503 DGLAFASDGASNFLGKINRVYGHSETKLPPGR-YHGVVGYIYK 544


>gi|148256957|ref|YP_001241542.1| putative pilus assembly protein CpaC [Bradyrhizobium sp. BTAi1]
 gi|146409130|gb|ABQ37636.1| putative Pilus assembly protein cpaC [Bradyrhizobium sp. BTAi1]
          Length = 489

 Score =  330 bits (846), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 160/492 (32%), Positives = 266/492 (54%), Gaps = 38/492 (7%)

Query: 3   YLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQV 62
           +L R F T  +I L + NP++A +   ++ +  V+++   ++     +S+G+ K +++  
Sbjct: 14  WLVRAFSTAAAIGL-AINPALAPVHAAEDRDTPVVSVGSSKV---HYLSLGIGKSVVVDF 69

Query: 63  PVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAH 122
           P DV+DVLV+DP  A+ VV S R  Y+ G  VGQ NV+    +G+Q+   DI I+RD+  
Sbjct: 70  PQDVKDVLVADPKIANAVVRSARRAYIIGAAVGQTNVVFFDGEGQQVAAYDIAIKRDLNG 129

Query: 123 LEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSK 182
           +   L + I    ++++ V D V+L G V +  ++Q+A E++   +            S 
Sbjct: 130 VRQALSQSIPG--VKIDGVGDGVILTGSVSSPVEAQQAGEIASRLVGG----------SD 177

Query: 183 KVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVS-- 240
           KV+N + + G DQV LKV ++EVRR+I+KQ+G   S + +      +F            
Sbjct: 178 KVVNSIVVRGRDQVMLKVNVSEVRREIVKQLGIDLSASMTYGTAVVNFNNTNPFTAYGKS 237

Query: 241 -EGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVS 299
              G+          S    + A+E A   +TLAEP LTAISG+SA+F +GG+       
Sbjct: 238 LVNGNALNVSGGGLSSVSATMRAMETAGVTKTLAEPNLTAISGESATFIAGGEFPVPGGY 297

Query: 300 SSTGATSV-----TTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVN---------- 344
           +    T V     T   +G+ L+FTP VLS GRI LR+ TEVSE                
Sbjct: 298 NCDPTTRVCTTSITYKKFGISLNFTPVVLSEGRISLRVMTEVSELSNDNAITVSYALTST 357

Query: 345 ---AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNS 401
              +  +P+ R R+A+TT+E+PSGG++ +AGL+++  +Q   G+P + ++P+LG LFR+ 
Sbjct: 358 SSSSVTIPAIRTRRAETTLEIPSGGSMAMAGLIQNQTKQAINGLPGVDQLPVLGQLFRSK 417

Query: 402 RFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVE 461
            +   ETE+ +  TP++V+ VA ++L+RPDD ++   D+++    R+N++YG     +  
Sbjct: 418 DYVNNETELMVLVTPYVVRAVAQKELARPDDGFAPATDSESALLGRMNRLYGIAAKVDTA 477

Query: 462 GQNYKGAIGFIY 473
                G  GFI 
Sbjct: 478 TGEPAG-FGFII 488


>gi|163751744|ref|ZP_02158962.1| Flp pilus assembly protein, secretin CpaC [Shewanella benthica
           KT99]
 gi|161328396|gb|EDP99555.1| Flp pilus assembly protein, secretin CpaC [Shewanella benthica
           KT99]
          Length = 484

 Score =  330 bits (845), Expect = 4e-88,   Method: Composition-based stats.
 Identities = 118/436 (27%), Positives = 197/436 (45%), Gaps = 21/436 (4%)

Query: 42  VEIGKGKKI-SIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVI 100
              G  + I  I + K  I+ +   V  V V +P   D+ +     +Y+ GK +G  N++
Sbjct: 31  GPTGASRDIMQIPIFKSRIINLKHAVHRVSVGNPNIGDIKLLPNNELYVLGKKLGSTNIM 90

Query: 101 LIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRA 160
           +   + + +  +DI I  D+  L++ L  F+    + V+     +++ G    ++    A
Sbjct: 91  IWDENERLVDVIDIEITHDLNGLKLRLHEFLPGEKLGVQTSQGHLLISGQASNLKKMNTA 150

Query: 161 VELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSIT 220
           VEL              +     V+N++ + G+ QV L+V IAEV+R++ +Q   +  I 
Sbjct: 151 VEL----AKAYAAAASVSKVKSTVLNMMTVGGDHQVMLEVVIAEVQREVARQFDSKFFIF 206

Query: 221 GSSSGPSKSFAADFGGKFVSEGGDFSVKGVL-----DRFSFETVLHALERATAIRTLAEP 275
              S  S   A   G   +        +G       D       L   ++    + LAEP
Sbjct: 207 NKGSKMSGGVAGRGGSFDLDPAAAIDSRGFFARYLNDNLMMNFALDVAKQNGLAKILAEP 266

Query: 276 TLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTE 335
           T+TA+SGQSA F SGG+     V    G+T++   D+GV + F PTVL  G+I L +   
Sbjct: 267 TVTALSGQSAEFLSGGEFPIP-VPGINGSTTIQYRDFGVGVRFVPTVLDSGQINLNLNVI 325

Query: 336 VSEPVI----------GVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGI 385
           VSE                   +PS   R   TTVEL  G TI ++GL+ D +++  + +
Sbjct: 326 VSEISNVHSVSLSGGGSNATLIVPSIVKRTTSTTVELADGQTIAISGLISDTLRENIDKL 385

Query: 386 PLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFF 445
           P L  IPILG LF +  F   ++E+ I  TP LV+P   + +S P D + +  D + +  
Sbjct: 386 PGLGDIPILGQLFTSKSFKSGQSELVILVTPRLVRPFNRKHISLPTDDFVLPSDMEFYLL 445

Query: 446 NRVNKIYGPKEASEVE 461
            +++      + S   
Sbjct: 446 GKMSHKKQNSQRSGTP 461


>gi|253996769|ref|YP_003048833.1| type II and III secretion system protein [Methylotenera mobilis
           JLW8]
 gi|253983448|gb|ACT48306.1| type II and III secretion system protein [Methylotenera mobilis
           JLW8]
          Length = 513

 Score =  329 bits (844), Expect = 5e-88,   Method: Composition-based stats.
 Identities = 135/480 (28%), Positives = 226/480 (47%), Gaps = 32/480 (6%)

Query: 8   FFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKK---------ISIGLNKVI 58
              M+ + L S  P  A  P     N  V  ++  ++              + + L +  
Sbjct: 24  LAAMLGVTLLSIAPLHAAEPQANMQNILVAAVTPKKVAARPTPSSTEIVPSVELSLGQSH 83

Query: 59  ILQVPVDV--QDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQ----MLNL 112
           ++++P  V  Q V V D     V V SPR + L  K +G   VI++   G+     +  +
Sbjct: 84  LVRLPAGVNLQRVKVDDDKIVQVDVTSPREVVLHAKTIGSTMVIILDKSGQSAVMDVRVV 143

Query: 113 DILIERDIAHLEMTLRRFIADSN-IRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQS 171
                 D A L+  L++ + +   I+V   ++++VL G V     + +A+ L+E +    
Sbjct: 144 AAATAMDAASLQTKLQQIMPNEKGIKVSTAAESLVLSGTVSDAVKADKAMALAEAY---- 199

Query: 172 GRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFA 231
                     KKV+N+L +A   QV L+V +AEV +++L ++G     + S+ G + + A
Sbjct: 200 ----GGKDKDKKVINMLQVAAPQQVMLEVKMAEVSKNLLDKLGASFGASRSNGGVAYAIA 255

Query: 232 ADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGG 291
           + F     ++         + + +    + A  +   ++ LAEP + AISGQ  SF +GG
Sbjct: 256 SGFLSLTGADPLSPGGLLTITKGNTAIKVDAENKDGVVKILAEPNIIAISGQEGSFLAGG 315

Query: 292 QHLYKTVSSSTGAT----SVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGD 347
           +       S+TG      ++   D+GV L FTPTVL  G I LR+  EVSE   G     
Sbjct: 316 KIFIPVPQSNTGGGSNVLTLEERDFGVGLKFTPTVLEEGMINLRVAPEVSELNQGGTTVG 375

Query: 348 M---PSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFN 404
               PS+ VR+  TTV+L  G +  +AGL+K+++ +     P+L +IPILGALFR+S F 
Sbjct: 376 GSVFPSFTVRRVATTVQLRDGQSFAIAGLIKNNVTENVRRFPILGEIPILGALFRSSSFQ 435

Query: 405 REETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQN 464
            ++TE+    TP LVKP+   D + P D ++    A+ F   ++          E   Q+
Sbjct: 436 EDKTELLFVITPRLVKPL-PPDFALPTDKFTPPSKAEFFLNGKLEGKPAEPATEESPAQS 494


>gi|116748930|ref|YP_845617.1| type II and III secretion system protein [Syntrophobacter
           fumaroxidans MPOB]
 gi|116697994|gb|ABK17182.1| type II and III secretion system protein [Syntrophobacter
           fumaroxidans MPOB]
          Length = 482

 Score =  327 bits (839), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 130/487 (26%), Positives = 207/487 (42%), Gaps = 45/487 (9%)

Query: 11  MMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVL 70
           +++  L   + S           AA            +KI + + K +I++    V    
Sbjct: 16  VLAFSLVLISSSALH--------AAGPVKVVTGEHAARKIHLQVGKSVIVRSGAPVVRTT 67

Query: 71  VSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRF 130
           +  P  AD+V  SP  +Y+ GK  G  N+ L   D K     DI +  D   L+  L   
Sbjct: 68  LGSPDVADIVALSPTQIYITGKATGVTNLTLWQSDDKVSAIYDIEVAPDTMRLKEKLHEV 127

Query: 131 IADS-NIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLN 189
           +    +I+V    D++ L G + +     +A+ L+E +              KKV+NLL 
Sbjct: 128 LPGERDIKVSASHDSLTLSGTISSSTHLAQAMTLAEAYSGG-----------KKVINLLQ 176

Query: 190 IAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGK------------ 237
           ++G  QV L+V +AE+ R +  ++G   SI   +     S   +                
Sbjct: 177 VSGVHQVMLEVRVAEMSRTLTNRLGIN-SIWNVNGSMGASLLGNLASLDKFAGSASGSSS 235

Query: 238 --FVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLY 295
               +   +     +   F++   + AL+    ++ LAEPTL A+SGQSASF +GG+   
Sbjct: 236 EFTFAPTVNSLFHILGGPFTWTAFIDALKEDGLVKVLAEPTLIAMSGQSASFLAGGEFPI 295

Query: 296 KTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVN----AGDMPSY 351
             V    G   +    +GV L FTPTVL+  R+ + +  EVSE             +P  
Sbjct: 296 P-VPQGLGTVGIEYKQFGVSLAFTPTVLNDKRMNIIVAPEVSELDYTTAINIAGVAVPGL 354

Query: 352 RVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIF 411
             RK  T +EL  G +  +AGLLKD I++  +  P+L  IP+LGALFR+  F R ETE+ 
Sbjct: 355 TTRKVSTAIELNDGQSFAIAGLLKDTIREDAKKFPILGSIPVLGALFRSVSFQRNETELI 414

Query: 412 IAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEV-----EGQNYK 466
           +  TP L KP+ +     P D +    D++ FF   +                 +   + 
Sbjct: 415 VIVTPRLAKPIDVATQPLPTDKFIEPSDSEFFFLGLLQGRAPKPAPRAPLPITDKKAGFD 474

Query: 467 GAIGFIY 473
           G  G   
Sbjct: 475 GEFGHTV 481


>gi|84387245|ref|ZP_00990266.1| Flp pilus assembly protein [Vibrio splendidus 12B01]
 gi|84377892|gb|EAP94754.1| Flp pilus assembly protein [Vibrio splendidus 12B01]
          Length = 484

 Score =  326 bits (836), Expect = 4e-87,   Method: Composition-based stats.
 Identities = 118/454 (25%), Positives = 205/454 (45%), Gaps = 27/454 (5%)

Query: 38  NISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQA 97
             S   +  GK +++  +K   + +      V + DP   D+V+     ++L GK +G  
Sbjct: 16  TASVAALQTGKTVTVPHHKSTHVVLSGKAAKVSLGDPEVLDIVILKSNELFLIGKKLGAT 75

Query: 98  NVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDS 157
           N++     G+ + +++I +  D+  L+  L  F+ D  I V    + ++L G V   Q  
Sbjct: 76  NLMAWDSRGQLIESINIEVTHDLNSLKAKLYEFLPDETIEVHSAQNRLLLSGQVSNQQQM 135

Query: 158 QRAVELSETFLSQSGRNQYANSSSKK-----VMNLLNIAGEDQVTLKVTIAEVRRDILKQ 212
             A+ ++ET+ S    ++   S S++     V+NL++I G  QV L+VT+AEV+R ++++
Sbjct: 136 NVAMRIAETYSSGQTADKSNESGSEQADATGVINLMSIGGAQQVMLEVTVAEVQRSLVRK 195

Query: 213 IGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLD----------RFSFETVLHA 262
                    +S       A+      +     F++    D             F   L  
Sbjct: 196 FDANFHFFQTSGSDFSWGASSVPAGVLGATPIFNIPTSTDYGILGSFIDSNTLFTFALDV 255

Query: 263 LERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTV 322
            ++    + LAEP LTA+SG  A F +GG+             ++   +YGV L F PTV
Sbjct: 256 AKQNGVAKVLAEPNLTALSGSKAEFLAGGEFPIPVPDEDG--ITIEYKEYGVGLKFIPTV 313

Query: 323 LSPGRIGLRIQTEVSEPVIGVN----------AGDMPSYRVRKADTTVELPSGGTIVLAG 372
           LS  +I L +  +VSE     +             +P    R A +T+EL  G TI +AG
Sbjct: 314 LSDKKINLNLAVDVSEIANTSSLTIDPGTTNATYFIPPITRRSASSTLELADGQTIGIAG 373

Query: 373 LLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDD 432
           LL ++++ +   +P    +PILG LF +  +   ETE+ I  TP L KP+    ++ P D
Sbjct: 374 LLSENVRDISNKMPGFGDVPILGQLFNSQEYISGETELVILVTPRLAKPIDRSKVTLPTD 433

Query: 433 HYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYK 466
            +   +D + +   R   I  P E+   + Q  +
Sbjct: 434 AFVDPNDLEYYLLGRGAYIAEPSESDSEQSQASQ 467


>gi|254473733|ref|ZP_05087128.1| type II and III secretion system protein [Pseudovibrio sp. JE062]
 gi|211957119|gb|EEA92324.1| type II and III secretion system protein [Pseudovibrio sp. JE062]
          Length = 456

 Score =  326 bits (836), Expect = 4e-87,   Method: Composition-based stats.
 Identities = 161/471 (34%), Positives = 264/471 (56%), Gaps = 23/471 (4%)

Query: 12  MSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLV 71
           M++ L  + P +A      EA   V +   V++   +++++G  + I+L    +V+DVLV
Sbjct: 1   MALTLTVTAPQLATAQTNFEATVEVTSQHSVKV---RQLNVGEGRSIVLNTNEEVRDVLV 57

Query: 72  SDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFI 131
           S+P  AD VV +   +++FG   GQA+++L G+ GKQ+ + ++ ++ D + L   ++R +
Sbjct: 58  SNPKIADAVVRTRNRVFVFGNETGQASLVLFGNGGKQLASFNLNVQPDPSGLIELIQRLL 117

Query: 132 ADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIA 191
            +S I  ++V+++VVL G   +  ++Q+A +++  F+             KK++N + +A
Sbjct: 118 PNSAINADIVNESVVLSGTAISALEAQQAYDIALKFVGND---------DKKIVNTIAVA 168

Query: 192 GEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFG---GKFVSEGGDFSVK 248
            +DQV LKVT+AEV R  +KQ+G       S       F           V   G F  +
Sbjct: 169 EKDQVQLKVTVAEVERTTIKQLGVSLQGALSIGALDVKFNTSPAYNINPSVVNAGLFQGQ 228

Query: 249 GVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVT 308
             +   S    + ALER   ++TLAEPTL A+SG++ASF +GG+             S+ 
Sbjct: 229 LPIGGGSIVPTIKALERDGVMKTLAEPTLVAVSGENASFLAGGEFPIPVAYEDN-KISLE 287

Query: 309 THDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGDMPSYRV-----RKADTTVELP 363
              +GV L FTP VLS GRI LRI+TEVSE           +  V     R+A++T+ELP
Sbjct: 288 FKPFGVGLDFTPVVLSEGRIKLRIKTEVSELSSEGAVNLAGAISVSALKVRRAESTLELP 347

Query: 364 SGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVA 423
           SGGT+V+AGLLK +  Q  +GIP L  +PILG +F++  +  ++TE+ I  TP++V+PVA
Sbjct: 348 SGGTLVMAGLLKHNYGQEIDGIPGLKDVPILGTMFKSRDYINKQTELVIFVTPYVVRPVA 407

Query: 424 MRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
              ++RPDD+++   D    F N++++IY   +A      +Y G IG+IY+
Sbjct: 408 RSQIARPDDNFAAPSDQSTIFLNQLSRIYRSTDAPV--KGSYHGKIGYIYE 456


>gi|27375777|ref|NP_767306.1| hypothetical protein bll0666 [Bradyrhizobium japonicum USDA 110]
 gi|27348915|dbj|BAC45931.1| bll0666 [Bradyrhizobium japonicum USDA 110]
          Length = 505

 Score =  326 bits (836), Expect = 5e-87,   Method: Composition-based stats.
 Identities = 161/503 (32%), Positives = 262/503 (52%), Gaps = 45/503 (8%)

Query: 3   YLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVI---------NISDVEIGKGKKISIG 53
              RTF+    + L                              ++  +   K + +S+G
Sbjct: 15  NRARTFWAGAMLTLGLLAAPGLVSAAEAPVGDQAPLQAPDLGVASVGTIAPAKTRFLSLG 74

Query: 54  LNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLD 113
           + K +++ +P +V+DVLV+DP  A+ V+ S +  Y+ G  VGQ NV+    DG+Q+   D
Sbjct: 75  VGKSVVIDLPREVKDVLVADPKIANAVIRSAQRAYIIGGQVGQTNVVFFTADGQQVAAYD 134

Query: 114 ILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGR 173
           I ++RD+  +   LR+ +    +++E + D+V+L G V +  ++Q+A E++   +     
Sbjct: 135 IAVKRDLNGMRAALRQSLPG--VQIEGIGDSVMLTGSVSSPVEAQQAGEVAAKLVGG--- 189

Query: 174 NQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAAD 233
                  S+KV+N + + G DQV LKV + EVRRDI+KQ+G   S + ++     +F   
Sbjct: 190 -------SEKVVNNIVVRGRDQVMLKVVVGEVRRDIVKQLGVDLSASLNAGTAVVNFNNS 242

Query: 234 -----FGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFT 288
                 GG  VS  G           +    + A+E A  +RTLAEP+LTAISG+SA+F 
Sbjct: 243 NPFSVSGGPLVSSNGLGVTGLAKGVATVNATMRAMETAGVMRTLAEPSLTAISGESATFI 302

Query: 289 SGGQHLYKTVSSSTGATSV-----TTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIG- 342
           +GG+       +    T V     T   +G+ L+FTP VLS GRI LR+ TEVSE     
Sbjct: 303 AGGEFPIPGGYACDPVTHVCTTQITYKKFGISLNFTPVVLSEGRISLRVMTEVSELSNQN 362

Query: 343 ------------VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSK 390
                        ++  +PS + R+A+TT+E+PSGG++ +AGL++   +Q   G+P + +
Sbjct: 363 AISVTQAVSASQTSSVTIPSIQTRRAETTLEIPSGGSMAMAGLIQQQTKQAINGLPGVDQ 422

Query: 391 IPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNK 450
           +PI+GALFR+  F   ETE+ +  TP++V+ VA ++LSRPDD ++   DA+     R+N+
Sbjct: 423 VPIIGALFRSQDFVNNETELMVIVTPYVVRAVAQKELSRPDDGFAPASDAQTALLGRMNR 482

Query: 451 IYGPKEASEVEGQNYKGAIGFIY 473
           +YG            +G  GFI 
Sbjct: 483 LYGI-ARRVDPIDGARGDFGFII 504


>gi|114568970|ref|YP_755650.1| type II and III secretion system protein [Maricaulis maris MCS10]
 gi|114339432|gb|ABI64712.1| type II and III secretion system protein [Maricaulis maris MCS10]
          Length = 491

 Score =  325 bits (833), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 147/502 (29%), Positives = 257/502 (51%), Gaps = 39/502 (7%)

Query: 1   MRYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGK-GKKISIGLNKVII 59
           MR        ++   L  + P  A+    +  N   + I +   G   + + + L+K  +
Sbjct: 1   MRTEMMIRTLLLLASLAMAAPVAAQPAGTERGNTMQVYIREPGNGPVSETLDLPLSKAAV 60

Query: 60  LQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERD 119
           + +PVDV DVLV++P   + +V +PR  Y+ G  +GQ N      +G+ +L+LD+ +ERD
Sbjct: 61  VHLPVDVADVLVTNPAVVEAIVRTPRRAYIMGMGIGQTNAFFFDANGQLILDLDLRVERD 120

Query: 120 IAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANS 179
           ++ L+ ++ RF+ ++ I VE ++D +VL G   +  D+  A+ +++ ++           
Sbjct: 121 LSPLQESIDRFLPNARIEVEAMNDHIVLSGRAPSASDADAALRIAQRWVDN--------- 171

Query: 180 SSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFG---- 235
               +++++++   +QV L+V I E++R I++Q+G   S  G++       +        
Sbjct: 172 -PDNILSMISVEAREQVMLRVRIVEMQRTIVRQLGVNLSTAGTTGEFGFGVSTSPDFSRV 230

Query: 236 ---GKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQ 292
                  S   D+         S   +L A+ER   +RTLAEP LTAI+G+SA+F +GG+
Sbjct: 231 GRFLGGTSAMLDWVSGNTGGVESVSAMLQAMERVGLVRTLAEPNLTAITGESANFLAGGE 290

Query: 293 HLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVN-------- 344
                     G   +    +GV L FTP VLS GRI LRI TEVSE     +        
Sbjct: 291 FPVPVGRDRDGNIIIEYKPFGVGLGFTPVVLSEGRISLRISTEVSELTSQGSLTFQSNNV 350

Query: 345 ------------AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIP 392
                          +P+  V +A+TTVELPSGG++VLAGL++++ +Q  +G+P +  +P
Sbjct: 351 LDDDGNVIGTVPGLTIPALNVNRAETTVELPSGGSLVLAGLIQEETRQNLDGVPGVQNLP 410

Query: 393 ILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIY 452
           +LG+LFR+  +  +ETE+ +  TP+LV P     L  P D +    +A    F R+N+ Y
Sbjct: 411 VLGSLFRSRDYENQETELVVLVTPYLVDPTNPNQLQTPADGFRNASEASGLLFGRINRAY 470

Query: 453 GPKEASEVEGQNYKGAIGFIYK 474
               +   + + + G +GF+++
Sbjct: 471 SVPGSDTGD-RGWSGPVGFLFE 491


>gi|323499921|ref|ZP_08104880.1| pilus assembly protein CpaC [Vibrio sinaloensis DSM 21326]
 gi|323315162|gb|EGA68214.1| pilus assembly protein CpaC [Vibrio sinaloensis DSM 21326]
          Length = 487

 Score =  325 bits (832), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 115/453 (25%), Positives = 201/453 (44%), Gaps = 30/453 (6%)

Query: 39  ISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQAN 98
            +      GK + +  +K   + +    + V + DP   D+V+     ++L GK +G  N
Sbjct: 17  SAVSATQSGKIVKVPHHKSTHVTLAAKAKRVSLGDPEVLDIVMLKSDEVFLIGKKLGSTN 76

Query: 99  VILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQ 158
           ++     G+ + +++I +  D+  L+  L  F+ +  I V    + ++L G +       
Sbjct: 77  LMAWDSRGRLIESINIEVTHDLNSLKAKLYEFLPNEEIEVHSAQNRLILSGQISNQAAMN 136

Query: 159 RAVELSETFLSQSGRNQYANSSSKKV-----MNLLNIAGEDQVTLKVTIAEVRRDILKQI 213
           +A+ ++ET+ +    ++   S S++V     +NL+ I G  QV L+VT+AEV+R ++++ 
Sbjct: 137 KALRVAETYSAGQEADKENRSLSEQVQKTGVINLMTIGGAQQVMLEVTVAEVQRSLVRKF 196

Query: 214 GFQHSITGSSSGPSKSFAADFGGKFVSEGG-------------DFSVKGVLDRFSFETVL 260
                   S+   S    +         GG              F    +     F   L
Sbjct: 197 DSNFHFFESNGNFSWGGTSAGAIIDDVNGGIGPIFNAPGIDNTGFLGTFIDGDTLFTFAL 256

Query: 261 HALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTP 320
              ++  + + LAEP LTA+SG  A F +GG+             ++   +YGV L F P
Sbjct: 257 DIAKQNGSAKVLAEPNLTALSGAKAEFLAGGEFPIPVP--DDDGITIEYKEYGVGLKFIP 314

Query: 321 TVLSPGRIGLRIQTEVSEPVI----------GVNAGDMPSYRVRKADTTVELPSGGTIVL 370
           TVLS   I L +  +VSE                   +P    R A +T+EL  G TI +
Sbjct: 315 TVLSDKHINLNLAIDVSEIANSATLTLNPGGTNGTYVIPPITRRSASSTLELADGQTIGI 374

Query: 371 AGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRP 430
           AGLL ++++ +  G+P  S IP+LG +F +  +   ETE+ I  TP L KP+    +S P
Sbjct: 375 AGLLSENVRDVVSGVPGFSDIPVLGQMFNSQEYISGETELVILVTPRLAKPIDRSKVSLP 434

Query: 431 DDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQ 463
            D +   +D + +   R   I    ++   E Q
Sbjct: 435 TDSFVEPNDFEYYLLGRGAYIAPTGKSKSNESQ 467


>gi|296444395|ref|ZP_06886360.1| type II and III secretion system protein [Methylosinus
           trichosporium OB3b]
 gi|296258042|gb|EFH05104.1| type II and III secretion system protein [Methylosinus
           trichosporium OB3b]
          Length = 485

 Score =  324 bits (831), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 165/487 (33%), Positives = 251/487 (51%), Gaps = 19/487 (3%)

Query: 1   MRYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIIL 60
           M   +R     ++  L       A   P   A  +    SD +    +++++G+ K II+
Sbjct: 1   MSGSRRHLIPTLATAL---ALVGAGSLPAVAAPQSWGVESDSDAIMSRRVAMGVGKSIIV 57

Query: 61  QVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDI 120
            +P D  +++V +P  A+ VV S R +Y+ G   GQ  +  +   G+Q+ NL+I I RD+
Sbjct: 58  DLPADAAEIVVGNPKVANAVVRSTRKLYIMGVETGQTTIFALDRSGRQIANLEISIGRDV 117

Query: 121 AHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYAN-- 178
             L   L   + +SNI    V+D ++L G V +  ++QRAV++++ F ++S      +  
Sbjct: 118 GELGPLLHAALPNSNISARTVNDAIILTGTVDSASEAQRAVDIAKGFAARSASASAQSAG 177

Query: 179 --SSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSG-PSKSFAADFG 235
              +   V+N L I  +DQV LKVT+AEV R +LKQ+G      G +             
Sbjct: 178 GSPADGLVVNALVIRTQDQVMLKVTVAEVERRVLKQLGISAQSGGETLLKGGWGQLVQQN 237

Query: 236 GKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLY 295
              V+     S   +         L A ER    R LAEPT+TAISG+SA FT GG+   
Sbjct: 238 PFAVNSALTASSLTINGNNGSTATLQAYERYGVSRVLAEPTVTAISGESAKFTVGGEIAV 297

Query: 296 KTVSSST------GATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGV----NA 345
              SS         +  +    YGV L+FTP VL+ GRI L + TEV+E         N 
Sbjct: 298 PGNSSCIAGSTLCSSVGIVFKPYGVSLNFTPVVLAQGRILLHLATEVTEIDYQAAQAYNG 357

Query: 346 GDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNR 405
             +P ++ RK +T+VELPSGG+I  AGLL     Q   G+P L  +P+LGALFR+  + R
Sbjct: 358 VTVPGFKTRKNETSVELPSGGSIATAGLLTQKSDQAINGLPGLINLPVLGALFRSRDYQR 417

Query: 406 EETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNY 465
            ETE+ I  TP++ + ++ RD++RPDD ++   D +A+   RVN++Y   +  +   Q  
Sbjct: 418 NETELLIVVTPYIARALSARDVTRPDDGFADASDPQAWLLGRVNRLYANPQHPQAAPQ-L 476

Query: 466 KGAIGFI 472
           KG IGFI
Sbjct: 477 KGRIGFI 483


>gi|303248302|ref|ZP_07334564.1| type II and III secretion system protein [Desulfovibrio
           fructosovorans JJ]
 gi|302490327|gb|EFL50239.1| type II and III secretion system protein [Desulfovibrio
           fructosovorans JJ]
          Length = 528

 Score =  324 bits (830), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 132/503 (26%), Positives = 219/503 (43%), Gaps = 75/503 (14%)

Query: 26  LPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPR 85
                 + AA   +  V +    ++S+ + K +ILQ   DV  V V+ P  AD V+ SPR
Sbjct: 20  CGMATLSYAAPGRMGTVAVRTAPRLSLTIGKSVILQSDADVSRVSVAQPEIADFVLLSPR 79

Query: 86  TMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDT 144
            +Y+ G+  G  N+ L     K     D+ +  DI+ L+  L   +     I V    D+
Sbjct: 80  QIYVTGRAPGITNLTLWDKGDKVRAVYDLDVAPDISRLKKMLHDVMPGESGIEVMSSQDS 139

Query: 145 VVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAE 204
           + L G VR   + ++A+ L+E +            + KKV+NLL++ G  QV L+V +AE
Sbjct: 140 IALSGTVRDSANMKKALALAEVY------------APKKVLNLLSVGGVQQVMLEVRVAE 187

Query: 205 VRRDILKQIGFQHSITGSSSGPSK----------------------------SFAADFGG 236
           + + ++ ++G   +  G  +                                + + D   
Sbjct: 188 MSKSLVNRMGINLNAVGDGNFAYTLIGSLSSVASGMFDTYYPQNAYQYITMTANSGDGNS 247

Query: 237 KFVSEGGDF--------------------------SVKGVLDRFSFETVLHALERATAIR 270
            F S                               +  G     +   V+  L++   ++
Sbjct: 248 SFDSTPIQLAYREFNQPSSKATMSFNQGTAVARWNTNFGGAGNTAMTAVVDMLKQNGLVK 307

Query: 271 TLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGL 330
            LAEP L  ++GQSA F +GGQ     VSS  G TS+    +GV L+FTPTV++  RI L
Sbjct: 308 ILAEPNLVCLNGQSADFLAGGQIPVP-VSSGLGTTSIEWKKFGVQLNFTPTVVAGDRINL 366

Query: 331 RIQTEVSEPVIGVN----AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIP 386
           ++  EVS              +P+   R+  TT+EL +G T  +AG+L +  +   +  P
Sbjct: 367 KVNPEVSNLDYTRAITLLGSTVPAINTRQTSTTIELKNGQTFAIAGMLNEQSRDSMDKYP 426

Query: 387 LLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFN 446
           +L  IP+LGALF++S++ +++TE+ I  T  LVKP+  + +S P D     DD + F   
Sbjct: 427 VLGDIPVLGALFKSSQYQKDQTELVILITAHLVKPLDKKAISLPTDSAHEPDDLEFFLG- 485

Query: 447 RVNKIYGPKEASEVEGQNYKGAI 469
                    +A   +GQ+     
Sbjct: 486 --ISRDAKSDAGAAQGQSLSTPA 506


>gi|218887827|ref|YP_002437148.1| type II and III secretion system protein [Desulfovibrio vulgaris
           str. 'Miyazaki F']
 gi|218758781|gb|ACL09680.1| type II and III secretion system protein [Desulfovibrio vulgaris
           str. 'Miyazaki F']
          Length = 493

 Score =  324 bits (829), Expect = 3e-86,   Method: Composition-based stats.
 Identities = 127/478 (26%), Positives = 211/478 (44%), Gaps = 40/478 (8%)

Query: 23  VAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVH 82
            A    +                  + + + + K ++++       V +SD   A VVV 
Sbjct: 20  AAACAVLATVLLLAAAAQAQADATPQAVPLAVGKSMVVRTAQPAARVSMSDEAIAGVVVL 79

Query: 83  SPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADS-NIRVEMV 141
           SP+ +Y+ GK  G A + L    G      DI +  D+A L+  L R + D  +I V  V
Sbjct: 80  SPQQVYVTGKKAGGATLTLWNGAGAITQVYDIQVTPDLAQLKEMLHRVLPDEKDIMVMAV 139

Query: 142 SDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVT 201
            +++ L G VR+      A+++++ +            +  KV NL+ + G  QV L+V 
Sbjct: 140 GESITLAGTVRSAAGMTTALDVAKMY------------APDKVTNLMQVGGVHQVLLEVK 187

Query: 202 IAEVRRDILKQIGFQHSITGSSSGPS-------------KSFAADFGGKFVSEGGDFSVK 248
           +AE+R+ +L+++G   +   ++                         G  VS       +
Sbjct: 188 VAEMRKSVLERLGIDLTYAWNNDFAFGMLNQLFTLDSQKGVVGVGPTGAVVSPNVTGMFR 247

Query: 249 GVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVT 308
               R S    L  L++   ++ LAEPTL   SG++A F +GG+     V    G  ++ 
Sbjct: 248 ATSGRASLMGFLDVLKQNGLVKVLAEPTLICRSGENADFLAGGEIPIP-VPQGLGTVAIE 306

Query: 309 THDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKADTTVELPS 364
              YGV L FTPTV+S   I +R+  EVSE     VI +N   +P+   R+A TTVEL  
Sbjct: 307 FKKYGVTLGFTPTVVSDKLISMRVSPEVSELDYSNVIEINGFTIPAISTRRAATTVELAD 366

Query: 365 GGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAM 424
           G +  +AGLL+D++++  +  P+L  +P+LG LFR+S + + ETE+ I  TP L KP+  
Sbjct: 367 GQSFAVAGLLRDEVRENIKKYPVLGDVPLLGTLFRSSNWQKNETELVIIVTPRLAKPLDG 426

Query: 425 RDLSRPDDHYSVEDDAKAFFFNRVNK---------IYGPKEASEVEGQNYKGAIGFIY 473
                P D +    + + F   ++            Y     S       +G  G + 
Sbjct: 427 ATAKLPTDGFREPSEFEFFLQGKMEGAAPAITAPAAYANPRNSADAPSGMEGEFGHVL 484


>gi|218710406|ref|YP_002418027.1| Flp pilus assembly protein [Vibrio splendidus LGP32]
 gi|218323425|emb|CAV19602.1| Flp pilus assembly protein [Vibrio splendidus LGP32]
          Length = 484

 Score =  323 bits (828), Expect = 3e-86,   Method: Composition-based stats.
 Identities = 118/455 (25%), Positives = 206/455 (45%), Gaps = 27/455 (5%)

Query: 38  NISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQA 97
            +S   +  GK +++  +K   + +      V + DP   D+V+     ++L GK +G  
Sbjct: 16  TLSFAALQTGKTVTVPHHKSTHVVLSGKASKVSLGDPDVLDIVMLKSSELFLIGKKLGAT 75

Query: 98  NVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDS 157
           N++     G+ + +++I +  D+  L+  L  F+ D  I V    + ++L G V   Q  
Sbjct: 76  NLMAWDSRGQLIESINIEVTHDLNSLKAKLYEFLPDETIEVHSAQNRLLLSGQVSNQQQM 135

Query: 158 QRAVELSETFLSQSGRNQYANSSSKK-----VMNLLNIAGEDQVTLKVTIAEVRRDILKQ 212
             A+ ++ET+ S    ++   S S++     V+NL++I G  QV L+VT+AEV+R ++++
Sbjct: 136 NVAMRIAETYSSGETADESKESGSEQAAATGVINLMSIGGAQQVMLEVTVAEVQRSLVRK 195

Query: 213 IGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLD----------RFSFETVLHA 262
                    +S       A+      +     F +    D             F   L  
Sbjct: 196 FDANFHFFQTSGSNISWGASSVPAGVLGATPIFDIPTSTDYGILGSFIDSNTLFTFALDV 255

Query: 263 LERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTV 322
            ++    + LAEP LTA+SG  A F +GG+             ++   +YGV L F PTV
Sbjct: 256 AKQNGVAKVLAEPNLTALSGSKAEFLAGGEFPIPVPDEDG--ITIEYKEYGVGLKFIPTV 313

Query: 323 LSPGRIGLRIQTEVS----------EPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAG 372
           LS  +I L +  +VS          +P        +P    R A +T+EL  G TI +AG
Sbjct: 314 LSDKKINLNLAVDVSEIANSSSLTIDPGTTNATYFIPPITRRSASSTLELADGQTIGIAG 373

Query: 373 LLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDD 432
           LL ++++ +   +P +  +PILG LF +  +   ETE+ I  TP L  P+    ++ P D
Sbjct: 374 LLSENVRDVSNKMPGIGDVPILGQLFNSQEYVSGETELVILVTPRLASPIDRSKVTLPTD 433

Query: 433 HYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKG 467
            +   +D + +   R   I  P E+   + Q  +G
Sbjct: 434 AFVDPNDLEYYLLGRSAYIAEPSESDSEQSQASQG 468


>gi|323137425|ref|ZP_08072503.1| type II and III secretion system protein [Methylocystis sp. ATCC
           49242]
 gi|322397412|gb|EFX99935.1| type II and III secretion system protein [Methylocystis sp. ATCC
           49242]
          Length = 504

 Score =  323 bits (828), Expect = 3e-86,   Method: Composition-based stats.
 Identities = 163/503 (32%), Positives = 253/503 (50%), Gaps = 35/503 (6%)

Query: 4   LQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGK-GKKISIGLNKVIILQV 62
           + R    ++     +   + A       A    + +   +     ++IS+G+ K II+ +
Sbjct: 1   MSRLMQNVIGAVWATVAVATATGIAPAHAQGPGVGVESGDNAMLARRISMGVGKSIIVDL 60

Query: 63  PVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAH 122
           P D  +V+V +P  AD +V S R +Y+ G + GQ  +  +   G+Q+ NL+I I RD+  
Sbjct: 61  PRDATEVVVGNPKVADAIVRSARKLYIMGMDAGQTTIFAVDSSGRQVANLEISIGRDVGE 120

Query: 123 LEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQS----------- 171
           L   L+  +  SNI    V+D ++L G V +  ++ RAV++++ F S++           
Sbjct: 121 LAPLLKAALPKSNITARTVNDIIILTGTVSSAGEALRAVDIAKGFASRAMGGGAGGGGGV 180

Query: 172 -------GRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSS 224
                         S+   V+N L I GE+QV LKVT+AEV R ++KQ+GF     G + 
Sbjct: 181 AGQASNSQVGGVGGSADGNVINALTIRGEEQVMLKVTVAEVERKVIKQLGFSAQAGGETI 240

Query: 225 -GPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQ 283
              S           ++     S   +    +    L A ER    R LAEPT+TA+SG+
Sbjct: 241 LNGSWGKLVQENPFAINPTMSNSALIINGPNNTNATLKAFERYGVSRILAEPTVTAVSGE 300

Query: 284 SASFTSGGQHLYKTVSSSTGATS----------VTTHDYGVVLHFTPTVLSPGRIGLRIQ 333
           +A    GG+       S T  T+          +T   YGV L+F P VLS GRI L + 
Sbjct: 301 AAKMLVGGEIAVPGSGSCTFFTNGGGQPICSPGITFKSYGVSLNFVPIVLSEGRIHLHLA 360

Query: 334 TEVSEPVIGVN----AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLS 389
            EV+E  +          +P ++ RK +T+VELPSGG+I  AGLL     Q   G+P L 
Sbjct: 361 AEVTEVDLQNTFTYANVAVPGFKTRKNETSVELPSGGSIATAGLLTQKSSQAISGLPGLL 420

Query: 390 KIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVN 449
            +PILGALFR+  + R ETE+ +  TP++V+P++ +D+SRPDD ++   D + +   RVN
Sbjct: 421 NLPILGALFRSRDYLRNETELLVIVTPYIVRPLSAQDVSRPDDGFADASDPQGWLLGRVN 480

Query: 450 KIYGPKEASEVEGQNYKGAIGFI 472
           +IY     +    QN+KG IGFI
Sbjct: 481 RIY-STRNNPQLMQNFKGRIGFI 502


>gi|307294424|ref|ZP_07574268.1| type II and III secretion system protein [Sphingobium
           chlorophenolicum L-1]
 gi|306880575|gb|EFN11792.1| type II and III secretion system protein [Sphingobium
           chlorophenolicum L-1]
          Length = 503

 Score =  323 bits (828), Expect = 4e-86,   Method: Composition-based stats.
 Identities = 133/481 (27%), Positives = 214/481 (44%), Gaps = 45/481 (9%)

Query: 12  MSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLV 71
           M   L + +   + LP   +A A + +++        ++ + LNK  +L         LV
Sbjct: 9   MLASLLTLSAGASLLPI--QAQAQIASLNLSNANHAGQLDVPLNKSQVLTADRPFAKALV 66

Query: 72  SDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFI 131
            +   ADV+  + R++Y+ GK +G  ++ L       +  +D+ +  D+  L+  L   +
Sbjct: 67  GNAEIADVLPMTNRSVYVLGKKMGTTSLTLYDSRNIMIAVVDVAVGPDVVTLKRQLSDLL 126

Query: 132 ADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIA 191
               I   + +D+VVL G + +     RAV++++T+               KV+N++++ 
Sbjct: 127 PGQPIGARISNDSVVLTGTLSSAAAVDRAVQIAKTYAG------------DKVVNMMSVG 174

Query: 192 GEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGK-------------- 237
              QV L+V  +E+ R   KQ G   +    S                            
Sbjct: 175 ASQQVMLEVRFSEMSRGAAKQFGINTAFLSDSGKVVGGIGNAAQSSAILSDTNGRPIVDL 234

Query: 238 --FVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLY 295
              +   G  +    +   +  T L ALER   + TLAEPTL A+SG++ASF +GG+   
Sbjct: 235 SKILDSFGIGAANFSIGSLNITTALDALERKGVVTTLAEPTLVALSGETASFLAGGEFPI 294

Query: 296 KTVSSSTGAT-----------SVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEP----V 340
               S++G             ++    +GV L FTPTVL  G I L ++ EVS       
Sbjct: 295 PVAQSNSGGGGGGGGNSGNAITIEFKPFGVSLGFTPTVLDDGIINLVVEPEVSSIDPSAS 354

Query: 341 IGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRN 400
           + VN   +P  + R+A TT+EL  G +  LAGLL+ D Q      P+L  IPI+GALFR+
Sbjct: 355 VTVNGLTIPGLQTRRASTTLELRDGQSFALAGLLRKDFQDTVRQFPILGSIPIIGALFRS 414

Query: 401 SRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEV 460
           S F + ETE+ I  TP LVKP+   D++ P D      +   F   R +K  G       
Sbjct: 415 SGFQKSETELVIIVTPRLVKPMRAEDVALPTDRVKPPHELDLFLMGRTDKAVGINPLDPN 474

Query: 461 E 461
            
Sbjct: 475 A 475


>gi|292491519|ref|YP_003526958.1| type II and III secretion system protein [Nitrosococcus halophilus
           Nc4]
 gi|291580114|gb|ADE14571.1| type II and III secretion system protein [Nitrosococcus halophilus
           Nc4]
          Length = 565

 Score =  323 bits (827), Expect = 4e-86,   Method: Composition-based stats.
 Identities = 127/544 (23%), Positives = 220/544 (40%), Gaps = 80/544 (14%)

Query: 5   QRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVE-----IGKGKKISIGLNKVII 59
           +RT+ + +  FL  +      L  +  A  + +     E             + L K  +
Sbjct: 13  RRTWLSGILFFLVINIIVFFSLTSLALAQTSPLTPRQSENLIIQSDIEGDFQVPLYKSGV 72

Query: 60  LQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERD 119
           +++    + + V +P  AD+++   R +Y+ GK +G  NV++   + +   + +I +  D
Sbjct: 73  IELEERAKRISVGNPGIADILMLHSRQLYVVGKALGTTNVVVWDKNERVFASFNIEVVHD 132

Query: 120 IAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLS---------- 169
           +  L+  L R +    I V    + ++L G V ++   + A +L++ FL           
Sbjct: 133 LDTLKRKLHRLLPGEVIEVHSAQERIILSGQVSSVVKMKAAEDLAQGFLPECISAESNVL 192

Query: 170 -------------------QSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDIL 210
                               +            V+NL+ + G  QV L++ +AE+ R +L
Sbjct: 193 VRDTTQGTPIIIQQGDGGRGASGANQEGCKKGSVVNLMQVGGAHQVMLEIKVAEIARTVL 252

Query: 211 KQIGFQH---SITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFS------------ 255
           K+        S        + S  A F       G +  + G L+               
Sbjct: 253 KRFDSNFNVFSFDSPWKFGANSGGASFPNALTPSGNEVPILGSLNGEDSPIGPVVDLFQP 312

Query: 256 --------------------FETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLY 295
                                E VL A  +    + LAEPTLT ++GQ A F SGG+   
Sbjct: 313 NTPGIQDKGVFLSYLSSKFFLEAVLEASRQKGLAKVLAEPTLTTLTGQEAQFVSGGEFPI 372

Query: 296 KTVSSS-TGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVI----------GVN 344
               S  TG  ++   ++GV+++F P VL  GRI L++   VSE               N
Sbjct: 373 PVPQSGITGNVTIEFKEFGVIVNFLPLVLDSGRINLKLNVAVSELSQDVPVTLGVQGTEN 432

Query: 345 AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFN 404
              +PS   R A  TVEL  G TI +AGL+ D++++L   +P L  +PILGALFR+  F 
Sbjct: 433 TFVIPSLTKRSAKATVELADGQTIGIAGLINDNLRELVTKLPGLGDVPILGALFRSQEFM 492

Query: 405 REETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQN 464
             +TE+ +  TP L +P++ + +  P D +    D + +   R+        +   +G  
Sbjct: 493 SGQTELVMFVTPHLARPISPQQVKLPTDSFVPPTDLEFYLMGRMEAREMSNSSPSSQGII 552

Query: 465 YKGA 468
             G 
Sbjct: 553 DIGP 556


>gi|218680971|ref|ZP_03528868.1| putative pilus assembly protein [Rhizobium etli CIAT 894]
          Length = 434

 Score =  323 bits (827), Expect = 5e-86,   Method: Composition-based stats.
 Identities = 214/438 (48%), Positives = 288/438 (65%), Gaps = 25/438 (5%)

Query: 52  IGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLN 111
           +GLNK +++ +P D  D+LVSDPT AD V  + R +YLFGK VGQ N+ + G  G++++N
Sbjct: 2   LGLNKAVVVDLPEDAHDILVSDPTMADAVTRTSRRIYLFGKKVGQTNIFVFGAGGQEIVN 61

Query: 112 LDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQS 171
           LDI IERD++ LE+ LRRFI DSNI VE+VSD +VL G VRT QD+ +A +L++ FL   
Sbjct: 62  LDIEIERDVSGLEVNLRRFIPDSNINVEIVSDNIVLTGTVRTPQDATQAADLAQVFLKGG 121

Query: 172 GRNQYANSS-----------------SKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIG 214
                  ++                 + +V+NLL I GEDQVTLKVTIAEVRR++LKQ+G
Sbjct: 122 EATTRTETASGTGGDSSVALFAEGRQASQVVNLLQIEGEDQVTLKVTIAEVRREVLKQLG 181

Query: 215 FQH---SITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRT 271
           F +   + +G +     S +AD     V  G     K  + ++   T L+ALE+A  ++T
Sbjct: 182 FDNLVSNSSGMTVAQLGSPSADSATSTVGGGLAALFKSTIGKYDISTYLNALEQAKVVKT 241

Query: 272 LAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLR 331
           LAEPTLTAISGQ+A+F SGGQ LY T   S G  +VT  +YG+ L F P VLS GRI L+
Sbjct: 242 LAEPTLTAISGQAATFNSGGQQLYSTT-DSDGNVTVTPFNYGINLAFKPVVLSSGRISLQ 300

Query: 332 IQTEVSEPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKI 391
           I+T VSEPV G        Y+ R A+T+VELPSGG+I LAGL++D++ Q   G P +SKI
Sbjct: 301 IKTNVSEPVAGSGNAT---YQRRSAETSVELPSGGSIALAGLIRDNVSQTMGGTPGVSKI 357

Query: 392 PILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKI 451
           P+LG LFR   F R+ETE+ I ATP+LV+PVA   L+RPDD++S E+D   FF NRVNK+
Sbjct: 358 PLLGTLFRQKGFERQETELVIIATPYLVRPVARNQLNRPDDNFSPENDGATFFLNRVNKV 417

Query: 452 YGPKEASEVEGQNYKGAI 469
           YG +EA   + Q + G+I
Sbjct: 418 YGRREAPVADAQ-FHGSI 434


>gi|315497465|ref|YP_004086269.1| type II and iii secretion system protein [Asticcacaulis excentricus
           CB 48]
 gi|315415477|gb|ADU12118.1| type II and III secretion system protein [Asticcacaulis excentricus
           CB 48]
          Length = 476

 Score =  322 bits (826), Expect = 6e-86,   Method: Composition-based stats.
 Identities = 142/467 (30%), Positives = 241/467 (51%), Gaps = 19/467 (4%)

Query: 17  FSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTK 76
            + +   A   P     + +   +     + + +++   +  ++ +PVD  DV VS+P  
Sbjct: 20  MAVSGVEAAPKPYSAPVSPMTVQTQTSGARTQVLNLAKGRSAVVDLPVDAADVFVSNPAV 79

Query: 77  ADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNI 136
           AD V+ +PR +++ G   GQ++ I     G+Q+LNL I +      L  T+++    S++
Sbjct: 80  ADAVLRTPRRIFVLGVAAGQSDAIFFDATGRQILNLQIRVGVSTDQLSDTVQKLYPQSDV 139

Query: 137 RVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQV 196
           +V+ V+  V+L G+V    +S+    LS  F  +           + ++N+L++AG+DQV
Sbjct: 140 QVQSVNGYVILSGVVANASESEAIQRLSVAFAEK----------PENIINMLSVAGKDQV 189

Query: 197 TLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSF 256
           +LKV I EV++  +KQ+GF  +     +G  +    +      +      +K        
Sbjct: 190 SLKVRIVEVQKSSIKQMGFNFNGLSGQTGEVQYALQNAPTYGTNGKALGGMKIGYADKLL 249

Query: 257 ETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVL 316
              L A ER   +RTLAEP L A+SG+SA F +GG+        + G  +V    YGV L
Sbjct: 250 SASLQAFERVGLVRTLAEPNLAAVSGESAKFLAGGEFPVPVAKDTQGRVTVEFKTYGVGL 309

Query: 317 HFTPTVLSPGRIGLRIQTEVSEPVIGVN-----AGDMPSYRVRKADTTVELPSGGTIVLA 371
            FTP VLS G I L++ TEVSE V   +        +P   VR+A+TTVELPSGG++++A
Sbjct: 310 GFTPVVLSNGTISLKLSTEVSEIVNTGSFSLDDTFTIPGLSVRRAETTVELPSGGSLMIA 369

Query: 372 GLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPD 431
           GLL+   +Q  + +P ++ IP+LGALFR+  F  E+TE+ +  TP+++   +      P 
Sbjct: 370 GLLQSKYKQSIDALPGMTTIPVLGALFRSRDFLDEQTEMVVIVTPYIISAKSPDAFQTPA 429

Query: 432 DHYSVEDDAKAFFFNRVNKI----YGPKEASEVEGQNYKGAIGFIYK 474
           D++ V  D ++ F  R+NK      G    +     +Y+  IG++ +
Sbjct: 430 DNFQVASDLESVFLGRLNKSVRAKRGEVAEAPPLAGSYQAPIGYVIE 476


>gi|254506750|ref|ZP_05118890.1| Flp pilus assembly protein, secretin CpaC [Vibrio parahaemolyticus
           16]
 gi|219550331|gb|EED27316.1| Flp pilus assembly protein, secretin CpaC [Vibrio parahaemolyticus
           16]
          Length = 487

 Score =  322 bits (824), Expect = 9e-86,   Method: Composition-based stats.
 Identities = 114/456 (25%), Positives = 204/456 (44%), Gaps = 30/456 (6%)

Query: 39  ISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQAN 98
            +      GK + +  +K   + +    + V + DP   D+V+     ++L GK +G  N
Sbjct: 17  SATAATQSGKIVKVPHHKSTHVTLAGKAKRVSLGDPEVLDIVMLKSDEVFLIGKKLGSTN 76

Query: 99  VILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQ 158
           ++     G+ + +++I +  D+  L+  L  F+ +  I+V    + ++L G + +     
Sbjct: 77  LMAWDRRGQLIESINIEVTHDLNSLKAKLYEFLPNEEIKVHSAQNRLILSGQISSQSAMN 136

Query: 159 RAVELSETFLSQSGRNQYANSSSKKV-----MNLLNIAGEDQVTLKVTIAEVRRDILKQI 213
            A+ ++ET+ +    ++   S S++V     +NL+ I G  QV L+VT+AEV+R ++++ 
Sbjct: 137 IALRVAETYSAGQEVDKENKSLSEQVQKTGVINLMTIGGAQQVMLEVTVAEVQRSLVRKF 196

Query: 214 GFQHSITGSSSGPSKSF----------AADFGGKFVSEG---GDFSVKGVLDRFSFETVL 260
                   S+   S                 G  F + G          +     F   L
Sbjct: 197 DSNFHFFESNGSFSWGGTSAGAIIDDVGGGIGPIFNTPGIDSTGLLGTFIDGDTLFTFAL 256

Query: 261 HALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTP 320
              ++    + LAEP LTA+SG  A F +GG+        +    ++   +YGV L F P
Sbjct: 257 DIAKQNGTAKVLAEPNLTALSGAKAEFLAGGEFPIPVPDENG--ITIEYKEYGVGLKFIP 314

Query: 321 TVLSPGRIGLRIQTEVSEPVIG----------VNAGDMPSYRVRKADTTVELPSGGTIVL 370
           TVLS   I L +  +VSE               +   +P    R A +T+EL  G TI +
Sbjct: 315 TVLSDKNINLNLAVDVSEIANTSSLTLSPGGTNSTYVIPPITRRSASSTLELADGQTIGI 374

Query: 371 AGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRP 430
           AGLL ++++ +  G+P  S IP+LG +F +  +   ETE+ I  TP L KP+    +S P
Sbjct: 375 AGLLSENVRDVVSGMPGFSDIPVLGQMFNSQEYISGETELVILVTPRLAKPIDRNRVSLP 434

Query: 431 DDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYK 466
            D +   +D + +   R   I    ++   + Q+  
Sbjct: 435 TDSFVEPNDFEYYLLGRGAYIAPSNQSRPQDVQDTN 470


>gi|260771478|ref|ZP_05880403.1| type II/IV secretion system secretin RcpA/CpaC associated with Flp
           pilus assembly [Vibrio furnissii CIP 102972]
 gi|260613604|gb|EEX38798.1| type II/IV secretion system secretin RcpA/CpaC associated with Flp
           pilus assembly [Vibrio furnissii CIP 102972]
 gi|315181060|gb|ADT87974.1| Flp pilus assembly protein, secretin CpaC [Vibrio furnissii NCTC
           11218]
          Length = 489

 Score =  321 bits (823), Expect = 2e-85,   Method: Composition-based stats.
 Identities = 114/453 (25%), Positives = 200/453 (44%), Gaps = 30/453 (6%)

Query: 40  SDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANV 99
                  GK +++  +K   +++      V + DP   D+V+     ++L GK +G  N+
Sbjct: 18  VYAANQSGKVVTVPHHKSTYVKLQGAASRVSLGDPEVLDIVMLKADELFLIGKRLGSTNL 77

Query: 100 ILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQR 159
           +     G+ + +++I +  D+  L+  L  F+ +  I V    + ++L G V + +    
Sbjct: 78  MAWDRRGQLLESINIEVTHDVNSLKAKLYEFLPNETISVHSAQNRLILSGQVSSQEKMNL 137

Query: 160 AVELSETFLSQSGRNQYANSSSK-----KVMNLLNIAGEDQVTLKVTIAEVRRDILKQIG 214
           A+ L+ET+ S    ++  +S +K      V+NL++I G  QV ++VT+AEV+R ++++  
Sbjct: 138 ALRLAETYASGDTADKATDSRNKEAEKTGVVNLMSIGGAQQVMIEVTVAEVQRSLVRRFD 197

Query: 215 FQHSITGSSSGPSKSFAADFG-------------GKFVSEGGDFSVKGVLDRFSFETVLH 261
                   +   S    +  G                  +        +     F   L 
Sbjct: 198 SNFHFFEGNGKFSWGATSAGGYIDDITGVAGPVFNAPTIDSTGLLSTFIDGDTLFTLALD 257

Query: 262 ALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPT 321
             +     + LAEP LTA+SG  A F +GG+      +      ++   +YGV L F PT
Sbjct: 258 VAKENGVAKVLAEPNLTALSGAKAEFLAGGEFPIPVPNRDG--ITIEYKEYGVGLKFIPT 315

Query: 322 VLSPGRIGLRIQTEVSE----------PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLA 371
           VLS  +I L +  +VSE          P     A  +P    R A +T+EL  G TI +A
Sbjct: 316 VLSDKKINLNLAVDVSEIASSTTLTVSPSGTNAAYYIPPITRRSAASTLELADGQTIGIA 375

Query: 372 GLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPD 431
           GLL ++++      P +  IP+LG LF +  +   ETE+ I  TP L KP+    +  P 
Sbjct: 376 GLLSENVRDSVSKFPGIGDIPVLGQLFNSQEYVSGETELVILVTPRLAKPIDRSKVVLPT 435

Query: 432 DHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQN 464
           D +    D K +   +   I GP++    +  +
Sbjct: 436 DAFVEPTDLKYYLLGQGAYIAGPRDVKRTKASD 468


>gi|51245387|ref|YP_065271.1| hypothetical protein DP1535 [Desulfotalea psychrophila LSv54]
 gi|50876424|emb|CAG36264.1| conserved hypothetical protein [Desulfotalea psychrophila LSv54]
          Length = 480

 Score =  320 bits (821), Expect = 2e-85,   Method: Composition-based stats.
 Identities = 126/490 (25%), Positives = 214/490 (43%), Gaps = 42/490 (8%)

Query: 8   FFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQ 67
           F  M+++ +      +   P   E+ A V+    +    G+ + + +N++  L+    ++
Sbjct: 7   FVRMLTVSICCLLV-MGGGPFAAESEATVL----INTKPGEPVQLTINRLAKLRSSEVIR 61

Query: 68  DVLVSDPTKADV---VVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLE 124
              + +P  A++      SP  +++ GK++G   + L G   K +   +I++  D+  L+
Sbjct: 62  RAHIVNPDIAELIYSKTQSPAWVFVSGKSIGTTQLTLWGARNKILGTFEIIVRPDVLGLK 121

Query: 125 MTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKV 184
             +       N+ V    D + L G V      Q+ + L+E +            +  KV
Sbjct: 122 KHIHDVFPGENVSVRDSGDFLTLTGTVAGAVRLQKILALAEAY------------APSKV 169

Query: 185 MNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVS---- 240
           +NLL + G  QV L+V IAE+ + +  Q+G    + GSS           G    +    
Sbjct: 170 INLLKVGGIQQVMLEVRIAEISKRVGNQLGINFGLDGSSGFGLSMLDGLSGLPGGTLPIE 229

Query: 241 --------EGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQ 292
                     G           S+   + AL+    ++ LA+PTL A SGQSASF +GG+
Sbjct: 230 PARVLDGLNIGSGVNAVFGKSGSYIVAIDALQEDGLVKVLAKPTLIAQSGQSASFLAGGE 289

Query: 293 HLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVN----AGDM 348
             +         + +    +GV L+FTPTVL  GRI L +  EVS+             +
Sbjct: 290 FPFPVAQQFDRFS-IEWKPFGVGLNFTPTVLGEGRISLLVSPEVSDLDFTNTISYAGYVV 348

Query: 349 PSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREET 408
           PS   R+  T VEL    +  +AGL+K++I++  +  PLL  IPILG LFR+S++ + ET
Sbjct: 349 PSIETRRMSTVVELNDNQSFAIAGLMKNNIRESIKKFPLLGDIPILGVLFRSSKYIKNET 408

Query: 409 EIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPK-----EASEVEGQ 463
           E+ +  TP LV PV   +LS P D +      +      +             A+     
Sbjct: 409 ELVVVVTPHLVTPVDGDELSLPTDSFVEPTAFELLVLGMLEGKEKQTYVENASATGANSL 468

Query: 464 NYKGAIGFIY 473
             +G  G+I 
Sbjct: 469 PLEGDFGYIV 478


>gi|258621447|ref|ZP_05716481.1| Flp pilus assembly protein [Vibrio mimicus VM573]
 gi|262171232|ref|ZP_06038910.1| type II/IV secretion system secretin RcpA/CpaC associated with Flp
           pilus assembly [Vibrio mimicus MB-451]
 gi|258586835|gb|EEW11550.1| Flp pilus assembly protein [Vibrio mimicus VM573]
 gi|261892308|gb|EEY38294.1| type II/IV secretion system secretin RcpA/CpaC associated with Flp
           pilus assembly [Vibrio mimicus MB-451]
          Length = 488

 Score =  320 bits (820), Expect = 3e-85,   Method: Composition-based stats.
 Identities = 111/436 (25%), Positives = 190/436 (43%), Gaps = 30/436 (6%)

Query: 39  ISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQAN 98
            +   I  GK +++  +K   + +    + V + DP   D+V+     ++L G+ +G  N
Sbjct: 17  TAQGAIQTGKVVTVPHHKSTFVVLSGKAKRVSLGDPQVLDIVMLKSDELFLIGRKLGSTN 76

Query: 99  VILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQ 158
           ++     G  + +L++ +  D+  L+  L   + D  I+V    + ++L GMV   +   
Sbjct: 77  LMAWDSRGNLIESLNVEVTHDLNSLKQKLYELLPDEPIQVHSAQNRLMLSGMVSNQEKMN 136

Query: 159 RAVELSETFLSQSGRNQYANS-----SSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQI 213
            A+ ++ET+ +    ++   S         V+NL+ I G  QV L+VT+AEV+R ++++ 
Sbjct: 137 IALRVAETYAAGQQADEATASLNSQVDKNGVINLMTIGGAQQVMLEVTVAEVQRSLVRRF 196

Query: 214 GFQHSITGSSSGPSKSFAADFG-------------GKFVSEGGDFSVKGVLDRFSFETVL 260
                    +   S    +  G                  E        +     F   L
Sbjct: 197 DSNFHFFEKNGNFSWGGTSAGGIIDDIGGVVGPVFNAPNIESTGLLGTFIDGDTLFTFAL 256

Query: 261 HALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTP 320
              +     + LAEP LTA+SG  A F +GG+             ++   +YGV L F P
Sbjct: 257 DIAKENGVAKVLAEPNLTALSGAKAEFLAGGEFPIPVPDKDG--VTIEYKEYGVGLKFIP 314

Query: 321 TVLSPGRIGLRIQTEVSEPV----------IGVNAGDMPSYRVRKADTTVELPSGGTIVL 370
           T+LS  RI L +  +VSE                +  +P    R A +T+EL  G TI +
Sbjct: 315 TILSDKRINLNLAVDVSEIASSNTLTLNPGTTNASYFIPPITRRSASSTLELADGQTIGI 374

Query: 371 AGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRP 430
           AGLL ++++ +   +P    IP+LG LFR+  +   ETE+ I  TP L KPV    ++ P
Sbjct: 375 AGLLSENVRDVTSKMPGFGDIPVLGQLFRSQNYISGETELVILVTPRLAKPVDRNKITLP 434

Query: 431 DDHYSVEDDAKAFFFN 446
            D +    D K +   
Sbjct: 435 TDAFVEPSDFKYYLLG 450


>gi|258627504|ref|ZP_05722285.1| Flp pilus assembly protein [Vibrio mimicus VM603]
 gi|258580310|gb|EEW05278.1| Flp pilus assembly protein [Vibrio mimicus VM603]
          Length = 488

 Score =  320 bits (819), Expect = 4e-85,   Method: Composition-based stats.
 Identities = 111/436 (25%), Positives = 190/436 (43%), Gaps = 30/436 (6%)

Query: 39  ISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQAN 98
            +   I  GK +++  +K   + +    + V + DP   D+V+     ++L G+ +G  N
Sbjct: 17  TAQGAIQTGKVVTVPHHKSTFVVLSGKAKRVSLGDPQVLDIVMLKSDELFLIGRKLGSTN 76

Query: 99  VILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQ 158
           ++     G  + +L++ +  D+  L+  L   + D  I+V    + ++L GMV   +   
Sbjct: 77  LMAWDSRGNLIESLNVEVTHDLNSLKQKLYELLPDEPIQVHSAQNRLMLSGMVSNQEKMN 136

Query: 159 RAVELSETFLSQSGRNQYANS-----SSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQI 213
            A+ ++ET+ +    ++   S         V+NL+ I G  QV L+VT+AEV+R ++++ 
Sbjct: 137 IALRVAETYAAGQQADEATASLNSQVDKNGVINLMTIGGAQQVMLEVTVAEVQRSLVRRF 196

Query: 214 GFQHSITGSSSGPSKSFAADFG-------------GKFVSEGGDFSVKGVLDRFSFETVL 260
                    +   S    +  G                  E        +     F   L
Sbjct: 197 DSNFHFFEKNGNFSWGGTSAGGIIDDIGGVVGPVFNAPNIESTGLLGTFIDGDTLFTFAL 256

Query: 261 HALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTP 320
              +     + LAEP LTA+SG  A F +GG+             ++   +YGV L F P
Sbjct: 257 DIAKENGVAKVLAEPNLTALSGAKAEFLAGGEFPIPVPDKDG--VTIEYKEYGVGLKFIP 314

Query: 321 TVLSPGRIGLRIQTEVSEPV----------IGVNAGDMPSYRVRKADTTVELPSGGTIVL 370
           T+LS  RI L +  +VSE                +  +P    R A +T+EL  G TI +
Sbjct: 315 TILSDKRINLNLAVDVSEIASSNTLTLNPGTTNASYFIPPITRRSASSTLELADGQTIGI 374

Query: 371 AGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRP 430
           AGLL ++++ +   +P    IP+LG LFR+  +   ETE+ I  TP L KPV    ++ P
Sbjct: 375 AGLLSENVRDVTSKMPGFGDIPVLGQLFRSQNYISGETELVILVTPRLAKPVDRNKITLP 434

Query: 431 DDHYSVEDDAKAFFFN 446
            D +    D K +   
Sbjct: 435 TDAFVEPSDFKYYLLG 450


>gi|262165919|ref|ZP_06033656.1| type II/IV secretion system secretin RcpA/CpaC associated with Flp
           pilus assembly [Vibrio mimicus VM223]
 gi|262025635|gb|EEY44303.1| type II/IV secretion system secretin RcpA/CpaC associated with Flp
           pilus assembly [Vibrio mimicus VM223]
          Length = 488

 Score =  320 bits (819), Expect = 4e-85,   Method: Composition-based stats.
 Identities = 111/436 (25%), Positives = 190/436 (43%), Gaps = 30/436 (6%)

Query: 39  ISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQAN 98
            +   I  GK +++  +K   + +    + V + DP   D+V+     ++L G+ +G  N
Sbjct: 17  TARGAIQTGKVVTVPHHKSTFVVLSGKAKRVSLGDPQVLDIVMLKSDELFLIGRKLGSTN 76

Query: 99  VILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQ 158
           ++     G  + +L++ +  D+  L+  L   + D  I+V    + ++L GMV   +   
Sbjct: 77  LMAWDSRGNLIESLNVEVTHDLNSLKQKLYELLPDEPIQVHSAQNRLMLSGMVSNQEKMN 136

Query: 159 RAVELSETFLSQSGRNQYANS-----SSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQI 213
            A+ ++ET+ +    ++   S         V+NL+ I G  QV L+VT+AEV+R ++++ 
Sbjct: 137 IALRVAETYAAGQQADEATASLNSQVDKNGVINLMTIGGAQQVMLEVTVAEVQRSLVRRF 196

Query: 214 GFQHSITGSSSGPSKSFAADFG-------------GKFVSEGGDFSVKGVLDRFSFETVL 260
                    +   S    +  G                  E        +     F   L
Sbjct: 197 DSNFHFFEKNGNFSWGGTSAGGIIDDIGGVVGPVFNAPNIESTGLLGTFIDGDTLFTFAL 256

Query: 261 HALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTP 320
              +     + LAEP LTA+SG  A F +GG+             ++   +YGV L F P
Sbjct: 257 DIAKENGVAKVLAEPNLTALSGAKAEFLAGGEFPIPVPDKDG--VTIEYKEYGVGLKFIP 314

Query: 321 TVLSPGRIGLRIQTEVSEPV----------IGVNAGDMPSYRVRKADTTVELPSGGTIVL 370
           T+LS  RI L +  +VSE                +  +P    R A +T+EL  G TI +
Sbjct: 315 TILSDKRINLNLAVDVSEIASSNTLTLNPGTTNASYFIPPITRRSASSTLELADGQTIGI 374

Query: 371 AGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRP 430
           AGLL ++++ +   +P    IP+LG LFR+  +   ETE+ I  TP L KPV    ++ P
Sbjct: 375 AGLLSENVRDVTSKMPGFGDIPVLGQLFRSQNYISGETELVILVTPRLAKPVDRNKITLP 434

Query: 431 DDHYSVEDDAKAFFFN 446
            D +    D K +   
Sbjct: 435 TDAFVEPSDFKYYLLG 450


>gi|86147467|ref|ZP_01065779.1| Flp pilus assembly protein [Vibrio sp. MED222]
 gi|85834760|gb|EAQ52906.1| Flp pilus assembly protein [Vibrio sp. MED222]
          Length = 485

 Score =  319 bits (818), Expect = 5e-85,   Method: Composition-based stats.
 Identities = 113/435 (25%), Positives = 197/435 (45%), Gaps = 27/435 (6%)

Query: 38  NISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQA 97
             S   +  GK +++  +K   + +      V + DP   D+V+     ++L GK +G  
Sbjct: 16  TASVAALQTGKTVTVPHHKSTHVVLSGKASKVSLGDPDVLDIVILKSNEVFLIGKKLGAT 75

Query: 98  NVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDS 157
           N++     G+ + +++I +  D+  L+  L  F+ D  I V    + ++L G +   Q  
Sbjct: 76  NLMAWDSRGQLIESINIEVTHDLNSLKSKLYEFLPDETIEVHSAQNRLLLSGQISNQQKM 135

Query: 158 QRAVELSETFLSQSGRNQYANSSSKKV-----MNLLNIAGEDQVTLKVTIAEVRRDILKQ 212
             A+ ++ET+ +    +    S S++V     +NL++I G  QV L+VT+AEV+R ++++
Sbjct: 136 NVAMRIAETYAAGQAADDSKESGSEQVAATGVINLMSIGGAQQVMLEVTVAEVQRSLVRK 195

Query: 213 IGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLD----------RFSFETVLHA 262
                    +S       A+      +     F +    D             F   L  
Sbjct: 196 FDANFHFFQTSGSNFSWGASSVPAGALGATPVFDIPTSTDYGILGSFIDSNTLFTFALDV 255

Query: 263 LERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTV 322
            ++    + LAEP LTA+SG  A F +GG+             ++   +YGV L F PTV
Sbjct: 256 AKQNGVAKVLAEPNLTALSGSKAEFLAGGEFPIPVPDEDG--ITIEYKEYGVGLKFIPTV 313

Query: 323 LSPGRIGLRIQTEVS----------EPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAG 372
           LS  +I L +  +VS          +P        +P    R A +T+EL  G TI +AG
Sbjct: 314 LSDKKINLNLAVDVSEIANSSSLTIDPGSTNATYFIPPITRRSASSTLELADGQTIGIAG 373

Query: 373 LLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDD 432
           LL ++++ +   +P +  +PILG LF +  +   ETE+ I  TP L KPV    ++ P D
Sbjct: 374 LLSENVRDVSNKMPGIGDVPILGQLFNSQEYVSGETELVILVTPRLAKPVDRSKVTLPTD 433

Query: 433 HYSVEDDAKAFFFNR 447
            +   +D + +   R
Sbjct: 434 AFVDPNDLEYYLLGR 448


>gi|239908021|ref|YP_002954762.1| bacterial type II and III secretion system protein family protein
           [Desulfovibrio magneticus RS-1]
 gi|239797887|dbj|BAH76876.1| bacterial type II and III secretion system protein family protein
           [Desulfovibrio magneticus RS-1]
          Length = 528

 Score =  319 bits (818), Expect = 5e-85,   Method: Composition-based stats.
 Identities = 124/502 (24%), Positives = 218/502 (43%), Gaps = 80/502 (15%)

Query: 2   RYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQ 61
           R      +        S   +         A      ++ V +    ++++ + K +ILQ
Sbjct: 4   RNCLPRLWARALAIALSLVLA-------APAQIVWGGVAPVAVRAAPRLALTIGKSVILQ 56

Query: 62  VPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIA 121
              D+  V V+ P  AD V+ SPR +Y+ G+  G  N+ L     K     D+ +  D +
Sbjct: 57  SDADIARVSVAQPDVADFVLLSPRQIYVTGRAPGITNLTLWDKGDKIRAVYDLDVAPDAS 116

Query: 122 HLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSS 180
            L+  L   +     I V    D++ L G VR  +  ++A+ L+E +            +
Sbjct: 117 RLKKMLHDVMPGETGIEVLASQDSIALSGTVRDAESLKKALSLAEVY------------A 164

Query: 181 SKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAAD------- 233
            KKV+NLL+++G  QV L+V +AE+ + ++ ++G   +  G  +                
Sbjct: 165 PKKVLNLLSVSGVQQVMLEVRVAEMSKSVVNRMGINLNAVGDGNFGYTLLGGLSTLADTV 224

Query: 234 ----------------FGGKFVSEGGDFSVK----------------------------- 248
                           F G   S   + +                               
Sbjct: 225 FNIDNVQNAYKYSTIKFNGSDGSSSTESATIQTRFREFNQPEQSKTVGLSQGTAAMRFST 284

Query: 249 --GVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATS 306
             G     +   VL  L++   ++ LAEP L  ++GQSA F +GG+     V S  G TS
Sbjct: 285 NWGGAGNTTMTAVLDLLKQNGLVKILAEPNLVCLNGQSAKFLAGGEIPVP-VPSGLGTTS 343

Query: 307 VTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIG----VNAGDMPSYRVRKADTTVEL 362
           +   ++GV L FTPT ++   I L++  EVS+        +++ ++P+   R+A T+VEL
Sbjct: 344 IEWKEFGVGLKFTPT-VAGEVISLQVNPEVSDLDYTRAIKLDSFEIPAVLTRRASTSVEL 402

Query: 363 PSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPV 422
            +G T  +AGLLK++ ++  +  P +  IP+LG LF++S + ++++E+ I  T  LVKP+
Sbjct: 403 KNGQTFAIAGLLKEEGRESVDKYPWIGDIPVLGNLFKSSSYQKDQSELVILITAHLVKPL 462

Query: 423 AMRDLSRPDDHYSVEDDAKAFF 444
             +D+  P D     DD + F 
Sbjct: 463 NKKDMILPTDGVHEPDDLEFFL 484


>gi|224824213|ref|ZP_03697321.1| type II and III secretion system protein [Lutiella nitroferrum
           2002]
 gi|224603632|gb|EEG09807.1| type II and III secretion system protein [Lutiella nitroferrum
           2002]
          Length = 520

 Score =  319 bits (818), Expect = 5e-85,   Method: Composition-based stats.
 Identities = 143/518 (27%), Positives = 232/518 (44%), Gaps = 68/518 (13%)

Query: 9   FTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQD 68
                + L +S    A   P + A           I     +++ + K   L+ PV +  
Sbjct: 19  LATCGMLLLASYSQAATTTPKRLAATPSTVAPCNAIESAPLVNVTVGKSFRLKTPVPISR 78

Query: 69  VLVSDPT-----------------------------KADVVV--HSPRTMYLFGKNVGQA 97
           +L+ +P                               ADV V   SP  +YL GK+VG  
Sbjct: 79  ILLGNPEGSQAAQPKESTDANADKGKPSAGGSTKSGVADVDVILLSPSEIYLLGKSVGST 138

Query: 98  NVILIGHDGKQMLNLDILIERDIAHLEMTLRRFI-ADSN-IRVEMVSDTVVLHGMVRTIQ 155
           N+IL+G +G+  L  D+ +  D A L+ +L + +   +N ++V   SD++VL G V    
Sbjct: 139 NIILLGRNGQCTLV-DVAVGADTASLQASLNQLLSPGANNVKVSAASDSLVLTGTVADSA 197

Query: 156 DSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGF 215
              RA+ L+E +  +            KV+N++++    QV L+V IAE+ + +L ++G 
Sbjct: 198 KLDRAMTLAEAYAGK-----------SKVINMMSVDAPQQVLLEVKIAEISKKLLDKLGV 246

Query: 216 QHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEP 275
             +   +  G + S+ + F    +   G   + G+ D  +    + A      ++ LAEP
Sbjct: 247 NIAGILNHGGWTYSWNSLFANDPL---GKALLSGINDSATRAFQIDAQHDDGLLKVLAEP 303

Query: 276 TLTAISGQSASFTSGGQHLYKTVSSSTGA----TSVTTHDYGVVLHFTPTVLSPGRIGLR 331
            L AISGQ  SF +GG+       ++T       ++   ++GV L FTPTVL  GRI L+
Sbjct: 304 NLMAISGQEGSFLAGGKIFIPVAQNNTNNGGSTITLEEKEFGVALRFTPTVLDGGRINLK 363

Query: 332 IQTEVSEPVIGVNAGD---------MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLK 382
           +  EVSE                  +PS+  R+A TTV+L  G +  + GLLK+++    
Sbjct: 364 VAPEVSELNPEGVGISAIGVAGKSILPSFTTRRAATTVQLHDGQSFAIGGLLKNNVTTNI 423

Query: 383 EGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKA 442
              P L +IPILGALFR++ F  +++E+    TP LVKP+   D   P D+Y   + A+ 
Sbjct: 424 SAFPFLGEIPILGALFRSTSFQTDKSELVFVVTPRLVKPL-PPDYKLPTDNYIPPNRAEL 482

Query: 443 FFFNRVNKIYGPK------EASEVEGQNYKGAIGFIYK 474
           F   R+             EAS     + +   GF  K
Sbjct: 483 FLGGRMEGRQPEPSASKASEASPQPEASTQAPSGFEVK 520


>gi|237678812|emb|CAQ57539.1| RhcC2 protein [Bradyrhizobium elkanii]
          Length = 484

 Score =  318 bits (815), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 128/479 (26%), Positives = 209/479 (43%), Gaps = 18/479 (3%)

Query: 2   RYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIG-KGKKISIGLNKVIIL 60
              +    + +   L       +     +              G     +++  ++   +
Sbjct: 18  SASRSAGLSRLCYVLCGFAMLFSSAAAAEIKRDGKGEPPRAAPGGTSGTLNLTSSQGKTV 77

Query: 61  QVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDI 120
            +      + V+DPT AD    S  T+++FGK  G+ ++  +  +G+ +  L +++ + I
Sbjct: 78  HLTAAATSIFVADPTIADYQAPSNTTIFVFGKKSGRTSLFALNENGEALAELRVVVTQPI 137

Query: 121 AHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSS 180
             L  TLR  + D  I V       +L G     +  + A +++E FL           +
Sbjct: 138 EDLRATLRAEVGDYPIHVSYTPRGAILSGTAPNAEVVETAKKVTEQFLG----------A 187

Query: 181 SKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVS 240
              V+N + +AG  QV L V +AEV R  +K +    +   S +G       D G     
Sbjct: 188 GSLVVNKIQVAGSLQVNLSVRVAEVSRSAVKDLNIHFTA-SSPNGAFLISGKDGGSGAAG 246

Query: 241 EGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSS 300
            GG   +       +   VL AL        LAEP LTA+SG+SASF +GG+     V  
Sbjct: 247 GGGTIGIGFSAGNTNLSAVLDALASEHLASILAEPNLTAMSGESASFLAGGEFPIP-VMQ 305

Query: 301 STGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIG----VNAGDMPSYRVRKA 356
                SV    +GV L F PTVL+  +I +R++ EVSE        +N  ++P+   R+A
Sbjct: 306 DNRQVSVQFRQFGVSLEFVPTVLNNNQINVRVKPEVSELSSEGQVKINGMEVPALSTRRA 365

Query: 357 DTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATP 416
            T VEL SG +  + GL++ +        P L  +PILGALFR+S F + ETE+ I  TP
Sbjct: 366 STVVELASGQSFAIGGLIRRNFNNDIGEFPWLGDVPILGALFRSSSFQKRETELVIIVTP 425

Query: 417 FLVKP-VAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
           ++V+P      +S P D  +   DA     N + +    ++A         G+ GFI +
Sbjct: 426 YIVRPGSNPSRMSAPSDRIAPPSDAGRILTNTLARPPKDRDAPRTSAPGLTGSAGFIIE 484


>gi|308050059|ref|YP_003913625.1| type II and III secretion system protein [Ferrimonas balearica DSM
           9799]
 gi|307632249|gb|ADN76551.1| type II and III secretion system protein [Ferrimonas balearica DSM
           9799]
          Length = 487

 Score =  317 bits (813), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 115/426 (26%), Positives = 199/426 (46%), Gaps = 19/426 (4%)

Query: 49  KISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQ 108
              + ++K   + +    + V V +P  AD+++ +P+ +Y+ G+ +G  N+++     + 
Sbjct: 47  SFPVPIHKSKTMSLANAAERVSVGNPAIADILLINPKELYILGRQLGSTNIMVWDDQDRL 106

Query: 109 MLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFL 168
           +  +DI I  D+  L+  L RF+ D  I V      +V+ G V  +     A++L+  + 
Sbjct: 107 VDIVDIEITHDLNGLKEKLHRFLPDEPIEVHSSQGQLVIGGQVSNLDRMNMALDLAHGYA 166

Query: 169 SQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSK 228
             +  +   ++    V+NL+++ G  QV L+VT+ EV+R++ + +    ++     G   
Sbjct: 167 VAANNSDNTST----VLNLMSVGGGHQVMLEVTVTEVQRELARTLDSDFALVF--EGSDF 220

Query: 229 SFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFT 288
                 G   +S  G F    V     F+  +   ++    R LAEP LT +SGQ A F 
Sbjct: 221 IGGLLGGDGLISNKGIFG-SYVSGDVLFDFAIDMAKQQGLARVLAEPNLTTMSGQMAEFL 279

Query: 289 SGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGDM 348
           SGG+            T++   ++GV + F PTVL  GRI L +   VSE       G +
Sbjct: 280 SGGEFPIPVPDRDG--TTIEYKEFGVGVKFVPTVLDSGRINLNLNVLVSELSNANAVGVI 337

Query: 349 P----------SYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALF 398
           P          S   R A++T+EL  G TI +AGLL   +++  + +P L +IP+LG LF
Sbjct: 338 PEGSTTALVTPSITKRSANSTIELGDGQTIAIAGLLSSTVRESMDELPGLGEIPVLGQLF 397

Query: 399 RNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEAS 458
            +  +   ETE+ I  TP LV+PV    L  P D +    D   +   R++K     + +
Sbjct: 398 SSQEYRNGETELVILVTPRLVRPVDREKLVLPTDGFVDPTDLGFYLMGRLSKRDEDVQPN 457

Query: 459 EVEGQN 464
                 
Sbjct: 458 TNPNSA 463


>gi|28899193|ref|NP_798798.1| putative pilus assembly transmembrane protein [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|153836824|ref|ZP_01989491.1| Flp pilus assembly protein [Vibrio parahaemolyticus AQ3810]
 gi|260361569|ref|ZP_05774596.1| Flp pilus assembly protein [Vibrio parahaemolyticus K5030]
 gi|260876726|ref|ZP_05889081.1| Flp pilus assembly protein [Vibrio parahaemolyticus AN-5034]
 gi|260898195|ref|ZP_05906691.1| Flp pilus assembly protein [Vibrio parahaemolyticus Peru-466]
 gi|260900397|ref|ZP_05908792.1| Flp pilus assembly protein [Vibrio parahaemolyticus AQ4037]
 gi|28807417|dbj|BAC60682.1| putative pilus assembly transmembrane protein [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|149749970|gb|EDM60715.1| Flp pilus assembly protein [Vibrio parahaemolyticus AQ3810]
 gi|308089085|gb|EFO38780.1| Flp pilus assembly protein [Vibrio parahaemolyticus Peru-466]
 gi|308091468|gb|EFO41163.1| Flp pilus assembly protein [Vibrio parahaemolyticus AN-5034]
 gi|308109123|gb|EFO46663.1| Flp pilus assembly protein [Vibrio parahaemolyticus AQ4037]
 gi|308114031|gb|EFO51571.1| Flp pilus assembly protein [Vibrio parahaemolyticus K5030]
 gi|328474270|gb|EGF45075.1| pilus assembly protein CpaC [Vibrio parahaemolyticus 10329]
          Length = 487

 Score =  317 bits (813), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 120/437 (27%), Positives = 205/437 (46%), Gaps = 24/437 (5%)

Query: 37  INISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQ 96
           +++       G+ +S+  ++   L +    + V + DP   D+VV     ++L GK +G 
Sbjct: 16  LSVHAATAQSGRVVSVAHHQSTQLVISGKAKKVTLGDPEVLDIVVLRSNELFLIGKKLGT 75

Query: 97  ANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQD 156
            NV +    G+ +   ++ +  D+  L+  L +F+ D +I V    + VVL G+V + Q+
Sbjct: 76  TNVSVWDSRGRLIEQFNVEVTHDLNTLKSKLFQFLPDESIEVHSAQEKVVLRGLVSSQQN 135

Query: 157 SQRAVELSETFLSQSGRNQYANSSSK---KVMNLLNIAGEDQVTLKVTIAEVRRDILKQI 213
              AV+++ETF      ++  +++      V+NLL+I G  QVTL+VT+AEV+R ++++ 
Sbjct: 136 MDIAVKIAETFALGDAADEEDDNAKDDESSVINLLSIGGAQQVTLEVTVAEVQRSLVRRF 195

Query: 214 GFQHSITGSSSGPSKSFAADFGGKFVSEGG---------DFSVKGVLDRFSFETVLHALE 264
                    S   +       GG                 F    +     F   L   +
Sbjct: 196 DSNFHFFQKSGDFTWGATTAGGGIDNIGPILNVPTVEDFGFLGSFIDSNTLFTFALDVAK 255

Query: 265 RATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLS 324
           +    + LAEP+LTA+SG  A F +GG+      +      ++   +YGV L F P +LS
Sbjct: 256 QNGVAKVLAEPSLTALSGTQAEFVAGGEFPIPVPNEDG--ITIDYKEYGVQLDFVPFILS 313

Query: 325 PGRIGLRIQTEVSEPVIG----------VNAGDMPSYRVRKADTTVELPSGGTIVLAGLL 374
             RI L++   VSE                   +P    R A TT+EL  G TI +AGLL
Sbjct: 314 DKRINLKLNVNVSEISNSGVLTFNPNEVNATFFIPPITKRSAGTTIELADGQTIGIAGLL 373

Query: 375 KDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHY 434
            ++ + + +GIP  S +P+LG LF++  F   ETE+ I  TP L  P+  R ++ P D +
Sbjct: 374 SENARNVADGIPGASDLPVLGRLFKSEEFTSGETELVILVTPRLATPIDRRRVTLPTDGF 433

Query: 435 SVEDDAKAFFFNRVNKI 451
              +D + +   +  K+
Sbjct: 434 VAPNDVEFYLLGKGAKL 450


>gi|27365106|ref|NP_760634.1| type II/IV secretion system secretin RcpA/CpaC [Vibrio vulnificus
           CMCP6]
 gi|27361252|gb|AAO10161.1| Type II/IV secretion system secretin RcpA/CpaC, associated with Flp
           pilus assembly [Vibrio vulnificus CMCP6]
          Length = 488

 Score =  317 bits (813), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 111/454 (24%), Positives = 195/454 (42%), Gaps = 30/454 (6%)

Query: 39  ISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQAN 98
            +      GK +++  +K   + +    + V + DP   D+V+     ++L G+ +G  N
Sbjct: 17  TAYGATQTGKVVTVPHHKSTFVALSGKAKRVSLGDPEVLDIVMLKSDELFLIGRKLGSTN 76

Query: 99  VILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQ 158
           ++     G  + +++I +  D+  L+  L  F+ +  I+V    + ++L GMV T +   
Sbjct: 77  LMAWDSRGNLIESINIEVTHDLNSLKQKLYEFLPEEPIQVHSAQNRLILSGMVSTQEKMN 136

Query: 159 RAVELSETFLSQSGRNQYANS-----SSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQI 213
            A+ ++ET+ +    ++   S         V+NL+ I G  QV L+VT+AEV+R ++++ 
Sbjct: 137 IALRVAETYAAGQQADEATASLNSQVEKSGVINLMTIGGAQQVMLEVTVAEVQRSLVRRF 196

Query: 214 GFQHSITGSSSGPSKSFAADFG-------------GKFVSEGGDFSVKGVLDRFSFETVL 260
                   ++   S    +  G                  +        +     F   L
Sbjct: 197 DSNFHFFENNGSFSWGATSAGGIIDDIGGGVGPIFNVPGIDSTGLLSTFIDGDTLFTFAL 256

Query: 261 HALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTP 320
              +     + LAEP LTA+SG  A F +GG+       S     ++   +YGV L F P
Sbjct: 257 DIAKENGVAKVLAEPNLTALSGAKAEFLAGGEFPIPVPDSDG--VTIEYKEYGVGLKFVP 314

Query: 321 TVLSPGRIGLRIQTEVSEPV----------IGVNAGDMPSYRVRKADTTVELPSGGTIVL 370
           T+LS  RI L +  +VSE                +  +P    R A +T+EL  G TI +
Sbjct: 315 TILSDKRINLNLAVDVSEIAASNTLTLSPGGTNASYFIPPITRRSASSTLELADGQTIGI 374

Query: 371 AGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRP 430
           AGLL ++++ +   +P    IP+LG LF +  +   ETE+ I  TP L KP+    ++ P
Sbjct: 375 AGLLSENVRDVSSKMPGFGDIPVLGQLFSSQDYISGETELVILVTPRLAKPIDRSKITLP 434

Query: 431 DDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQN 464
            D +    D K +       I      +    Q 
Sbjct: 435 TDAFVEPSDLKYYLLGVGAYIAESPTNANAAAQP 468


>gi|317154605|ref|YP_004122653.1| type II and III secretion system protein [Desulfovibrio aespoeensis
           Aspo-2]
 gi|316944856|gb|ADU63907.1| type II and III secretion system protein [Desulfovibrio aespoeensis
           Aspo-2]
          Length = 478

 Score =  317 bits (812), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 133/475 (28%), Positives = 217/475 (45%), Gaps = 32/475 (6%)

Query: 6   RTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVD 65
           R   + +  FL +   +V+ L P+  A+  V+N     +     IS+ ++K  IL     
Sbjct: 4   RPPRSFLLAFLMALAVTVSGLVPLAVADVDVLNTEAPGV-----ISLVVSKSTILTADAP 58

Query: 66  VQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEM 125
           V  V ++ P  A VVV SP  +Y+ G+ +G   + L    G+     D++I  D+  L+ 
Sbjct: 59  VSRVSLAQPETASVVVLSPTQIYITGRKLGTTTLTLWS-GGQVSGVYDLVITPDVTRLKR 117

Query: 126 TLRRFIADSN-IRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKV 184
            +   +     ++V    +++ L G V    D    + L+E              +  KV
Sbjct: 118 MIHEILPRERSVQVLSSGESITLSGSVSNTGDLTSVLSLAEA------------EAPGKV 165

Query: 185 MNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSS-------GPSKSFAADFGGK 237
           +NLL + G  QV L+V +AE+ R  LK++G   + T S+          S          
Sbjct: 166 VNLLRVDGVQQVMLQVRVAEMSRTALKRMGINLAATFSNFTVYSFLNNLSSLANTGSNVI 225

Query: 238 FVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKT 297
            +++  +  V+      +   +L AL+     R LAEP LT +SG+SA F  GG+     
Sbjct: 226 ELTDKINSVVRYNSGSTNVVGMLDALKAHGLARLLAEPNLTCVSGESADFLVGGEIPIPK 285

Query: 298 VSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGV----NAGDMPSYRV 353
              + G  S+    +GV L FTPTVLS G I L +  EVSE            ++P+   
Sbjct: 286 -PGALGTVSIEFKPFGVGLEFTPTVLSSGAINLHVSPEVSELDYTNALRYQGYEIPAIST 344

Query: 354 RKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIA 413
           RKA T V+L  G +  +AGL+ + +++     P+L  IP+LG LFR+S + + +TE+ I 
Sbjct: 345 RKASTVVDLADGQSFAIAGLISESLKENNHRFPVLGDIPVLGTLFRSSDYQKNKTELVII 404

Query: 414 ATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGA 468
            T  LVKP+ M   + P D +    D + +    +    G   A+ V  Q   G+
Sbjct: 405 VTAHLVKPLDMAGQTLPGDGFKEPTDYEFYMLGLLEG-QGASPAAMVGAQARSGS 458


>gi|37680844|ref|NP_935453.1| Flp pilus assembly protein, secretin CpaC [Vibrio vulnificus YJ016]
 gi|37199593|dbj|BAC95424.1| Flp pilus assembly protein, secretin CpaC [Vibrio vulnificus YJ016]
          Length = 488

 Score =  316 bits (810), Expect = 4e-84,   Method: Composition-based stats.
 Identities = 111/454 (24%), Positives = 195/454 (42%), Gaps = 30/454 (6%)

Query: 39  ISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQAN 98
            +      GK +++  +K   + +    + V + DP   D+V+     ++L G+ +G  N
Sbjct: 17  TAYGATQTGKVVTVPHHKSTFVALSGKAKRVSLGDPEVLDIVMLKSDELFLIGRKLGSTN 76

Query: 99  VILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQ 158
           ++     G  + +++I +  D+  L+  L  F+ +  I+V    + ++L GMV T +   
Sbjct: 77  LMAWDSRGNLIESINIEVTHDLNSLKQKLYEFLPEEPIQVHSAQNRLILSGMVSTQEKMN 136

Query: 159 RAVELSETFLSQSGRNQYANS-----SSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQI 213
            A+ ++ET+ +    ++   S         V+NL+ I G  QV L+VT+AEV+R ++++ 
Sbjct: 137 IALRVAETYAAGQQADEATASLNSQVEKSGVINLMTIGGAQQVMLEVTVAEVQRSLVRRF 196

Query: 214 GFQHSITGSSSGPSKSFAADFG-------------GKFVSEGGDFSVKGVLDRFSFETVL 260
                   ++   S    +  G                  +        +     F   L
Sbjct: 197 DSNFHFFENNGSFSWGATSAGGIIDDIGGGVGPIFNVPGIDSTGLLSTFIDGDTLFTFAL 256

Query: 261 HALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTP 320
              +     + LAEP LTA+SG  A F +GG+       S     ++   +YGV L F P
Sbjct: 257 DIAKENGVAKVLAEPNLTALSGAKAEFLAGGEFPIPVPDSDG--VTIEYKEYGVGLKFVP 314

Query: 321 TVLSPGRIGLRIQTEVSEPV----------IGVNAGDMPSYRVRKADTTVELPSGGTIVL 370
           T+LS  RI L +  +VSE                +  +P    R A +T+EL  G TI +
Sbjct: 315 TILSDKRINLNLAVDVSEIAASNTLTLSPGGTNASYFIPPITRRSASSTLELADGQTIGI 374

Query: 371 AGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRP 430
           AGLL ++++ +   +P    IP+LG LF +  +   ETE+ I  TP L KP+    ++ P
Sbjct: 375 AGLLSENVRDVSSKMPGFGDIPVLGQLFSSQDYISGETELVILVTPRLAKPIDRSKITLP 434

Query: 431 DDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQN 464
            D +    D K +       I      +    Q 
Sbjct: 435 TDAFVEPSDLKYYLLGVGAYIAESPTNANATAQP 468


>gi|320155489|ref|YP_004187868.1| type II/IV secretion system secretin RcpA/CpaC, associated with Flp
           pilus assembly [Vibrio vulnificus MO6-24/O]
 gi|319930801|gb|ADV85665.1| type II/IV secretion system secretin RcpA/CpaC, associated with Flp
           pilus assembly [Vibrio vulnificus MO6-24/O]
          Length = 488

 Score =  316 bits (810), Expect = 5e-84,   Method: Composition-based stats.
 Identities = 109/436 (25%), Positives = 192/436 (44%), Gaps = 30/436 (6%)

Query: 39  ISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQAN 98
            +      GK +++  +K   + +    + V + DP   D+V+     ++L G+ +G  N
Sbjct: 17  TAYGATQTGKVVTVPHHKSTFVALSGKAKRVSLGDPEVLDIVMLKSDELFLIGRKLGSTN 76

Query: 99  VILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQ 158
           ++     G  + +++I +  D+  L+  L  F+ +  I+V    + ++L GMV T +   
Sbjct: 77  LMAWDSRGNLIESINIEVTHDLNSLKQKLYEFLPEEPIQVHSAQNRLILSGMVSTQEKMN 136

Query: 159 RAVELSETFLSQSGRNQYANS-----SSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQI 213
            A+ ++ET+ +    ++   S         V+NL+ I G  QV L+VT+AEV+R ++++ 
Sbjct: 137 IALRVAETYAAGQQADEATASLNSQVEKSGVINLMTIGGAQQVMLEVTVAEVQRSLVRRF 196

Query: 214 GFQHSITGSSSGPSKSFAADFG-------------GKFVSEGGDFSVKGVLDRFSFETVL 260
                   ++   S    +  G                  +        +     F   L
Sbjct: 197 DSNFHFFENNGSFSWGATSAGGIIDDIGGGVGPIFNVPGIDSTGLLSTFIDGDTLFTFAL 256

Query: 261 HALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTP 320
              +     + LAEP LTA+SG  A F +GG+       S     ++   +YGV L F P
Sbjct: 257 DIAKENGVAKVLAEPNLTALSGAKAEFLAGGEFPIPVPDSDG--VTIEYKEYGVGLKFVP 314

Query: 321 TVLSPGRIGLRIQTEVSEPV----------IGVNAGDMPSYRVRKADTTVELPSGGTIVL 370
           T+LS  RI L +  +VSE                +  +P    R A +T+EL  G TI +
Sbjct: 315 TILSDKRINLNLAVDVSEIAASNTLTLSPGGTNASYFIPPITRRSASSTLELADGQTIGI 374

Query: 371 AGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRP 430
           AGLL ++++ +   +P    IP+LG LF +  +   ETE+ I  TP L KP+    ++ P
Sbjct: 375 AGLLSENVRDVSSKMPGFGDIPVLGQLFSSQDYISGETELVILVTPRLAKPIDRSKITLP 434

Query: 431 DDHYSVEDDAKAFFFN 446
            D +    D K +   
Sbjct: 435 TDAFVEPSDLKYYLLG 450


>gi|260776715|ref|ZP_05885610.1| type II/IV secretion system secretin RcpA/CpaC associated with Flp
           pilus assembly [Vibrio coralliilyticus ATCC BAA-450]
 gi|260607938|gb|EEX34203.1| type II/IV secretion system secretin RcpA/CpaC associated with Flp
           pilus assembly [Vibrio coralliilyticus ATCC BAA-450]
          Length = 476

 Score =  316 bits (809), Expect = 6e-84,   Method: Composition-based stats.
 Identities = 109/451 (24%), Positives = 195/451 (43%), Gaps = 30/451 (6%)

Query: 42  VEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVIL 101
                 K + +  +K   + +    + V + DP   D+V+     ++L GK +G  N++ 
Sbjct: 9   AATQSSKVVKVPHHKSTHVTLVGKAKRVSLGDPEVLDIVMLKSNEVFLIGKKLGSTNLMA 68

Query: 102 IGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAV 161
               G+ + +++I +  D+  L+  L  F+ D  I V    + ++L G+V +      A+
Sbjct: 69  WDSRGRLIESINIEVTHDLNSLKAKLFEFLPDEEIGVHSAQNRLILSGLVSSQSAMNIAL 128

Query: 162 ELSETFLSQSGRNQYANSSSKKV-----MNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQ 216
            ++ET+ +    ++   S S++V     +NLL I G  QV L+VT+AEV+R ++++    
Sbjct: 129 RVAETYAAGQEVDKETESLSEQVSKTGVINLLTIGGAQQVMLEVTVAEVQRTLVRKFDSN 188

Query: 217 HSITGSSSGPSKSFAADFGGKFVSEG-------------GDFSVKGVLDRFSFETVLHAL 263
                SS   +    +  G                           +     F   L   
Sbjct: 189 FHFFQSSGDFNWGGTSAGGSIDDVNNVVAPIFNAPTIENTGLLGTLIDSNTFFTFALDIA 248

Query: 264 ERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVL 323
           ++    + LAEP LTA+SG  A F +GG+             ++   +YGV L F PT+L
Sbjct: 249 KQNGTAKVLAEPNLTALSGAKAEFLAGGEFPIPVPDEDG--ITIEYKEYGVGLKFIPTIL 306

Query: 324 SPGRIGLRIQTEVSEPVI----------GVNAGDMPSYRVRKADTTVELPSGGTIVLAGL 373
           +  +I L +  +VSE                   +P    R A +T+EL  G TI +AGL
Sbjct: 307 TDQKINLNLAVDVSEIANSATLTLAPGGTNATYVIPPITRRSASSTLELADGQTIGIAGL 366

Query: 374 LKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDH 433
           L ++++     +P  S IPILG +F +  +   ETE+ I  TP L KP+    ++ P D 
Sbjct: 367 LSENVRDSVAEMPGFSDIPILGQMFNSQEYISGETELVILVTPRLAKPIDRNRVTLPTDS 426

Query: 434 YSVEDDAKAFFFNRVNKIYGPKEASEVEGQN 464
           +   +D + +   R   +     +     ++
Sbjct: 427 FVEPNDFEYYLLGRGAYLEPADASKPKAERS 457


>gi|153834055|ref|ZP_01986722.1| Flp pilus assembly protein [Vibrio harveyi HY01]
 gi|148869610|gb|EDL68600.1| Flp pilus assembly protein [Vibrio harveyi HY01]
          Length = 486

 Score =  316 bits (809), Expect = 6e-84,   Method: Composition-based stats.
 Identities = 121/436 (27%), Positives = 205/436 (47%), Gaps = 23/436 (5%)

Query: 37  INISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQ 96
           ++++      GK +S+  ++   L +    + V + DP   D++V     ++L GK +G 
Sbjct: 16  LSVNAAPAQSGKVVSVAHHQSTQLMISGKAKKVTLGDPEVLDIIVLRSNELFLVGKKLGT 75

Query: 97  ANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQD 156
            NV +    G+ +   ++ +  D+  L+  L +F+ D +I V    + VVL G+V T Q+
Sbjct: 76  TNVSVWDSRGRLIEQFNVEVTHDLNTLKSKLYQFLPDESIEVHSAQEKVVLRGLVSTQQN 135

Query: 157 SQRAVELSETFLSQSGRNQYANSSSKK--VMNLLNIAGEDQVTLKVTIAEVRRDILKQIG 214
              AV+++ETF +    ++  + S     V+NLL+I G  QVTL+VT+AEV+R ++++  
Sbjct: 136 MDTAVKIAETFAAGEAADEGEDDSKDDSMVINLLSIGGAQQVTLEVTVAEVQRTLVRRFD 195

Query: 215 FQHSITGSSSGPSKSFAADFGGKFVSEGG---------DFSVKGVLDRFSFETVLHALER 265
                   S   +       GG                 F    +     F   L    +
Sbjct: 196 SNFHFFQKSGDFTWGATTAGGGIDNIGPILNIPSVDDFGFLGSFIDSNTLFTFALDVARQ 255

Query: 266 ATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSP 325
               + LAEP+LTA+SG  A F +GG+      +      ++   +YGV L F P +LS 
Sbjct: 256 NGVAKVLAEPSLTALSGTQAEFVAGGEFPIPVPNEDG--ITIDYKEYGVQLDFVPYILSD 313

Query: 326 GRIGLRIQTEVSEPVIG----------VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLK 375
            RI L++   VSE                   +P    R A TT+EL  G TI +AGLL 
Sbjct: 314 KRINLKMNVNVSEIANSGVLTFNPNEVNATFFIPPITKRSAGTTIELADGQTIGIAGLLS 373

Query: 376 DDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYS 435
           ++ + + +GIP  S +P+LG LF++  F   ETE+ I  TP L  P+  R ++ P D + 
Sbjct: 374 ENARNVADGIPGASDLPVLGRLFKSEEFTSGETELVILVTPRLATPIDRRRITLPTDGFV 433

Query: 436 VEDDAKAFFFNRVNKI 451
             +D + +   +  ++
Sbjct: 434 SPNDVEFYLLGKGAEL 449


>gi|323491532|ref|ZP_08096711.1| pilus assembly protein CpaC [Vibrio brasiliensis LMG 20546]
 gi|323314108|gb|EGA67193.1| pilus assembly protein CpaC [Vibrio brasiliensis LMG 20546]
          Length = 485

 Score =  316 bits (809), Expect = 6e-84,   Method: Composition-based stats.
 Identities = 114/455 (25%), Positives = 199/455 (43%), Gaps = 30/455 (6%)

Query: 39  ISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQAN 98
           ++      GK + +  +K   + +    + V + DP   D+V+     ++L GK +G  N
Sbjct: 17  VTYAASQSGKVVKVPHHKSTHVTLAGKAKRVSLGDPDVLDIVMLKSDELFLIGKKLGSTN 76

Query: 99  VILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQ 158
           ++     G+ + +++I +  D+  L+  L  F+ + +I V    + ++L G +       
Sbjct: 77  LMAWDSRGQLIESINIEVTHDLNSLKAKLFEFLPNESIEVHSAQNRLILSGQISNQAAMN 136

Query: 159 RAVELSETFLSQSGRNQYANSSSKK-----VMNLLNIAGEDQVTLKVTIAEVRRDILKQI 213
            A+ ++ET+ +    ++   S SK+     V+NL+ I G  QV L+VT+AEV+R ++++ 
Sbjct: 137 IALRVAETYSAGRQADKENKSLSKQAEKTGVINLMTIGGAQQVMLEVTVAEVQRSLVRKF 196

Query: 214 GFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVL----------DRFSFETVLHAL 263
               +   SS    K      G         F                    F   L   
Sbjct: 197 DANFAFFQSSGSKFKWGGTSTGATVPGATPIFEAPSTGDYGILGSFIDGNTLFTFALDVA 256

Query: 264 ERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVL 323
            +    + LAEP LTA+SG  A F +GG+             ++   +YGV L F PTVL
Sbjct: 257 RQNGTAKVLAEPNLTALSGSKAEFLAGGEFPIPVPDEDG--ITIEYKEYGVGLKFIPTVL 314

Query: 324 SPGRIGLRIQTEVSEPVI----------GVNAGDMPSYRVRKADTTVELPSGGTIVLAGL 373
           S  +I L +  +VSE               +   +P    R A +T+EL  G TI +AGL
Sbjct: 315 SDKKINLNLAVDVSEIANSSSLTLSPGSTNSTYIIPPITRRSASSTLELADGQTIGIAGL 374

Query: 374 LKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDH 433
           L ++++ +   +P  S IPILG +F +  +   ETE+ I  TP L +P+    ++ P D 
Sbjct: 375 LSENVRDVANEMPGFSDIPILGQMFNSQEYVSGETELVILVTPRLAQPIDRNKVTLPTDS 434

Query: 434 YSVEDDAKAFFFNR---VNKIYGPKEASEVEGQNY 465
           +   +D + +   R   +       +A  V    Y
Sbjct: 435 FVEPNDFEYYLLGRGSYLAPASQASQAKPVAEPEY 469


>gi|149911409|ref|ZP_01900027.1| Flp pilus assembly protein, secretin CpaC [Moritella sp. PE36]
 gi|149805517|gb|EDM65522.1| Flp pilus assembly protein, secretin CpaC [Moritella sp. PE36]
          Length = 489

 Score =  315 bits (807), Expect = 1e-83,   Method: Composition-based stats.
 Identities = 111/427 (25%), Positives = 191/427 (44%), Gaps = 20/427 (4%)

Query: 49  KISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQ 108
            + I + K   LQ+   +  V V +   AD+++   R +Y+ GK +G  N+++   D   
Sbjct: 44  SVRIPIFKSKTLQMDKAIHRVSVGNSDIADILILRSRELYIVGKRLGTTNMMVWDKDDNL 103

Query: 109 MLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFL 168
           +   ++ +  D+  L   L +++ + +I VE     +V+ G V ++     AVE++E + 
Sbjct: 104 VHVQNLEVTHDLNSLRKRLYKYLPNEDIGVETSQGQLVVSGQVSSLVKMNTAVEIAEGYA 163

Query: 169 SQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQH----SITGSSS 224
           + +   +  +     V+N++++ G  QV L+VT+AEV  DI + +          +   +
Sbjct: 164 TAANVGKSNSI----VVNMMSVGGGQQVMLEVTVAEVSTDIGRNLDGNTVLGAFGSDGFA 219

Query: 225 GPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQS 284
           G              S   +   + +     F       +     + LAEP LTA+SGQS
Sbjct: 220 GIGTGTGNVPTNILGSIDTNIFARYLTGDMLFSVAFDVAKSKGLTKILAEPNLTALSGQS 279

Query: 285 ASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVI--- 341
           A F SGG++      S+    ++   D+GV + F PTVL  G+I L ++  VSE      
Sbjct: 280 AEFLSGGEYPVPV--STDDGITIEYRDFGVGVSFVPTVLDSGKINLNLKVLVSELSSVNS 337

Query: 342 -------GVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPIL 394
                     +   PS   R   TTVEL  G TIV+ GLL D +++     P L  IPIL
Sbjct: 338 VTISASDTNTSTITPSLIKRSTATTVELGDGQTIVIGGLLSDSLRESITKFPGLGDIPIL 397

Query: 395 GALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGP 454
           G LF +  +   +TE+ I  TP LV+P     +  P D +    D + +   ++ +    
Sbjct: 398 GQLFTSQEYISGQTELVIMVTPRLVRPFNKDGMILPTDGFVPVSDMEFYLLGKMTQQEKG 457

Query: 455 KEASEVE 461
            +     
Sbjct: 458 SDTKNPN 464


>gi|283852073|ref|ZP_06369347.1| type II and III secretion system protein [Desulfovibrio sp.
           FW1012B]
 gi|283572463|gb|EFC20449.1| type II and III secretion system protein [Desulfovibrio sp.
           FW1012B]
          Length = 527

 Score =  315 bits (807), Expect = 1e-83,   Method: Composition-based stats.
 Identities = 143/523 (27%), Positives = 229/523 (43%), Gaps = 82/523 (15%)

Query: 10  TMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDV 69
            +++  L +   S           AA   ++ V +    K+S+ + K +ILQ   DV  V
Sbjct: 12  RLLAWVLVAGLASTGY--------AAPAVVAPVAVRSTPKLSLTIGKSVILQSDADVSRV 63

Query: 70  LVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRR 129
            V+ P  AD V+ SPR +Y+ G+  G  N+ L     K     D+ +  DI  L+  L  
Sbjct: 64  SVAQPEIADFVLLSPRQVYVTGRAPGVTNLTLWDKGDKIRAVYDLDVAPDITRLKKMLHD 123

Query: 130 FIADS-NIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLL 188
            +     I V    D + L G VR  ++ ++A+ L+E +            + KKV+NL+
Sbjct: 124 VLPGEPGIEVRASQDAIALAGTVRDAENMKKALTLAEVY------------APKKVVNLM 171

Query: 189 NIAGEDQVTLKVTIAEVRRDILKQIG----------FQHSITGSSSGPSKSF-------- 230
            + G  QV L+V +AE+ + +L ++G          F +++ G  +  + S         
Sbjct: 172 AVGGVQQVMLEVRVAEMSKSVLNRMGINLNAIGDGNFAYTLIGGLTSVAGSMFNMDATQN 231

Query: 231 ----------AADFGGKFVSEGGDFSVK--------------------------GVLDRF 254
                      AD    F S     S +                          G     
Sbjct: 232 VYQYITMTAKGADGNTSFDSSPIQLSYREFNQPSNRATATMNQGTAVARWNTNWGGAGNT 291

Query: 255 SFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGV 314
           +   VL  L+    ++ LAEP L  ++GQ+A F +GGQ     V S  G TS+   D+GV
Sbjct: 292 AMTAVLDVLKENGLVKILAEPNLVCLNGQTADFLAGGQIPVP-VPSGLGTTSIEWKDFGV 350

Query: 315 VLHFTPTVLSPGRIGLRIQTEVSEPV----IGVNAGDMPSYRVRKADTTVELPSGGTIVL 370
            L FTPT++   RI L++  EVS+      I +    +P+   R+  TTVEL +G T  +
Sbjct: 351 GLKFTPTIVGGDRINLQVHPEVSDLDYAHAIQLQGSTIPAINTRRTSTTVELKNGQTFAV 410

Query: 371 AGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRP 430
           AG+LK++ +   +  P++  IPILG LF++S+F +++TE+ I  T  L KP+  + +S P
Sbjct: 411 AGMLKEEARSTFDKYPVVGDIPILGNLFKSSQFQKDQTELVILITAHLAKPLDKKAVSLP 470

Query: 431 DDHYSVEDDAKAFFFNRVNKIYGPKEASE--VEGQNYKGAIGF 471
            D     DD + F   R +       A    V G    G  G 
Sbjct: 471 TDSAHEPDDLEFFLGIRRDGGQATPAAGPLAVSGAALDGDFGH 513


>gi|304320647|ref|YP_003854290.1| putative exporter protein, cpaC [Parvularcula bermudensis HTCC2503]
 gi|303299549|gb|ADM09148.1| putative exporter protein, cpaC [Parvularcula bermudensis HTCC2503]
          Length = 494

 Score =  314 bits (805), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 144/502 (28%), Positives = 239/502 (47%), Gaps = 42/502 (8%)

Query: 1   MRYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIIL 60
           MR +      +    L  + PS+A+              +       +++ + L K  I+
Sbjct: 5   MRKILSVMAGLAGAVLIGTGPSMAQPGGSTPLEFETTYDAGGNGLASREVLLPLGKAAII 64

Query: 61  QVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDI 120
           ++P    D++VSDP   + V+ +P+ ++L G+  GQAN         Q+LNL+I +E+D 
Sbjct: 65  ELPRPATDIIVSDPDIVEAVIRTPQRVFLMGREAGQANAFFFDRANNQILNLEIRVEQDA 124

Query: 121 AHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSS 180
             +   + + + ++ I VE ++  V++HG V    D+QRA E++  F  +          
Sbjct: 125 DTIRELMTKLVPNARISVESLNGNVIIHGTVDNASDAQRAGEIASRFAGE---------- 174

Query: 181 SKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFA-----ADFG 235
               +N+L +    QV LK+ I E++R +++Q+G   +        +  FA     A  G
Sbjct: 175 -DNFVNMLKVREPSQVLLKIKIVEMQRRLVRQLGIDLNGVAQVDRSAIEFAVQNSFAISG 233

Query: 236 GKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLY 295
                   + S  G  D  + +      E+   ++TLAEP++ A+SG++ASF +GG+   
Sbjct: 234 QSLGGINANLSTPGFGDITNLDFAFDIFEQNGLVKTLAEPSIVALSGRNASFLAGGEFPV 293

Query: 296 KTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVI-------------- 341
               S+ G  SVT   +GV L F P V S  RI L + TEVS+                 
Sbjct: 294 PEA-SANGTPSVTFKPFGVQLEFQPVVYSKNRIQLTLATEVSDVSNVNGLSIAGATQAEE 352

Query: 342 ----------GVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKI 391
                           +P    R A TTVELPSGG++ LAGLL++DI ++ +G+P L + 
Sbjct: 353 DPDTGEIIEQTFEGFIVPGTVSRSAATTVELPSGGSLALAGLLQEDINEVIDGVPGLKET 412

Query: 392 PILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKI 451
           P+LGALFR+  F  ++TE+ I ATP+LV+P  +  L+ P   Y+     ++    ++   
Sbjct: 413 PVLGALFRSQEFQSQQTELVIIATPYLVEPTDLAALTDPAQGYAPPSPVQSVILGQLESA 472

Query: 452 YGPKEASEVEGQNYKGAIGFIY 473
           YG +     + Q   G IGFI 
Sbjct: 473 YGVRGRKARDAQ-LSGPIGFIL 493


>gi|197295153|ref|YP_002153694.1| flp type pilus assembly protein [Burkholderia cenocepacia J2315]
 gi|195944632|emb|CAR57236.1| flp type pilus assembly protein [Burkholderia cenocepacia J2315]
          Length = 644

 Score =  313 bits (803), Expect = 3e-83,   Method: Composition-based stats.
 Identities = 123/439 (28%), Positives = 215/439 (48%), Gaps = 18/439 (4%)

Query: 42  VEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVIL 101
             + +   +++ L K +++ +P  V++  + +P  A   + SP+T+Y+ G  VG  N+I+
Sbjct: 92  GAVRESTSVAVPLGKSLLVPMPEPVRNRTIGNPAVAQATMVSPQTLYILGLAVGTTNMIV 151

Query: 102 IGHDGKQMLNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRA 160
            G  G     +D+ +  D   L+ +L + + +  +I V   + T+VL G V + Q +Q+A
Sbjct: 152 QGKSGACR-VIDVAVGADAGGLQASLLQLMPNERDIHVSTAAGTIVLAGTVSSSQAAQQA 210

Query: 161 VELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSIT 220
           V+++  +   +G           V+N+LN+    QV L+V +AEV + ++ Q+G   +I 
Sbjct: 211 VQIAHAYGDSAGDAAGGGKQGGGVLNMLNVTSPQQVMLEVKVAEVSKTLINQMGSAFNIQ 270

Query: 221 GSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAI 280
           G     S +  ++      S      V    +   F     A      ++ LAEP L  I
Sbjct: 271 GGFGSWSGALVSNLLAGVASGA----VFNKANNRPFSIAADAQNTDNLVKILAEPNLVTI 326

Query: 281 SGQSASFTSGGQHLYKTVSSSTGAT---SVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS 337
           SGQ A+F +GG+       SS   T   ++   ++GV L FTPTVL+ GRI L++  EVS
Sbjct: 327 SGQEATFLAGGKIFIPIPQSSGNGTSSITLQEEEFGVALKFTPTVLANGRISLKVAPEVS 386

Query: 338 EPVIG---------VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLL 388
           E                  +P    R+A TTV++  G +  + GL+KD+     + IP +
Sbjct: 387 ELSQTGVTLSATNIGGTSILPLITTRRASTTVQMSDGESFAIGGLIKDNATGALKAIPGV 446

Query: 389 SKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRV 448
            ++P+LGALFR++ F ++ TE+    TP LVKP+   D++ P D +S  ++   +    +
Sbjct: 447 GEVPVLGALFRSTSFQQDRTELIFLITPHLVKPLQTADVALPTDSFSKPNEVDVYATGNM 506

Query: 449 NKIYGPKEASEVEGQNYKG 467
               G ++A     Q   G
Sbjct: 507 EGRGGVRKAGAQPMQPANG 525


>gi|78060314|ref|YP_366889.1| Flp pilus assembly protein secretin CpaC [Burkholderia sp. 383]
 gi|77964864|gb|ABB06245.1| Flp pilus assembly protein secretin CpaC [Burkholderia sp. 383]
          Length = 652

 Score =  313 bits (803), Expect = 3e-83,   Method: Composition-based stats.
 Identities = 118/429 (27%), Positives = 210/429 (48%), Gaps = 18/429 (4%)

Query: 42  VEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVIL 101
             + +   +S+ L K +++ +P  V++  + +P  A   + SP+T+Y+ G +VG  N+I+
Sbjct: 92  GAVRESTSVSVPLGKSLLVPMPEPVRNRTIGNPAVAQATMVSPQTLYILGLSVGTTNMIV 151

Query: 102 IGHDGKQMLNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRA 160
            G  G     +D+ +  D   L+ +L + + +  +I V   + T+VL G V +   +Q+A
Sbjct: 152 QGRSGACR-VIDVAVGADAGGLQASLMQLMPNERDIHVSTAAGTIVLAGTVSSSMAAQQA 210

Query: 161 VELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSIT 220
           ++++  +   +G       +   V+N+LN+    QV L+V +AEV + ++ Q+G   +I 
Sbjct: 211 MQIARAYGDSAGDPAGGGKAGGGVLNMLNVTSPQQVMLEVKVAEVSKTLINQMGSALNIQ 270

Query: 221 GSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAI 280
           G     S +  ++      +           +   F     A      ++ LAEP L  I
Sbjct: 271 GGFGSWSGALVSNLLAGVATG----IAFSKANNKPFNLAADAQNTDNLVKILAEPNLVTI 326

Query: 281 SGQSASFTSGGQHLYKTVSSSTGAT---SVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS 337
           SGQ A+F +GG+       SS   T   ++   ++GV L FTPTVLS GRI L++  EVS
Sbjct: 327 SGQEATFLAGGKIFIPIPQSSGNGTSSITLQEEEFGVALKFTPTVLSNGRISLKVAPEVS 386

Query: 338 EPVIG---------VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLL 388
           E                  +P    R+A TTV++  G T  + GL+KD+     + +P +
Sbjct: 387 ELSQTGVTLSATNIGGTSILPLITTRRASTTVQMGDGETFAIGGLIKDNGTGALKALPGV 446

Query: 389 SKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRV 448
            +IP+LGAL R++ F ++ TE+    TP LVKP+   D+  P D +S  ++   +    +
Sbjct: 447 GEIPVLGALLRSTSFQQDRTELIFVITPHLVKPLQTADVPLPTDSFSKPNEVDVYATGNM 506

Query: 449 NKIYGPKEA 457
               G ++ 
Sbjct: 507 EGRGGVRKP 515


>gi|91788411|ref|YP_549363.1| type II and III secretion system protein [Polaromonas sp. JS666]
 gi|91697636|gb|ABE44465.1| type II and III secretion system protein [Polaromonas sp. JS666]
          Length = 514

 Score =  313 bits (802), Expect = 3e-83,   Method: Composition-based stats.
 Identities = 132/488 (27%), Positives = 224/488 (45%), Gaps = 42/488 (8%)

Query: 16  LFSSNPSVAKLPPIKEANAAVINISDVEIGK--------GKKISIGLNKVIILQVPVDVQ 67
           L + NP  A   P K+A  A       +             +I++   K  ++++P    
Sbjct: 40  LAAKNPPTATSGPGKQAATAQPKAVVTQARAPITGKVELAPQINLSEGKSTLMRLPSPAT 99

Query: 68  DVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTL 127
            + V D    DV++ +P  +Y+ GK+VG  N+IL          +DI +  D   L   L
Sbjct: 100 RLSVGDARIVDVILLNPSELYMLGKSVGSTNLILWNKANDA-TIIDIAVGMDTVALRSRL 158

Query: 128 RRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANS------- 179
            +  A   ++++   +DT++L GMV  +  + + + ++  ++ +S R+  A         
Sbjct: 159 EQMFASEKDLKITTAADTLILSGMVSDVVKADQILSVANAYVQRSSRSGQAGGASGGSAG 218

Query: 180 ----SSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFG 235
                S KV+N+L+IA   QV L+V +AEV + +  Q+G       ++   + +  ++  
Sbjct: 219 GQQSDSAKVVNMLSIAAPQQVMLEVQVAEVSKTLADQLGASIGGRKTTGSWTYTLLSNLL 278

Query: 236 GKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLY 295
               S  G     G          + A +    ++ LAEPT+ AISGQ ASF +GG+   
Sbjct: 279 TGAASSIGAVKNSGNF------LTIDAQKGDGLLKILAEPTIMAISGQEASFLAGGKIFI 332

Query: 296 KTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEP---------VIGVNAG 346
              S + G  ++   ++GV + F PTVL  GRI L++  EVS+                 
Sbjct: 333 PVKSGNNGEIALEEKEFGVSVKFLPTVLEGGRINLKVAPEVSDLNRQGVGISATGSSTTA 392

Query: 347 DMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNRE 406
            +PS+  R+A TTV+L  G +  + GL+K+++       PLL ++P+LGALFR+S F  +
Sbjct: 393 ILPSFTTRRASTTVQLFDGQSFAIGGLIKNNVTANINAFPLLGEVPVLGALFRSSDFQTD 452

Query: 407 ETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYK 466
            +E+    TP LVKP+   D   P D Y     ++ F   ++     P E ++  G    
Sbjct: 453 RSELVFIVTPHLVKPL-PADYKLPTDPYIQPSRSEFFLGGKMEGA-APPEGNKPAGPAT- 509

Query: 467 GAIGFIYK 474
              GF  K
Sbjct: 510 ---GFEVK 514


>gi|107028248|ref|YP_625343.1| type II and III secretion system protein [Burkholderia cenocepacia
           AU 1054]
 gi|116687159|ref|YP_840406.1| type II and III secretion system protein [Burkholderia cenocepacia
           HI2424]
 gi|105897412|gb|ABF80370.1| type II and III secretion system protein [Burkholderia cenocepacia
           AU 1054]
 gi|116652874|gb|ABK13513.1| type II and III secretion system protein [Burkholderia cenocepacia
           HI2424]
          Length = 642

 Score =  313 bits (802), Expect = 4e-83,   Method: Composition-based stats.
 Identities = 122/439 (27%), Positives = 215/439 (48%), Gaps = 19/439 (4%)

Query: 42  VEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVIL 101
             + +   +++ L K +++ +P  V++  + +P  A   + SP+T+Y+ G  VG  N+I+
Sbjct: 92  GAVRESTSVAVPLGKSLLVPMPEPVRNRTIGNPAVAQATMVSPQTLYILGLAVGTTNMIV 151

Query: 102 IGHDGKQMLNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRA 160
            G  G     +D+ +  D   L+ +L + + +  +I V   + T+VL G V + Q +Q+A
Sbjct: 152 QGRSGACR-VIDVAVGADAGGLQASLLQLMPNERDIHVSTAAGTIVLAGTVSSSQAAQQA 210

Query: 161 VELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSIT 220
           V+++  +   S  +         V+N+LN+    QV L+V +AEV + ++ Q+G   +I 
Sbjct: 211 VQIAHAY-GDSAGDAAGGKQGGGVLNMLNVTSPQQVMLEVKVAEVSKTLINQMGSAFNIQ 269

Query: 221 GSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAI 280
           G     S +  ++      S      V    +   F     A      ++ LAEP L  I
Sbjct: 270 GGFGSWSGALVSNLLAGVASGA----VFNKANNKPFSIAADAQNTDNLVKILAEPNLVTI 325

Query: 281 SGQSASFTSGGQHLYKTVSSSTG---ATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS 337
           SGQ A+F +GG+       S +    + ++   ++GV L FTPTVL+ GRI L++  EVS
Sbjct: 326 SGQEATFLAGGKIFIPIPQSGSNGVSSITLQEEEFGVALKFTPTVLANGRISLKVAPEVS 385

Query: 338 EPVIGV---------NAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLL 388
           E                  +P    R+A TTV++  G +  + GL+KD+     + IP +
Sbjct: 386 ELSQTGVTLSASNIGGTSILPLITTRRASTTVQMSDGESFAIGGLIKDNASGALKAIPGV 445

Query: 389 SKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRV 448
            ++P+LGALFR++ F ++ TE+    TP LVKP+   D++ P D +S  ++   F    +
Sbjct: 446 GEVPVLGALFRSTSFQQDRTELIFLITPHLVKPLQTADVALPTDSFSKPNEVDVFATGNM 505

Query: 449 NKIYGPKEASEVEGQNYKG 467
               G ++A     Q   G
Sbjct: 506 EGRGGVRKAGAQPMQPANG 524


>gi|170734868|ref|YP_001773982.1| type II and III secretion system protein [Burkholderia cenocepacia
           MC0-3]
 gi|169820906|gb|ACA95487.1| type II and III secretion system protein [Burkholderia cenocepacia
           MC0-3]
          Length = 646

 Score =  312 bits (800), Expect = 6e-83,   Method: Composition-based stats.
 Identities = 122/439 (27%), Positives = 215/439 (48%), Gaps = 19/439 (4%)

Query: 42  VEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVIL 101
             + +   +++ L K +++ +P  V++  + +P  A   + SP+T+Y+ G  VG  N+I+
Sbjct: 92  GAVRESTSVAVPLGKSLLVPMPEPVRNRTIGNPAVAQATMVSPQTLYILGLAVGTTNMIV 151

Query: 102 IGHDGKQMLNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRA 160
            G  G     +D+ +  D   L+ +L + + +  +I V   + T+VL G V + Q +Q+A
Sbjct: 152 QGRSGACR-VIDVAVGADAGGLQASLLQLMPNERDIHVSTAAGTIVLAGTVSSSQAAQQA 210

Query: 161 VELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSIT 220
           V+++  +   S  +         V+N+LN+    QV L+V +AEV + ++ Q+G   +I 
Sbjct: 211 VQIAHAY-GDSAGDAAGGKQGGGVLNMLNVTSPQQVMLEVKVAEVSKTLINQMGSAFNIQ 269

Query: 221 GSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAI 280
           G     S +  ++      S      V    +   F     A      ++ LAEP L  I
Sbjct: 270 GGFGSWSGALVSNLLAGVASGA----VFNKANNKPFSIAADAQNTDNLVKILAEPNLVTI 325

Query: 281 SGQSASFTSGGQHLYKTVSSSTG---ATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS 337
           SGQ A+F +GG+       S +    + ++   ++GV L FTPTVL+ GRI L++  EVS
Sbjct: 326 SGQEATFLAGGKIFIPIPQSGSNGVSSITLQEEEFGVALKFTPTVLANGRISLKVAPEVS 385

Query: 338 EPVIGV---------NAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLL 388
           E                  +P    R+A TTV++  G +  + GL+KD+     + IP +
Sbjct: 386 ELSQTGVTLSASNIGGTSILPLITTRRASTTVQMSDGESFAIGGLIKDNASGALKAIPGV 445

Query: 389 SKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRV 448
            ++P+LGALFR++ F ++ TE+    TP LVKP+   D++ P D +S  ++   F    +
Sbjct: 446 GEVPVLGALFRSTSFQQDRTELIFLITPHLVKPLQTADVALPTDSFSKPNEVDVFATGNM 505

Query: 449 NKIYGPKEASEVEGQNYKG 467
               G ++A     Q   G
Sbjct: 506 EGRGGVRKAGAQPMQPANG 524


>gi|300021854|ref|YP_003754465.1| type II and III secretion system protein [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299523675|gb|ADJ22144.1| type II and III secretion system protein [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 550

 Score =  312 bits (800), Expect = 7e-83,   Method: Composition-based stats.
 Identities = 177/537 (32%), Positives = 258/537 (48%), Gaps = 77/537 (14%)

Query: 11  MMSIFLFSSNPSVAKLPPIKE---------------ANAAVINISDVEIGKGKKISIGLN 55
           + +  L S+ P+ A+                       + V       +   K I IGL 
Sbjct: 18  VFAAVLTSAAPTSAQSRAADRLSVRADRGDPEFSKNTQSIVRISESEGLPVRKSIKIGLG 77

Query: 56  KVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDIL 115
           K ++++ P  V+DV+ S+P   D VV S   ++L GK  GQ+N     + G+Q+  +++ 
Sbjct: 78  KSVLIEFPNGVRDVMASNPAVVDAVVLSSNRVFLLGKAPGQSNAFFFSNKGEQLALIELN 137

Query: 116 IERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQ 175
           ++++   LEM LRR I  S I+VE ++ T +L G V++  DS RA  ++  F+SQ   N 
Sbjct: 138 VDQEGDGLEMLLRRVIPGSEIKVETLNQTAILTGRVKSPSDSARASRIAAQFMSQMIANW 197

Query: 176 YAN--------------------SSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGF 215
            +N                       K V+NLL +  E+QV LKVT+AEV+R +LKQ+G 
Sbjct: 198 ASNVSLTSSGSGQQNKAGEVKDADDVKSVINLLTVEAEEQVMLKVTVAEVKRTLLKQLGI 257

Query: 216 QHSITGSSSGPSKSFAA------------------------------------DFGGKFV 239
                 SS   S +                                       + G    
Sbjct: 258 NLGGVLSSGSFSTTLLTENAFPISTAQGLGSLPTFGVGTAASAACAVGQICAFNPGPATG 317

Query: 240 SEGGDFSVKGVLDR-FSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTV 298
           + G    V G  +   + ++ + ALER   I+TLAEP LTAISG+ A F +GG+  Y T 
Sbjct: 318 AFGNSGLVSGWGNSRNNIQSAVRALERDGLIKTLAEPNLTAISGEPAEFLAGGEVPYVTG 377

Query: 299 SSS-TGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGDMPSYRVRKAD 357
             + TG ++V    +GV L FTP VL+ GRI L+I T VS+    V     P +  R+A 
Sbjct: 378 VDTQTGVSAVAFKKFGVQLAFTPVVLTEGRISLKIDTSVSDISQYVAGN--PVFDTRQAK 435

Query: 358 TTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPF 417
           T VELPSGG++ LAGL+    QQ  +G+P    IPILG LFR+  F  +E+E+ +  TP+
Sbjct: 436 TVVELPSGGSLALAGLISTKTQQNIDGLPGAKDIPILGTLFRSRDFQNDESELVVIVTPY 495

Query: 418 LVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
           LV+PVA + LS P D      D KA F   +N+IYG  E         KG  GFI +
Sbjct: 496 LVQPVARQQLSAPTDGLYPATDLKADFLGHLNRIYGKSE--VQPSGGLKGDYGFIVE 550


>gi|94309592|ref|YP_582802.1| type II and III secretion system protein [Cupriavidus metallidurans
           CH34]
 gi|93353444|gb|ABF07533.1| Flp pilus assembly protein secretin CpaC [Cupriavidus metallidurans
           CH34]
          Length = 620

 Score =  312 bits (799), Expect = 8e-83,   Method: Composition-based stats.
 Identities = 115/447 (25%), Positives = 215/447 (48%), Gaps = 21/447 (4%)

Query: 19  SNPSVAKLPPIKE-ANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKA 77
              S+A +P     A  A        I     + + + K  ++ +P  V++  + +P   
Sbjct: 60  MTISMAPVPAAPSIAADARGPNCSGAIRNESSVIVPIGKSQLIPLPEPVRNRTLGNPNVV 119

Query: 78  DVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADS-NI 136
              + SP+T+Y+ G++VG  N+I+ G  G     +++++  D   L+ +L + +     I
Sbjct: 120 QATMVSPQTLYVLGRSVGTTNMIVQGRSGGC-SIINVVVNADSNGLQTSLAQLLPGESGI 178

Query: 137 RVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQV 196
           RV   +D +VL G V + Q + +A+++++ + + +  +  AN     V+N++++    QV
Sbjct: 179 RVMTAADNLVLTGSVSSSQAALQAMDIAQAYANAAQGD-GANGKKGGVLNMMSVDTPQQV 237

Query: 197 TLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSF 256
            L+V +AEV + +L Q+G   +I G     +    ++     ++           +   F
Sbjct: 238 MLEVKVAEVSKTLLNQLGSAVNIQGGFGSWTGGVISNL----LTGAAAGIFGSKANNKPF 293

Query: 257 ETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSS----STGATSVTTHDY 312
              + A +  + ++ LAEP L  ISGQ ASF +GG+       S         ++   ++
Sbjct: 294 NLAIDAQKNDSLVKVLAEPNLVTISGQEASFLAGGKIYIPVAQSNALGGASTITLQEEEF 353

Query: 313 GVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGD---------MPSYRVRKADTTVELP 363
           GV L FTPTVL+ GRI L++  EVSE                  +P    R+A TTV++ 
Sbjct: 354 GVGLKFTPTVLANGRIHLKVSPEVSELSPTGATVSGSTLTGQTILPLITTRRASTTVQMR 413

Query: 364 SGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVA 423
            G +  + GLL+D  +   + +P   ++P+LG LFR+++F ++ TE+    TP LVKP+ 
Sbjct: 414 DGESFAIGGLLQDSARGSLKALPGAGEVPVLGTLFRSTQFQQDLTELVFIITPHLVKPMQ 473

Query: 424 MRDLSRPDDHYSVEDDAKAFFFNRVNK 450
            ++   P D ++  D    +F   +  
Sbjct: 474 TQNYPLPTDGFTTPDPLSLYFMGNMEG 500


>gi|260462607|ref|ZP_05810813.1| type II and III secretion system protein [Mesorhizobium
           opportunistum WSM2075]
 gi|259031513|gb|EEW32783.1| type II and III secretion system protein [Mesorhizobium
           opportunistum WSM2075]
          Length = 478

 Score =  312 bits (799), Expect = 9e-83,   Method: Composition-based stats.
 Identities = 118/484 (24%), Positives = 213/484 (44%), Gaps = 33/484 (6%)

Query: 4   LQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVP 63
           +Q ++  M +  L      +        A+       DV      ++ + +++ + +QV 
Sbjct: 1   MQGSWLRMGAAALSCLGALLLTSLAADAAD----RFIDVSNPSVHRVFLPMSQSVTIQVN 56

Query: 64  VDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHL 123
            ++ D++V D   AD    + RT+Y+ GK  G   V L   D + +  + I +  D++ +
Sbjct: 57  ANLGDIVVGDEKIADAQPMTDRTLYVIGKGAGTTTVNLFSTDKRSLGVIQIEVGVDVSDM 116

Query: 124 EMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKK 183
              +R+    S I +  ++  V L G V+     +  +++++ +                
Sbjct: 117 AQAIRQVSPRSRIEIGSINGKVRLGGHVKDGATLEAIMQVAQQY------------GPDA 164

Query: 184 VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEG- 242
           ++N + +    QV L+V + E +R+  + +G      GSS+    +  A         G 
Sbjct: 165 IINSVTVDDSQQVNLEVRVLEAKRNAGRDLGVSFRSRGSSATIFGTGIAATTPPGADPGT 224

Query: 243 ------------GDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSG 290
                            + +      + ++ ALE    +RTLA P LT +SG+ ASF +G
Sbjct: 225 LVTGLLSKTNPFASLITQIIDSNIKVDLIIEALEAKGVVRTLANPNLTTLSGEPASFNAG 284

Query: 291 GQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGDMPS 350
           GQ   ++V +  G   +    +GV L FTP VL+  +I + +  EVS+     +AGD P 
Sbjct: 285 GQVPIRSV-TKDGLIQIEYKQFGVNLQFTPIVLADDKIHISLAPEVSDLTGFTSAGD-PI 342

Query: 351 YRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEI 410
           +  RK DT VEL  G +  + GLL     +L+  +P L ++P++G LFRNS   +EETE+
Sbjct: 343 FTNRKLDTVVELRDGQSFAVGGLLSSKTTKLQNQVPWLGQVPVIGTLFRNSSNQKEETEL 402

Query: 411 FIAATPFLVKPVAM-RDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAI 469
            +  TP +V+PV     L+ P D     +D + F   ++  +          G    G  
Sbjct: 403 VVIVTPHIVRPVKPGEQLATPFDKTRPANDPEFFVLGQLE-VNKDMIRKYETGDGVTGPY 461

Query: 470 GFIY 473
           G + 
Sbjct: 462 GHML 465


>gi|78062906|ref|YP_372814.1| type II and III secretion system protein [Burkholderia sp. 383]
 gi|77970791|gb|ABB12170.1| type II and III secretion system protein [Burkholderia sp. 383]
          Length = 460

 Score =  312 bits (799), Expect = 9e-83,   Method: Composition-based stats.
 Identities = 141/489 (28%), Positives = 226/489 (46%), Gaps = 45/489 (9%)

Query: 1   MRYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIIL 60
           M  + R         + +S  + A+     +A AA              +SI   K  +L
Sbjct: 1   MVRMVRWIACWCLACIVASGSAFAQGARAPDAGAA--------------LSIATGKGELL 46

Query: 61  QVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDI 120
            +P     + V+DP  AD+ V SPRT+++FGK  G   +I +G + + +L   ++++ D 
Sbjct: 47  SLPEPATAMFVADPAIADIQVPSPRTVFVFGKKAGTTTLIALGANHRPILRKTVIVQVDT 106

Query: 121 AHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSS 180
           A L+  L        + V     ++++ G V +  D+   ++    +L            
Sbjct: 107 ASLQGVLDSRFPQLKLSVSGAPGSLMVSGKVPSAADADAVMQSLTPYLHDK--------- 157

Query: 181 SKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKS-------FAAD 233
            +K++N L ++   QV L+V + EV R+I +Q+G   S  G +             F   
Sbjct: 158 -EKIVNRLTLSRPIQVNLRVRVTEVSRNITQQLGINWSSLGGAGNFVGGLFNGRTLFDPT 216

Query: 234 FGGKFVSEGGDFSVKGVL--DRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGG 291
            G   +S  G FSV G     R+S + VL AL++   I  LAEP LTA+SG++ASF +GG
Sbjct: 217 NGLFNLSPTGAFSVLGGFRAGRWSIDVVLDALDQEGLITMLAEPNLTAMSGETASFLAGG 276

Query: 292 QHLYKTVS--SSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEP----VIGVNA 345
           +         SSTGA +V    +GV L FTPTVL+  RI L+++ EVSE      +    
Sbjct: 277 EIPIPVAQAGSSTGAITVEFKPFGVSLDFTPTVLADNRISLKVRPEVSEIDTNNSVTTGG 336

Query: 346 GDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNR 405
             +P   VR+ DTTVEL SG +  + GLL+         IP L ++PI+G LF +  F  
Sbjct: 337 VKVPGLTVRRVDTTVELSSGQSFAIGGLLQSQTADTVSQIPGLGRLPIIGRLFSSKNFQD 396

Query: 406 EETEIFIAATPFLVKPVAMRDLSRPDDHYSVE-DDAKAFFFNRVNKIYGPKEASEVEGQN 464
            +TE+ +  TP++V+P     L +  D  +    D +    + +       +        
Sbjct: 397 NKTEVVVIVTPYIVQPTGPGQLEQAIDTVARPSSDLEFAVQHNLGLDLLSGDT-----PR 451

Query: 465 YKGAIGFIY 473
             GA GF+Y
Sbjct: 452 LVGAAGFVY 460


>gi|16127175|ref|NP_421739.1| pilus assembly protein CpaC [Caulobacter crescentus CB15]
 gi|221235976|ref|YP_002518413.1| outer membrane pilus secretion channel cpaC [Caulobacter crescentus
           NA1000]
 gi|7208425|gb|AAF40192.1|AF229646_4 CpaC [Caulobacter crescentus CB15]
 gi|13424571|gb|AAK24907.1| pilus assembly protein CpaC [Caulobacter crescentus CB15]
 gi|220965149|gb|ACL96505.1| outer membrane pilus secretion channel cpaC [Caulobacter crescentus
           NA1000]
          Length = 560

 Score =  312 bits (798), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 142/502 (28%), Positives = 236/502 (47%), Gaps = 70/502 (13%)

Query: 32  ANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFG 91
           A   V  I          + +   K  I+++P +V+D+LV++P  AD V+   R +Y+ G
Sbjct: 70  AEDQVARIVMTADQTAATLELAKGKSAIVELPSEVRDLLVTNPQIADAVLRDKRRIYIVG 129

Query: 92  KNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMV 151
              G  +       G+++L+L I + + +  L   L + + D+ I V  + D+VVL G V
Sbjct: 130 LAEGTTDAAFFDTAGRRILSLSIRVSQPVDQLAAMLGKILPDAKITVSPIRDSVVLSGTV 189

Query: 152 RTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILK 211
           RT  +++ A  ++  F+             +KV+N++++AG+DQV L+V I EV+R+++K
Sbjct: 190 RTASEAESAARIAAQFVGS----------PEKVLNMISVAGKDQVMLQVRIVEVQRNVIK 239

Query: 212 QIGFQHSI-------------TGSSSGPSKSFAADF------------------------ 234
           Q+G   +                   G + S                             
Sbjct: 240 QLGVDLNAVIGQLGETQYTFGMAPGYGVNGSLLGGVTGGYKMDTTKQPVMQTPCTGPGWT 299

Query: 235 ----------GGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQS 284
                     GG         S  G     S + ++ A ER   +RTLAEP L A+SG+S
Sbjct: 300 AGSLCPVVARGGGNSDTATIQSTAGDPGLNSAKGMIQAFERVGLVRTLAEPNLAAVSGES 359

Query: 285 ASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVI--- 341
             F  GG+    T S ++G  ++    YGV L +TP VLS GRI L++ TEVSE      
Sbjct: 360 GKFLVGGEFPVPTGSDTSGKVTIEFKPYGVGLGYTPVVLSGGRISLKLSTEVSELSSLGA 419

Query: 342 ---------GVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIP 392
                    G     +P   VR+ ++TVELPSGG+++LAGLL+   ++  + +P ++ +P
Sbjct: 420 FSMSTGTSSGSTNLTVPGLSVRRVESTVELPSGGSLMLAGLLQQTTKETIDSLPGMTSMP 479

Query: 393 ILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIY 452
           ILG+LFR+  F   +TE+ +  TP+++ P   ++L  P D      D       R+NK+ 
Sbjct: 480 ILGSLFRSRDFLNNQTELVVIITPYIIDPTRPQNLQTPADGLQFASDMGTVLLGRLNKVV 539

Query: 453 GPKEASEVEGQNYKGAIGFIYK 474
               A    G+ Y+G +G++ +
Sbjct: 540 KAP-AGANAGRAYQGPVGYVIE 560


>gi|83312840|ref|YP_423104.1| Flp pilus assembly protein, secretin CpaC [Magnetospirillum
           magneticum AMB-1]
 gi|82947681|dbj|BAE52545.1| Flp pilus assembly protein, secretin CpaC [Magnetospirillum
           magneticum AMB-1]
          Length = 495

 Score =  312 bits (798), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 144/461 (31%), Positives = 245/461 (53%), Gaps = 24/461 (5%)

Query: 27  PPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRT 86
                      ++  +     + + + + K I L +P  V++V++ +   ADV+V +P  
Sbjct: 46  AAPSPRPGTPQSLRGLSSAAAESMQVPVGKSIDLPLPGAVKEVVIGNSDIADVIVRTPHM 105

Query: 87  MYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSN-IRVEMVSDTV 145
           +++ G+ VGQ NV L+   G+ M  +D+ +  D   ++  LR  + +   I VE V+D++
Sbjct: 106 VHITGRAVGQTNVFLMDRSGRVMRRIDLAVAIDSQAVKDALRAVLPEERAITVEAVADSL 165

Query: 146 VLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEV 205
            L G V+    ++ A  ++  F++  G          K++N++ +  E QV L V +AE+
Sbjct: 166 YLSGSVKNDGAARDAKMVARRFVADDG----------KLVNMIRVVNEQQVLLHVKVAEI 215

Query: 206 RRDILKQIGFQH------SITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETV 259
           +R +LK++GF        S+ G++S  S + ++  G    S    F    V    +    
Sbjct: 216 QRTVLKELGFGLTANKSISLPGTASLSSFTTSSTVGLIDSSSTAIFGTATVTGLGALAAN 275

Query: 260 LHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFT 319
            + LE    IRTL EP LTA+SG++A+  +GG+     VS++ G+ SV    YGV+L FT
Sbjct: 276 FNILENQGLIRTLVEPNLTAVSGETATMLAGGELPIP-VSTTNGSISVEFKPYGVLLSFT 334

Query: 320 PTVLSPGRIGLRIQTEVSEPVIG-----VNAGDMPSYRVRKADTTVELPSGGTIVLAGLL 374
           P VL PGR+ L++ TEVS               +P+++VR+A +TVELPSGG+I++AGLL
Sbjct: 335 PVVLDPGRLSLKMSTEVSAIDTANKTAITTTISVPAFKVRRAGSTVELPSGGSIMIAGLL 394

Query: 375 KDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHY 434
           ++DI     G+P L  +P+LGALFR++ F R ETE+ +  + ++++PV   +LS P+D +
Sbjct: 395 QNDITANIAGLPGLMDLPVLGALFRSNAFQRNETELVVILSAYVIRPVDQPNLSTPNDGF 454

Query: 435 SVEDDAKAFFFNRVNKIYGPKEASEV-EGQNYKGAIGFIYK 474
           +   D K F   R+   Y  +   E       +G  G I +
Sbjct: 455 APSSDLKRFLLGRLQDTYTTRGKGEPAAPPALQGPYGHIVQ 495


>gi|82703477|ref|YP_413043.1| type II and III secretion system protein [Nitrosospira multiformis
           ATCC 25196]
 gi|82411542|gb|ABB75651.1| type II and III secretion system protein [Nitrosospira multiformis
           ATCC 25196]
          Length = 574

 Score =  311 bits (797), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 130/503 (25%), Positives = 216/503 (42%), Gaps = 49/503 (9%)

Query: 8   FFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIG-------KGKKISIGLNKVIIL 60
              ++ I L  S    A              ++  +             + +   K  +L
Sbjct: 41  ITVLLGITLGLSGELSAANQTAAGQAMGRPMVAAAKPAGPVEGLLAASDMDVTYGKSALL 100

Query: 61  QVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDG----KQMLNLDILI 116
           ++P  V  + V +P  ADV + SP  +Y+ GK++G  NVIL    G     Q   +++ +
Sbjct: 101 RLPAPVTRISVGNPDVADVTLISPGEIYVLGKSIGTTNVILWTRGGLAGSSQTAVINVTV 160

Query: 117 ERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQ----- 170
             D A L+  LR  +    +I+V    D++VL G V     + RAV L++ ++       
Sbjct: 161 ILDAAALQAKLRELMPGETDIKVTAAGDSLVLSGTVSDTLKADRAVALADAYVRAAAGGQ 220

Query: 171 --------------------SGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDIL 210
                                 +       S +V+NLL +    QV L+V +AE+ R + 
Sbjct: 221 GGQRGGKQGGDASGGQGGGDEPKGAGQGLGSVQVVNLLQVGSNQQVMLEVKVAEINRKVA 280

Query: 211 KQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIR 270
           +++GF        +G + +      G      G               ++ A ++     
Sbjct: 281 ERLGFDFQRAARKAGSAWTQI--MTGIIGGAPGMLFQSRGTPEIGDAFLIDAEKKDELFH 338

Query: 271 TLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGL 330
            LAEP + AISGQ ASF  GG+ +      +   T + +  +GV L FTPTVL  GRI L
Sbjct: 339 ILAEPNIVAISGQEASFLVGGEVMIPIPQYAGVIT-LQSRQFGVGLRFTPTVLEEGRINL 397

Query: 331 RIQTEVSEPVIGVNAGD--------MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLK 382
            +  EV+E V               +P++  R+  TTV+L  G ++ + GLL+D+I++  
Sbjct: 398 VVSPEVTELVKFDTIATTGLGGVLAVPTFTTRRVSTTVQLRDGQSLAIGGLLQDNIKETI 457

Query: 383 EGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKA 442
           +  P+L +IPILGALFR+S F +++TE+ +  TP L+KP+   D + P D +   D    
Sbjct: 458 KRFPVLGEIPILGALFRSSDFQKDKTELMVVVTPRLIKPLQP-DYALPTDAFVQPDRPDF 516

Query: 443 FFFNRVNKIYGPKEASEVEGQNY 465
            F  R+           +    Y
Sbjct: 517 LFDGRMEGSPTGLLPKGMPASEY 539


>gi|46201037|ref|ZP_00207939.1| COG4964: Flp pilus assembly protein, secretin CpaC
           [Magnetospirillum magnetotacticum MS-1]
          Length = 480

 Score =  311 bits (796), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 146/468 (31%), Positives = 238/468 (50%), Gaps = 26/468 (5%)

Query: 22  SVAKLPPIKEANAAVINISDVEIGK-GKKISIGLNKVIILQVPVDVQDVLVSDPTKADVV 80
             A   P +   A              + + + + K + L +P  V++V++ +   ADV+
Sbjct: 24  LGAPSGPGQAQRAGTPRSLLGATAASAESMQVPVGKSVDLTLPGAVREVVIGNSDIADVM 83

Query: 81  VHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSN-IRVE 139
           V SP  +++ G+ VGQ NV L+   G+ M  +D+ +  D   +   LR  + D   I VE
Sbjct: 84  VRSPNLVHITGRAVGQTNVFLVDRAGRVMRRIDLNVSIDSQAVRDALRAVLPDERAINVE 143

Query: 140 MVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLK 199
            V+D++ L G V+    ++ A  L+  F+++            K++NLL +  E QV L 
Sbjct: 144 AVADSLYLSGSVKNDAAARDAKMLARRFVAEDA----------KLVNLLRVVNEQQVLLH 193

Query: 200 VTIAEVRRDILKQIGFQHSIT-------GSSSGPSKSFAADFGGKFVSEGGDFSVKGVLD 252
           V +AE++R +LK++GF  +          S  G     ++  G    S    F    +  
Sbjct: 194 VKVAEIQRTVLKELGFGLTANKGIPLIGSSVLGSGSKTSSTVGLIDSSSTAIFGTATITG 253

Query: 253 RFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDY 312
             +    L+ LE    IRTL EP LTA+SG++A+  +GG+        + GA SV    Y
Sbjct: 254 IGALAANLNILENQGLIRTLVEPNLTAVSGETATMLAGGELPIPIS-QTNGAVSVEFKPY 312

Query: 313 GVVLHFTPTVLSPGRIGLRIQTEVSEPVIGV-----NAGDMPSYRVRKADTTVELPSGGT 367
           GV+L FTPTVL PGR+ L++ TEVS           ++  +P+++VR+A +TVELPSGG+
Sbjct: 313 GVLLSFTPTVLDPGRLSLKMSTEVSAIDNNNKTAISSSISVPAFKVRRAGSTVELPSGGS 372

Query: 368 IVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDL 427
           I++AGLL++DI     G+P L  +P+LG LFR++ F R ETE+ +  + ++V+PV    L
Sbjct: 373 IMIAGLLQNDITSNITGLPGLMDLPVLGLLFRSNAFQRNETELVVILSAYVVRPVEQPVL 432

Query: 428 SRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVE-GQNYKGAIGFIYK 474
             P+D ++   D K F   R+   Y  +         + +G  G I +
Sbjct: 433 GTPNDGFAPSSDLKRFLLGRLQDTYTKRSRELPATPPSLQGPYGHIVQ 480


>gi|114799376|ref|YP_761691.1| pilus assembly protein CpaC [Hyphomonas neptunium ATCC 15444]
 gi|114739550|gb|ABI77675.1| pilus assembly protein CpaC [Hyphomonas neptunium ATCC 15444]
          Length = 535

 Score =  311 bits (796), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 148/541 (27%), Positives = 250/541 (46%), Gaps = 77/541 (14%)

Query: 5   QRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPV 64
            RT   +    + +  P+   L                +    +++++G++K +I+ +  
Sbjct: 1   MRTIKALTCAAIVAILPAPFALAQTIPNGMGTSITKPGDQAVSRRVTLGVDKSMIVDLEA 60

Query: 65  DVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLE 124
              DV++S+P  AD VV + + +   G   GQ N ++    G  +L+L+I++E D+A LE
Sbjct: 61  PAADVVISNPEIADAVVQTAQRIIFRGIKFGQTNALIFDRAGNTLLDLNIMVETDLAALE 120

Query: 125 MTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKV 184
            T+ R I D+ +++E  + +V+L GMV  +  S +  +L + F  +S           ++
Sbjct: 121 ETISRHIPDARVKIESFNGSVILTGMVDNLSQSDQVSQLVKAFFPESAGGGEL-----QI 175

Query: 185 MNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSI------------------------- 219
           +N+LN+   DQV L+V I E++R ++KQ+G   S                          
Sbjct: 176 VNMLNVNAADQVMLEVRIVEMQRSVIKQLGINLSGATSFGELANQTLQQVFQGGLPLFFD 235

Query: 220 ---------------------------TGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLD 252
                                         S+    +      G    E G  +      
Sbjct: 236 PDSGEYNTTGQGTAVEMLQPAGPSSNTISGSASSGFNVQGQALGGISLETGYTNYNNGRL 295

Query: 253 RFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDY 312
           + S    + A+ER   +RTLAEP + A+SG+SA F +GG+       +  G  +V    Y
Sbjct: 296 QSSIGAAIDAMERVGIVRTLAEPNIVAMSGESAKFLAGGEFPVPVGQNQNGQITVEFKPY 355

Query: 313 GVVLHFTPTVLSPGRIGLRIQTEVSEPVIG-------------------VNAGDMPSYRV 353
           GV L FTP VLS GRI L++ TEVSE                       +    +P+  V
Sbjct: 356 GVGLAFTPVVLSEGRISLKVSTEVSELTSQGAFQGAAQTITDGDGNTTIIQGATLPALSV 415

Query: 354 RKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIA 413
           R+A++ VELPSGG++++AGL+    +Q  + +P L K+PILG+LF++  F  EETE+ + 
Sbjct: 416 RRAESVVELPSGGSMMMAGLISVKDRQTIDQLPGLKKLPILGSLFQSRDFLSEETELVVM 475

Query: 414 ATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIY 473
            TP+LV       +  P D Y+   DAK  FF ++N+ YG   A  ++  +Y+  +GF+ 
Sbjct: 476 VTPYLVGATNKASMVTPADGYANASDAKTIFFGKLNETYGRDGAP-IKPDDYRAPVGFME 534

Query: 474 K 474
           +
Sbjct: 535 E 535


>gi|325525578|gb|EGD03368.1| flp type pilus assembly protein [Burkholderia sp. TJI49]
          Length = 545

 Score =  310 bits (794), Expect = 3e-82,   Method: Composition-based stats.
 Identities = 122/433 (28%), Positives = 214/433 (49%), Gaps = 18/433 (4%)

Query: 42  VEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVIL 101
             + +   +S+ L K +++ +P  V++  + +P  A   + SP+T+Y+ G +VG  N+I+
Sbjct: 91  GAVRESSSVSVPLGKSLLVPMPEPVRNRTIGNPAVAQATMVSPQTLYILGLSVGTTNMIV 150

Query: 102 IGHDGKQMLNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRA 160
            G  G     +D+ +  D   L+ +L++ + +  +I V   + T+VL G V   Q +Q+A
Sbjct: 151 QGRSGACR-VIDVAVGADAGGLQTSLQQLMPNERDIHVSTAAGTIVLAGSVSNSQAAQQA 209

Query: 161 VELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSIT 220
           V ++  +   +G           V+N+L++    QV L+V +AEV + ++ Q+G   +I 
Sbjct: 210 VAIARAYGDSAGSGDAGGKPGSGVLNMLSVTSPQQVMLEVKVAEVSKTLINQLGSAFNIQ 269

Query: 221 GSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAI 280
           G     S +  ++      S           +R  F+    A      ++ LAEP L  I
Sbjct: 270 GGFGSWSGALVSNLLAGVASG----IAVSKSNRRPFQIAADAQNTDNLVKILAEPNLVTI 325

Query: 281 SGQSASFTSGGQHLYKTVSSSTGATSV---TTHDYGVVLHFTPTVLSPGRIGLRIQTEVS 337
           SGQ A+F +GG+       SS G  +       ++GV L FTPTVL+ GRI L++  EVS
Sbjct: 326 SGQEATFLAGGKIFIPVPQSSGGNATTITLQEEEFGVALKFTPTVLANGRISLKVAPEVS 385

Query: 338 EPVIG---------VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLL 388
           E               A  +P    R+A TTV++  G +  + GL+KD++    + IP +
Sbjct: 386 ELSSTGVTLSATNVSGASILPLITTRRASTTVQMNDGESFAIGGLIKDNVTGALKAIPGV 445

Query: 389 SKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRV 448
            ++P+LGALFR++ F ++ TE+    TP LVKP+ + D+  P D +S  ++A  +    +
Sbjct: 446 GEVPVLGALFRSTSFQQDRTELIFLITPHLVKPMQIADVPLPTDSFSKPNEADVYATGNM 505

Query: 449 NKIYGPKEASEVE 461
               G +      
Sbjct: 506 EGRRGVRRQGAEA 518


>gi|167589424|ref|ZP_02381812.1| type II and III secretion system protein [Burkholderia ubonensis
           Bu]
          Length = 460

 Score =  310 bits (794), Expect = 3e-82,   Method: Composition-based stats.
 Identities = 135/488 (27%), Positives = 226/488 (46%), Gaps = 43/488 (8%)

Query: 1   MRYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIIL 60
           M  + R         + +   + A+   + +A A               +++   K  +L
Sbjct: 1   MVRMVRWIALWCMACVAAPGVAFAQRASVPDAGAP--------------LTLAAGKGDLL 46

Query: 61  QVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDI 120
            +P     + V+DP+ AD+ V SPRT+++FGK  G   +I +G + + +L   ++++ D 
Sbjct: 47  SLPEPAATMFVADPSIADIQVPSPRTVFVFGKKAGTTTLIALGANHRPILRRTVIVQADT 106

Query: 121 AHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSS 180
             L+  L        ++V     ++++ G V +  D+   ++    +L            
Sbjct: 107 PSLQRVLDSRFPQWQLKVSGAPGSLMVSGKVPSGADADAVMQSLAPYLQDK--------- 157

Query: 181 SKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKS-------FAAD 233
            +K++N L ++   QV L+V + EV R+I +Q+G   S  G S             F   
Sbjct: 158 -EKLVNRLTLSRPIQVNLRVRVTEVSRNITQQLGINWSGLGGSGNFIGGLFNGRTLFDPT 216

Query: 234 FGGKFVSEGGDFSVKGVL--DRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGG 291
                +S  G FSV G     R+S + VL AL++   I  LAEP LTA+SG++ASF +GG
Sbjct: 217 TSLFNLSPTGAFSVLGGFRAGRWSIDVVLDALDQEGLITMLAEPNLTAMSGETASFLAGG 276

Query: 292 QHLYKTVSS--STGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGD-- 347
           +       S  +TGA +V    +GV L FTPTVL+  RI L+++ EVSE     +     
Sbjct: 277 EIPIPVAQSGTTTGAITVEFKPFGVSLDFTPTVLAENRISLKVRPEVSEIDPTNSVTTGG 336

Query: 348 --MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNR 405
             +P+  VR+ +TTVEL SG +  + GLL+     +   IP L ++P+LG LF +  F  
Sbjct: 337 VKVPALSVRRVETTVELSSGQSFAIGGLLQSQTSDVVSQIPGLGRLPVLGRLFSSKNFQD 396

Query: 406 EETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNY 465
            +TE+ +  TP++V+P     L +  D  +       F   R   +         +    
Sbjct: 397 NKTEVVVIVTPYIVQPAGPGQLEQAIDTVARPSSDLEFAVQRNLGLDLLSG----DTPRL 452

Query: 466 KGAIGFIY 473
            GA GF+Y
Sbjct: 453 VGAAGFVY 460


>gi|12620550|gb|AAG60826.1|AF322012_131 RhcC2 [Bradyrhizobium japonicum]
          Length = 484

 Score =  310 bits (794), Expect = 4e-82,   Method: Composition-based stats.
 Identities = 127/476 (26%), Positives = 211/476 (44%), Gaps = 21/476 (4%)

Query: 4   LQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVP 63
           L R  + +    L    P  A     ++    +   +         ++I  ++   + + 
Sbjct: 25  LNRLCYLLCGFALL--FPLAASAETKRDGKGEMPRAAPG--STTGTLNITSSQGKTVHLS 80

Query: 64  VDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHL 123
                + V+DP  AD    S  T+++FGK  G+ ++  +  +G+ +  L I++ + +  L
Sbjct: 81  APAATIFVADPAIADYQAPSSSTIFVFGKKSGRTSLFALNENGEALAELRIVVTQPLEDL 140

Query: 124 EMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKK 183
              L+  + D  I+V       +L G+       + A +++E F+           +   
Sbjct: 141 RAALKAEVGDYPIQVSYTPRGAILSGIAPNADVVEAARKVTEQFVG----------AGAP 190

Query: 184 VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGG 243
           V+N + +AG  QV L V +AEV R  +K +    + +G + G   +     G      GG
Sbjct: 191 VVNKIQVAGSLQVNLSVRVAEVSRTAVKDLNINFTASGPN-GAFLATGKPGGSGRAGGGG 249

Query: 244 DFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTG 303
              +       +   VL AL        LAEP LTA+SG++ASF +GG+     V     
Sbjct: 250 TIGIGFSTGNINLSAVLDALASEHLASILAEPNLTAMSGEAASFLAGGEFPIP-VMQDNR 308

Query: 304 ATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIG----VNAGDMPSYRVRKADTT 359
             SV    +GV L F PTVLS  +I +R++ EVSE        +N   +P+   R+A T 
Sbjct: 309 QVSVQFRQFGVSLEFVPTVLSNNQIIVRVKPEVSELSTEGEVKINGMAVPALSTRRASTV 368

Query: 360 VELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLV 419
           VEL SG +  + GL++ +        P L  +PILGALFR+S F + ETE+ I  TP++V
Sbjct: 369 VELASGQSFAIGGLIRRNFNTDIGEFPWLGDVPILGALFRSSSFQKRETELVIVVTPYIV 428

Query: 420 KP-VAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
           +P      +S P +  +   DA     N V +    ++A         G  GFI +
Sbjct: 429 RPGSNPSQISIPTNRIAPPSDAGRILTNTVARPPQGRDAPRASAPGLTGNAGFIIE 484


>gi|148976662|ref|ZP_01813349.1| Flp pilus assembly protein, secretin CpaC [Vibrionales bacterium
           SWAT-3]
 gi|145964013|gb|EDK29271.1| Flp pilus assembly protein, secretin CpaC [Vibrionales bacterium
           SWAT-3]
          Length = 456

 Score =  309 bits (792), Expect = 5e-82,   Method: Composition-based stats.
 Identities = 111/438 (25%), Positives = 196/438 (44%), Gaps = 27/438 (6%)

Query: 52  IGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLN 111
           +  +K   + +      V + DP   D+V+     ++L GK +G  N++     G+ + +
Sbjct: 1   MPHHKSTHVVLSGKASKVSLGDPEVLDIVILKSNEVFLIGKKLGATNLMAWDARGQLIES 60

Query: 112 LDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQS 171
           ++I +  D+  L+  L  F+ D  I V    + ++L G +   Q    A+ ++ET+ +  
Sbjct: 61  INIEVTHDLNSLKAKLYEFLPDETIEVHSAQNRLLLSGQISNQQKMNVAMRIAETYAAGQ 120

Query: 172 GRNQYANSSSKK-----VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGP 226
             ++   S S++     V+NL++I G  QV L+VT+AEV+R ++++         +S   
Sbjct: 121 AADETKESGSEQAAATGVINLMSIGGAQQVMLEVTVAEVQRSLVRKFDANFHFFQTSGSN 180

Query: 227 SKSFAADFGGKFVSEGGDFSVKGVLD----------RFSFETVLHALERATAIRTLAEPT 276
                A      +     F +    D             F   L   ++    + LAEP 
Sbjct: 181 FSWGGASVPAGVLGATPIFDIPTSTDYGILGSFIDSNTLFTFALDVSKQNGVAKVLAEPN 240

Query: 277 LTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEV 336
           LTA+SG  A F +GG+             ++   +YGV L F PTVLS  +I L +  +V
Sbjct: 241 LTALSGSKAEFLAGGEFPIPVP--DDDGITIEYKEYGVGLKFIPTVLSDQKINLNLAVDV 298

Query: 337 S----------EPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIP 386
           S          +P        +P    R A +T+EL  G TI +AGLL ++++ +   + 
Sbjct: 299 SEIANSSSLTIDPGTTNATYFIPPITRRSASSTLELADGQTIGIAGLLSENVRDISNKML 358

Query: 387 LLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFN 446
            +  +PILG LF +  +   ETE+ I  TP L KPV    ++ P D +   +D + +   
Sbjct: 359 GIGDVPILGQLFNSQEYVSGETELVILVTPRLAKPVDRSKVTLPTDAFVDPNDLEYYLLG 418

Query: 447 RVNKIYGPKEASEVEGQN 464
           R   I  P ++ +    +
Sbjct: 419 RSAYIAEPSDSEDNSSAS 436


>gi|115361033|ref|YP_778170.1| type II and III secretion system protein [Burkholderia ambifaria
           AMMD]
 gi|115286361|gb|ABI91836.1| type II and III secretion system protein [Burkholderia ambifaria
           AMMD]
          Length = 657

 Score =  309 bits (792), Expect = 6e-82,   Method: Composition-based stats.
 Identities = 119/434 (27%), Positives = 211/434 (48%), Gaps = 18/434 (4%)

Query: 42  VEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVIL 101
             +     +++ L K +++ +P  V++  + +P  A   + SP+T+Y+ G +VG  N+I+
Sbjct: 92  GAVRDATSVTVPLGKSLLVPMPEPVRNRTIGNPAVAQATMVSPQTLYILGLSVGTTNMIV 151

Query: 102 IGHDGKQMLNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRA 160
            G  G     +D+ +  D   L+ +L++ +    +I V   + T+VL G V   Q +Q+A
Sbjct: 152 QGRSGACR-VIDVAVGADAGGLQSSLQQLMPGERDIHVSTAAGTIVLAGTVSNSQAAQQA 210

Query: 161 VELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSIT 220
           V+++  +   +G           V+N+L +    QV L+V +AEV + ++ Q+G   +I 
Sbjct: 211 VQIAHAYSDSAGEGAGGAGKGAGVLNMLAVTSPQQVMLEVKVAEVSKTLINQMGTAFNIQ 270

Query: 221 GSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAI 280
           G     S +  ++      S G    +    +   F     A      ++ LAEP L  I
Sbjct: 271 GGFGSWSGALVSNLLAGVASAG----IFNKANNKPFSVAADAQNTDNLVKILAEPNLVTI 326

Query: 281 SGQSASFTSGGQHLYKTVSSSTGAT---SVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS 337
           SGQ A+F +GG+       SS   T   ++   ++GV L FTPTVL+ GRI L++  EVS
Sbjct: 327 SGQEATFLAGGKIFIPVPQSSGTGTSSITLQEEEFGVALKFTPTVLANGRISLKVAPEVS 386

Query: 338 EPVIG---------VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLL 388
           E                  +P    R+A TTV++  G +  + GL+KD+     + IP +
Sbjct: 387 ELSQTGVTLSATNIGGTSILPLITTRRASTTVQMSDGESFAIGGLIKDNASGSLKAIPGV 446

Query: 389 SKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRV 448
            ++P+LGALFR++ F ++ TE+    TP LV+P+   D+  P D +S   +   +    +
Sbjct: 447 GEVPVLGALFRSTSFQQDRTELIFLITPHLVRPLQTADVPLPTDSFSKPSEIDVYATGNM 506

Query: 449 NKIYGPKEASEVEG 462
               G ++A+    
Sbjct: 507 EGRKGVRKATMQPS 520


>gi|170750189|ref|YP_001756449.1| type II and III secretion system protein [Methylobacterium
           radiotolerans JCM 2831]
 gi|170656711|gb|ACB25766.1| type II and III secretion system protein [Methylobacterium
           radiotolerans JCM 2831]
          Length = 546

 Score =  309 bits (792), Expect = 6e-82,   Method: Composition-based stats.
 Identities = 148/497 (29%), Positives = 244/497 (49%), Gaps = 55/497 (11%)

Query: 33  NAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGK 92
            A V+ +   E    +++ +   + +I+ +P D ++V V++P  A+ VV S R +++ G 
Sbjct: 50  PAPVLTVGAAEANTTRRVELTAGRSVIVDLPRDAKEVFVANPAVANAVVRSTRKVFVIGM 109

Query: 93  NVGQANVILIGHDGKQMLNLDILIERDIA--HLEMTLRRFIADSNIRVEMVSDTVVLHGM 150
             G  ++ ++  +G+Q+  LD+ + RD+    L   L + I      V     +V+L G 
Sbjct: 110 ADGATSIFIMDAEGRQIAALDVTVARDLNLGTLRELLSQSIPGGRFDVRSSGASVLLSGA 169

Query: 151 VRTIQDSQRAVELSETFLSQSGRNQYANS----------SSKKVMNLLNIAGEDQVTLKV 200
           V +  D+Q+A++++  F+   G      +          S   V+N L I  +DQV L+V
Sbjct: 170 VNSSSDAQQAIDIANAFVGLGGGGAAGPAGAASGGVAAGSRGAVINNLTIRNKDQVMLRV 229

Query: 201 TIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSE------------------- 241
           T+ EV R++LKQ G   +   S+  P  +          +                    
Sbjct: 230 TVVEVSRNVLKQFGINMAGNWSALNPVGNLGQTVVNGGTAAATQVPAYLPNVITNNLPFP 289

Query: 242 -------GGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHL 294
                  G           FS +  L A E+A   R LAEPTLTAISG++A F +GG+  
Sbjct: 290 INTNTPSGNLIQASVQGGGFSLQATLKAFEQAGVSRILAEPTLTAISGEAAKFLAGGEFA 349

Query: 295 YKTVS----SSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVI--------G 342
               +        +  +T   YGV L FTPTVL+  RI +R+ T+V+E           G
Sbjct: 350 VPASATCAVGGVCSPGITYKPYGVALSFTPTVLADNRISIRVATDVTEIDTQQSFSYVIG 409

Query: 343 VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSR 402
             +  +P  RVR+++TTVELPSGG ++ AGL++   +Q   G+P L  +PILGALFR+  
Sbjct: 410 NTSVAVPGTRVRRSETTVELPSGGVMMTAGLIQQFNKQAIAGLPGLINLPILGALFRSRD 469

Query: 403 FNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVE- 461
           + R+ETE+ I  TP++ +P+  + +SRPDD++    D +     ++N+IYG         
Sbjct: 470 YQRQETELMIMCTPYIARPMEPKQVSRPDDNFVDASDGQTVLLGQINRIYGKVAPPGATA 529

Query: 462 ----GQNYKGAIGFIYK 474
               G+ Y+G +GFI +
Sbjct: 530 AAPLGRAYRGRVGFIVE 546


>gi|257141104|ref|ZP_05589366.1| type II and III secretion system protein [Burkholderia
           thailandensis E264]
          Length = 826

 Score =  308 bits (789), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 124/433 (28%), Positives = 216/433 (49%), Gaps = 21/433 (4%)

Query: 42  VEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVIL 101
             +G+   +S+ L K +++ +   V++  + +P  A   + SPRT+YL G +VG  N+I+
Sbjct: 94  GAMGESTSVSVPLGKSLLVPLDEPVRNRTIGNPAVAQATMVSPRTLYLVGMSVGTTNMIV 153

Query: 102 IGHDGKQMLNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRA 160
            G  G     +D+ +  D   L+ +LR+ +    +IRV   +DT+VL G V + Q +Q+A
Sbjct: 154 QGKSGACR-IIDVAVGADAGGLQASLRQLMPRERDIRVSTAADTIVLAGNVSSAQAAQQA 212

Query: 161 VELSETFLSQSGRNQYANSSSKK---VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQH 217
           V +++ +  ++               V+N+L +    QV L+V +AEV + ++ Q+G   
Sbjct: 213 VAIAKAYSDRTNAGALGGGGGGTRAGVLNMLTVTSPQQVMLEVKVAEVSKTLINQMGSAV 272

Query: 218 SITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTL 277
           ++ G     + +         ++  G+       ++      + A      ++ LAEP L
Sbjct: 273 NLQGGFGSWTGALVTSL----LTGVGNGIAVSKSNKLPLNGSIDAQNTDQPVKILAEPRL 328

Query: 278 TAISGQSASFTSGGQHLYKTVSSSTGATSV---TTHDYGVVLHFTPTVLSPGRIGLRIQT 334
             ISGQ A+F +GG+       SS   TS       ++GV L FTPTVLS GRI L++  
Sbjct: 329 VTISGQEATFLAGGKIFIPVPQSSGVGTSTITLQQEEFGVGLKFTPTVLSNGRINLKVAP 388

Query: 335 EVSEPVIGV---------NAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGI 385
           EVSE                  +P    R+A TTV++  G T  + GL+KD+ Q   + +
Sbjct: 389 EVSELSPTGVTLSAANVGGVSILPLITTRRASTTVQMNDGETFAIGGLIKDNAQGTLKAL 448

Query: 386 PLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFF 445
           P + ++P+LGALFR++ F ++ TE+    TP LVKP+A  D+  P D ++  ++A  +  
Sbjct: 449 PGIGELPVLGALFRSTSFQQDRTELVFIITPHLVKPLAAADVPLPTDSFTQPNEADVYAT 508

Query: 446 NRVNKIYGPKEAS 458
             +    G ++  
Sbjct: 509 GNMEGRGGLRQHG 521


>gi|220918104|ref|YP_002493408.1| type II and III secretion system protein [Anaeromyxobacter
           dehalogenans 2CP-1]
 gi|219955958|gb|ACL66342.1| type II and III secretion system protein [Anaeromyxobacter
           dehalogenans 2CP-1]
          Length = 477

 Score =  308 bits (789), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 131/491 (26%), Positives = 224/491 (45%), Gaps = 44/491 (8%)

Query: 11  MMSIFLFSSNPSVAKLPPIK-EANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDV 69
           M++  L +       LPP++  A A      D  +G G ++++   +  +L +  ++  V
Sbjct: 1   MIAHTLLALALFATPLPPVELAAGALPPLRIDRSVGAGSELALEAGQNRLLIISEEIGRV 60

Query: 70  LVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRR 129
            V+DP+ AD+ V +   + L  K+ G  ++ L     + +  + +++ R++  L   ++ 
Sbjct: 61  AVADPSVADLKVVTTNQLLLTAKSSGTTDLTLWNRSNEPL-VIALVVTRNLEPLRKQVKD 119

Query: 130 FIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLN 189
                 + +    + V+L G V  ++  +R VE+++               +K+V NL+ 
Sbjct: 120 LFPGEKVTITGAGELVILSGEVSDVRIPERLVEVAK-------------LHAKQVANLVK 166

Query: 190 IAGEDQVTLKVTIAEVRRDILKQIGFQH-----------SITGSSSGPSKSFAADFGGKF 238
           ++G  QV L+V  AEV R  L+QIG               +TG    P+       G   
Sbjct: 167 VSGNQQVQLEVRFAEVSRSGLRQIGVNLFHQSSNGEVVTGMTGRGIIPTDLGVPGTGTAG 226

Query: 239 VS---------EGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTS 289
                       G    V  +   F F  +L  LE+    +TLAEPTL  +SGQ A F +
Sbjct: 227 APPPIFRPQFNNGFSMFVSSLSGDFPFSAMLSLLEQNGLSKTLAEPTLVTLSGQQARFVA 286

Query: 290 GGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVI----GVNA 345
           GG+        S G T V    +G++L FTPTV++   I L ++ EVS+        +  
Sbjct: 287 GGELPIPLG-GSFGQTQVEWKKFGILLDFTPTVIAGDTIHLDLKAEVSDIDQSLAITIGG 345

Query: 346 GDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNR 405
             +P    R+++TT+ L  G +  +AGLL D ++   E +PLL  IPILGALFR++++ R
Sbjct: 346 TTIPGLTSRQSETTIRLGDGQSFAIAGLLSDRVRSQIERVPLLGSIPILGALFRSTQYKR 405

Query: 406 EETEIFIAATPFLVKPVAMRDL-SRPDDH-YSVEDDAKAFFFNRVNKIYGPKEASEVEGQ 463
           EE+E+ +  T  L +PVA   L   P +   +   D + F     +       ++    Q
Sbjct: 406 EESELLVVVTARLARPVAPHQLPPLPTERELNHPGDIELFLLGWDDGGKQVPRSAPSTRQ 465

Query: 464 NY--KGAIGFI 472
                GA GF+
Sbjct: 466 AGGPSGARGFV 476


>gi|261252087|ref|ZP_05944660.1| type II/IV secretion system secretin RcpA/CpaC associated with Flp
           pilus assembly [Vibrio orientalis CIP 102891]
 gi|260935478|gb|EEX91467.1| type II/IV secretion system secretin RcpA/CpaC associated with Flp
           pilus assembly [Vibrio orientalis CIP 102891]
          Length = 480

 Score =  308 bits (789), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 117/449 (26%), Positives = 198/449 (44%), Gaps = 31/449 (6%)

Query: 39  ISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQAN 98
           IS      GK +++  +K   + +    + V + DP   D+V+     ++L GK +G  N
Sbjct: 10  ISFAATQSGKIVTVPHHKSTHVTLAGKAKRVSLGDPDVLDIVMLKSDEVFLIGKKLGSTN 69

Query: 99  VILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQ 158
           ++     G+ + +++I +  D+  L+  L  F+ D  I+V      ++L G V +     
Sbjct: 70  LMAWDSRGQLIESINIEVTHDLNSLKAKLFEFLPDEEIKVHSAQHRLILSGQVSSQSVMN 129

Query: 159 RAVELSETFLSQSGRNQY-----ANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQI 213
            A+ ++ET+ +    ++         +S  V+NLL I G  QV L+VT+AEV+R ++++ 
Sbjct: 130 IALRVAETYSAGKEADKGKSSLSNQVNSTGVINLLTIGGAQQVMLEVTVAEVQRTLVRKF 189

Query: 214 GFQHSITGSSSGPSKSFAADFGGKFVSEGG--------------DFSVKGVLDRFSFETV 259
                   +S G         GG                           +     F   
Sbjct: 190 DANFHFFQTSGGEFSWGGTSAGGVIDDVNNVIGPIFNAPGVESTGLLGTFIDSNTLFTFA 249

Query: 260 LHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFT 319
           L   ++    + LAEP LTA+SG  A F +GG+      S      ++   +YGV L F 
Sbjct: 250 LDIAKQNGTAKVLAEPNLTALSGAKAEFLAGGEFPIPVPSEDG--ITIEYKEYGVGLKFI 307

Query: 320 PTVLSPGRIGLRIQTEVSEPVIGVN----------AGDMPSYRVRKADTTVELPSGGTIV 369
           PTVLS  +I L +  +VSE                   +P    R A +T+EL  G TI 
Sbjct: 308 PTVLSDKKINLNLAVDVSELATSTTLTLNPGATNGTYVIPPITRRSASSTLELADGQTIG 367

Query: 370 LAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSR 429
           +AGLL ++++ + E +P  S IP+LG +F +  +   ETE+ I  TP L KP+  R ++ 
Sbjct: 368 IAGLLSENVRDVVEEMPGFSDIPVLGQMFNSQEYISGETELVILVTPRLAKPIDRRRITL 427

Query: 430 PDDHYSVEDDAKAFFFNRVNKIYGPKEAS 458
           P + +   +D + +   R   I    E  
Sbjct: 428 PTESFVEPNDFEYYLLGRGAYIAPASEQK 456


>gi|254229332|ref|ZP_04922749.1| putative phospholipid-binding domain family [Vibrio sp. Ex25]
 gi|262393417|ref|YP_003285271.1| type II/IV secretion system secretin RcpA/CpaC associated with Flp
           pilus assembly [Vibrio sp. Ex25]
 gi|151938140|gb|EDN56981.1| putative phospholipid-binding domain family [Vibrio sp. Ex25]
 gi|262337011|gb|ACY50806.1| type II/IV secretion system secretin RcpA/CpaC associated with Flp
           pilus assembly [Vibrio sp. Ex25]
          Length = 487

 Score =  308 bits (789), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 121/437 (27%), Positives = 207/437 (47%), Gaps = 24/437 (5%)

Query: 37  INISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQ 96
           ++++   +  GK +++  ++   L +    + V + DP   D++V     ++L GK +G 
Sbjct: 16  LSVNAATVQSGKVVTVAHHQSTQLMISGQAKKVTLGDPEVLDILVLRSNELFLIGKKLGT 75

Query: 97  ANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQD 156
            NV +    G+ +   ++ +  D+  L+  L +F+ D NI V    + VVL G+V + Q+
Sbjct: 76  TNVSVWDRRGRLIEQFNVEVTHDLNTLKSKLYQFLPDENIEVHSAQEKVVLRGLVSSQQN 135

Query: 157 SQRAVELSETFLSQSGRNQYANSSSKK---VMNLLNIAGEDQVTLKVTIAEVRRDILKQI 213
              AV+++ETF      ++  +SS      V+NLL+I G  QVTL+VT+AEV+R ++++ 
Sbjct: 136 MDTAVKIAETFALGEAADEEDDSSKDDDSMVINLLSIGGAQQVTLEVTVAEVQRTLVRRF 195

Query: 214 GFQHSITGSSSGPSKSFAADFGGKFVSEGG---------DFSVKGVLDRFSFETVLHALE 264
                    S   +       GG                 F    +     F   L   +
Sbjct: 196 DSNFHFFQRSGDFTWGGTTAGGGIDGIGPILNVPTVEDFGFLGSFIDSNTLFTFALDVAK 255

Query: 265 RATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLS 324
           +    + LAEP+LTA+SG  A F +GG+      +      ++   +YGV L F P +LS
Sbjct: 256 QNGVAKVLAEPSLTALSGTQAEFVAGGEFPIPVPNEDG--ITIDYKEYGVQLDFVPFILS 313

Query: 325 PGRIGLRIQTEVSEPVIG----------VNAGDMPSYRVRKADTTVELPSGGTIVLAGLL 374
             RI L++   VSE                   +P    R A TT+EL  G TI +AGLL
Sbjct: 314 DKRINLKLNVNVSEISNSGVLTFNPNEVNATFFIPPITKRSAGTTIELADGQTIGIAGLL 373

Query: 375 KDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHY 434
            ++ + + +GIP  S +P+LG LF++  F   ETE+ I  TP L  P+  R ++ P D +
Sbjct: 374 SENARNVADGIPGASDLPVLGRLFKSEEFTSGETELVILVTPRLATPIDRRRITLPTDGF 433

Query: 435 SVEDDAKAFFFNRVNKI 451
              +D + +   +  ++
Sbjct: 434 VAPNDVEFYLLGKGAEL 450


>gi|269966892|ref|ZP_06180965.1| Flp pilus assembly protein [Vibrio alginolyticus 40B]
 gi|269828559|gb|EEZ82820.1| Flp pilus assembly protein [Vibrio alginolyticus 40B]
          Length = 487

 Score =  308 bits (789), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 121/437 (27%), Positives = 205/437 (46%), Gaps = 24/437 (5%)

Query: 37  INISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQ 96
           ++++      GK +++  ++   L +    + V + DP   D++V     ++L GK +G 
Sbjct: 16  LSVNAATAQSGKVVTVAHHQSTQLMISGQAKKVTLGDPEVLDILVLRSNELFLIGKKLGT 75

Query: 97  ANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQD 156
            NV +    G+ +   ++ +  D+  L+  L +F+ D NI V    + VVL G+V + Q+
Sbjct: 76  TNVSVWDRRGRLIEQFNVEVTHDLNTLKSKLYQFLPDENIEVHSAQEKVVLRGLVSSQQN 135

Query: 157 SQRAVELSETFLSQSGRNQYANSSSKK---VMNLLNIAGEDQVTLKVTIAEVRRDILKQI 213
              AV+++ETF      ++  +SS      V+NLL+I G  QVTL+VT+AEV+R ++++ 
Sbjct: 136 MDTAVKIAETFALGEAADEEDDSSKDDESMVINLLSIGGAQQVTLEVTVAEVQRTLVRRF 195

Query: 214 GFQHSITGSSSGPSKSFAADFGGKFVSEGG---------DFSVKGVLDRFSFETVLHALE 264
                    S   +       GG                 F    +     F   L   +
Sbjct: 196 DSNFHFFQRSGDFTWGGTTAGGGIDGIGPILNVPTVEDFGFLGSFIDSNTLFTFALDVAK 255

Query: 265 RATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLS 324
           +    + LAEP+LTA+SG  A F +GG+      +      ++   +YGV L F P +LS
Sbjct: 256 QNGVAKVLAEPSLTALSGTQAEFVAGGEFPIPVPNEDG--ITIDYKEYGVQLDFVPFILS 313

Query: 325 PGRIGLRIQTEVSEPVIG----------VNAGDMPSYRVRKADTTVELPSGGTIVLAGLL 374
             RI L++   VSE                   +P    R A TT+EL  G TI +AGLL
Sbjct: 314 DKRINLKLNVNVSEISNSGVLTFNPNEVNATFFIPPITKRSAGTTIELADGQTIGIAGLL 373

Query: 375 KDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHY 434
            ++ + +  GIP  S +P+LG LF++  F   ETE+ I  TP L  P+  R ++ P D +
Sbjct: 374 SENARNVANGIPGASDLPVLGRLFKSEEFTSGETELVILVTPRLATPIDRRRITLPTDGF 433

Query: 435 SVEDDAKAFFFNRVNKI 451
              +D + +   +  ++
Sbjct: 434 VAPNDVEFYLLGKGAEL 450


>gi|83859357|ref|ZP_00952878.1| pilus assembly protein CpaC [Oceanicaulis alexandrii HTCC2633]
 gi|83852804|gb|EAP90657.1| pilus assembly protein CpaC [Oceanicaulis alexandrii HTCC2633]
          Length = 529

 Score =  308 bits (788), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 150/540 (27%), Positives = 258/540 (47%), Gaps = 77/540 (14%)

Query: 1   MRYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGK---GKKISIGLNKV 57
           M    +T   +  +      P+ A+L   +      + +   E G     + + + L + 
Sbjct: 1   MARFSQTLCAVALMAAACVCPAEAQLSGGRTEANNTLQVHIREPGAGPASESLQLPLGQA 60

Query: 58  IILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIE 117
            ++ +P D  DV++++   A  VV + R  ++ G+ VG+ N+     DG  +L+L++ +E
Sbjct: 61  AVIHLPEDAADVVIANDEVASAVVRTTRRAFVMGQAVGRTNIFFFNADGGLILDLNVRVE 120

Query: 118 RDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYA 177
           RDIA L+  L RF+ +  I+ E ++  +VL G V +   +  A+++++ ++         
Sbjct: 121 RDIAALQDALDRFVPEGRIQAESMNANIVLSGQVPSAAAADTALQVAQRWV--------- 171

Query: 178 NSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSI------------------ 219
             + ++V++ L + G DQVTL+V I E+ R +++Q+G   S                   
Sbjct: 172 -DTPEQVVSFLTVEGRDQVTLQVRIVEMERTLVRQLGVNLSGEQAFGEFTPTVRTAATND 230

Query: 220 -----------------------TGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLD--RF 254
                                    +  G S +F           G   +   V    + 
Sbjct: 231 RGDPLFDQNGAPIYEVYQQGRFQNSAGWGTSNAFGVAGAALGGLTGTLGTQNLVDGVLQS 290

Query: 255 SFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGV 314
           S    L+ALER   +RTLAEP +TAISG+ A F +GG+          G  ++    +GV
Sbjct: 291 SISATLNALERVGLVRTLAEPNITAISGEPAQFLAGGEFPVPVGRDRDGNVTIEFKPFGV 350

Query: 315 VLHFTPTVLSPGRIGLRIQTEVSE--------------------PVIGVNAGDMPSYRVR 354
            L FTP VLS GRI LR+ TEVSE                        V    +P+  V 
Sbjct: 351 GLGFTPVVLSEGRISLRVSTEVSELSNEGAISLNSQVITDDQGNVTGTVQGVTIPALSVN 410

Query: 355 KADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAA 414
           +A+TTVELPSGG++V+AGL++++ +Q  + +P + ++P+LG+LFR+  F   ETE+ +  
Sbjct: 411 RAETTVELPSGGSMVIAGLIREETRQAMDSVPGIERMPVLGSLFRSRDFANNETELVVVV 470

Query: 415 TPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
           TP+LV P+   D+  P + ++V   A   F  R+N++Y    A +VE + + G IGF+ +
Sbjct: 471 TPYLVDPLNPNDVESPAEGFAVSSLAAGAFLGRLNRVYAAPGA-QVENRGWSGPIGFVLE 529


>gi|13475417|ref|NP_106981.1| pilus assembly protein [Mesorhizobium loti MAFF303099]
 gi|14026169|dbj|BAB52767.1| pilus assembly protein [Mesorhizobium loti MAFF303099]
          Length = 481

 Score =  307 bits (785), Expect = 3e-81,   Method: Composition-based stats.
 Identities = 119/483 (24%), Positives = 207/483 (42%), Gaps = 35/483 (7%)

Query: 8   FFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQ 67
           F+  M+    S   ++     + +A    I++S+  +    ++ + +++ + + V   + 
Sbjct: 4   FWVRMAAVALSCFATLPTWSLVADAADRFIDVSNPSV---HRVFLPMSQSVTIAVNATLG 60

Query: 68  DVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTL 127
           D++V D   AD    + RT+Y+ GK  G   V L   + + +  + I +  D++ +   +
Sbjct: 61  DIVVGDEKIADAQPMTDRTLYVIGKGAGTTTVNLFSPEKRSLGVIQIEVGVDVSDMAQAI 120

Query: 128 RRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNL 187
           R+    S I V  V+  V L G V+        +E+++ +                ++N 
Sbjct: 121 RQVAPRSRIEVASVNGRVRLGGHVKDGVTMAAILEVAKQY------------GPDDIINS 168

Query: 188 LNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGP----------------SKSFA 231
           + I    QV L+V I E +R+  + +G       S S                       
Sbjct: 169 VTIDDSQQVNLEVRILEAKRNAGRDLGVSIRSNNSRSTTIVGTGIAAVDKDNVVLGTGGF 228

Query: 232 ADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGG 291
                   +  G    + + +    +  + ALE   A+RTLA P LT +SG+ ASF +GG
Sbjct: 229 LSDLLSTSTPFGALLTRVIDNNIKVDLYIEALEAKGAVRTLANPNLTTLSGEQASFNAGG 288

Query: 292 QHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGDMPSY 351
           +          G  S+    +GV L FTP VL  G+I + +  EVS+      AGD P +
Sbjct: 289 EVP-IRTLDKNGEISIVYKQFGVNLLFTPVVLDDGKIHMNLAPEVSDLNGFTTAGD-PIF 346

Query: 352 RVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIF 411
             RK  T VEL  G +  + GLL     +L+  +P L ++P++G LFRNS   +EETE+ 
Sbjct: 347 TNRKLSTVVELRDGQSFAVGGLLSSRTTKLQNQVPWLGQVPVIGTLFRNSSNQKEETELV 406

Query: 412 IAATPFLVKPVAM-RDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIG 470
           +  TP +V+PV     L+ P D     +D + F   ++  +          G    G  G
Sbjct: 407 VIVTPHIVRPVKPGEQLATPFDKTRPANDPEFFVLGQLE-VNKDMIRRYETGDGVTGPYG 465

Query: 471 FIY 473
            + 
Sbjct: 466 HML 468


>gi|172062959|ref|YP_001810610.1| type II and III secretion system protein [Burkholderia ambifaria
           MC40-6]
 gi|171995476|gb|ACB66394.1| type II and III secretion system protein [Burkholderia ambifaria
           MC40-6]
          Length = 460

 Score =  307 bits (785), Expect = 3e-81,   Method: Composition-based stats.
 Identities = 132/488 (27%), Positives = 223/488 (45%), Gaps = 43/488 (8%)

Query: 1   MRYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIIL 60
           M  + R         + +   ++A+     +A A               +SI   K  +L
Sbjct: 1   MVRMVRWIAVWCLACIVAPGVALAQRAHAADAGAP--------------LSIATGKGEML 46

Query: 61  QVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDI 120
            +      + V+DP+ AD+ V SPRT+++FGK  G   +I +G + + +L   ++++ D 
Sbjct: 47  SLSEPATAMFVADPSIADIQVPSPRTVFVFGKKAGTTTLIALGANHRPILRRTVIVQVDT 106

Query: 121 AHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSS 180
           A L+  L        + V     ++++ G V +  D+   ++    +L+           
Sbjct: 107 ASLQTVLDSRFPQLKLAVSGAPGSLMVSGKVPSAADADAVMQSLTPYLNDK--------- 157

Query: 181 SKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFV- 239
            ++++N L ++   QV L+V + EV R++ +Q+G   S  G++                 
Sbjct: 158 -ERIVNRLTLSRPIQVNLRVRVTEVSRNVTQQLGINWSSLGAAGNFIGGLFNGRTLMDPT 216

Query: 240 ------SEGGDFSVKGVL--DRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGG 291
                 S  G +SV G     R+S + VL AL++   I  LAEP LTA+SGQ+ASF +GG
Sbjct: 217 TKLFNLSPTGAYSVLGGFHAGRWSIDVVLDALDQEGLITMLAEPNLTAMSGQTASFLAGG 276

Query: 292 QHLYKTVS--SSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEP----VIGVNA 345
           +         ++TGA +V    +GV L FTPTVL+  RI L+++ EVSE      +    
Sbjct: 277 EIPIPVAQAGNTTGAITVEFKPFGVSLDFTPTVLADNRISLKVRPEVSEVDANNSVTTGG 336

Query: 346 GDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNR 405
             +P   VR+ +TTVEL SG +  + GLL+         IP L ++PI+G LF +  F  
Sbjct: 337 VTVPGLTVRRVETTVELSSGQSFAIGGLLQSQTANTVSQIPGLGRLPIIGRLFSSKNFQD 396

Query: 406 EETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNY 465
            +TE+ +  TP++V+P     L +  D  +       F   R   +      +       
Sbjct: 397 NKTEVVVIVTPYIVQPTGPGQLEQALDTVARPSSDLEFAVQRNLGLDLMSGETPRP---- 452

Query: 466 KGAIGFIY 473
            GA GF+Y
Sbjct: 453 VGAAGFVY 460


>gi|167648152|ref|YP_001685815.1| type II and III secretion system protein [Caulobacter sp. K31]
 gi|167350582|gb|ABZ73317.1| type II and III secretion system protein [Caulobacter sp. K31]
          Length = 545

 Score =  307 bits (785), Expect = 4e-81,   Method: Composition-based stats.
 Identities = 150/517 (29%), Positives = 246/517 (47%), Gaps = 74/517 (14%)

Query: 20  NPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADV 79
            P +   P +      V+ I     G  + +++   K  I+++PVDV+D+LV++P  AD 
Sbjct: 41  APRIIDTPTLAPPADQVLRIDLTASG-AQSLTLARGKSAIVELPVDVRDMLVTNPAVADA 99

Query: 80  VVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVE 139
           V+  PR +Y+ G   G  + +     G+++L+L I +++D + L+ TLRR +  +NI V+
Sbjct: 100 VLRGPRRIYVLGMGQGVTDAVFFDAAGRKILSLAIRVDQDSSALQDTLRRVLPAANIEVQ 159

Query: 140 MVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLK 199
            + D+V+L GMV  + +S  A +++  F+ +             V+N+L IAG+DQV LK
Sbjct: 160 SIRDSVILTGMVANVGESTMASQIAARFVDK----------PDNVLNMLTIAGKDQVMLK 209

Query: 200 VTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFG------------------------ 235
           V I EV+R+I+KQ+G   S      G ++                               
Sbjct: 210 VRIVEVQRNIIKQLGVDSSAVLGQLGETQYAFGLSPSYGINGKLLGGLTGGYKADTTKQP 269

Query: 236 ----------------------GKFVSEGGDFSVKGVLDRFSFE---TVLHALERATAIR 270
                                     S G   ++              ++ A ER   +R
Sbjct: 270 TLQVPCNAALPDGAKCLQIVRDNSVYSNGDTATITDTAGSAGLNSAKGMIQAFERVGLVR 329

Query: 271 TLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGL 330
           TLAEP LT +SG++  F  GG+        +TG  ++    YGV L +TP VLS GRI L
Sbjct: 330 TLAEPNLTVVSGEAGKFLVGGEFPVPVGQDATGKVTIEFKPYGVGLGYTPIVLSGGRISL 389

Query: 331 RIQTEVSEPVI-------------GVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDD 377
           ++ TEVSE                  +   +P   VR+A+TTVELPSGG++++AGLL+  
Sbjct: 390 KLSTEVSELSSLGAFTLTTSTGTSTSSNLTVPGLTVRRAETTVELPSGGSLMIAGLLQQQ 449

Query: 378 IQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVE 437
            +Q  + +P ++ +PILGALFR+  +   ETE+ +  TP++V P   ++L  P D     
Sbjct: 450 TRQNIDALPGMTSLPILGALFRSRDYLNGETELVVIITPYIVDPTKPQNLQTPADGLQTA 509

Query: 438 DDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
            D       R+NK+          G+ Y+G +G++ +
Sbjct: 510 SDMSTALLGRLNKVVKAP-VGANSGRAYQGPVGYVIE 545


>gi|170703887|ref|ZP_02894570.1| type II and III secretion system protein [Burkholderia ambifaria
           IOP40-10]
 gi|170131202|gb|EDS99846.1| type II and III secretion system protein [Burkholderia ambifaria
           IOP40-10]
          Length = 460

 Score =  306 bits (784), Expect = 4e-81,   Method: Composition-based stats.
 Identities = 132/488 (27%), Positives = 223/488 (45%), Gaps = 43/488 (8%)

Query: 1   MRYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIIL 60
           M  + R         + +   ++A+     +A A               +SI   K  +L
Sbjct: 1   MVRMVRWIAFWCLACIVAPGVALAQRAHAADAGAP--------------LSIATGKGEML 46

Query: 61  QVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDI 120
            +      + V+DP+ AD+ V SPRT+++FGK  G   +I +G + + +L   ++++ D 
Sbjct: 47  SLSEPATAMFVADPSIADIQVPSPRTVFVFGKKAGTTTLIALGANHRPILRRTVIVQVDT 106

Query: 121 AHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSS 180
           A L+  L        + V     ++++ G V +  D+   ++    +L+           
Sbjct: 107 ASLQTVLDSRFPQLKLAVSGAPGSLMVSGKVPSAADADAVMQSLTPYLNDK--------- 157

Query: 181 SKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFV- 239
            ++++N L ++   QV L+V + EV R++ +Q+G   S  G++                 
Sbjct: 158 -ERIVNRLTLSRPIQVNLRVRVTEVSRNVTQQLGINWSSLGAAGNFIGGLFNGRTLMDPT 216

Query: 240 ------SEGGDFSVKGVL--DRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGG 291
                 S  G +SV G     R+S + VL AL++   I  LAEP LTA+SGQ+ASF +GG
Sbjct: 217 TRLFNLSPTGAYSVLGGFHAGRWSIDVVLDALDQEGLITMLAEPNLTAMSGQTASFLAGG 276

Query: 292 QHLYKTVS--SSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEP----VIGVNA 345
           +         ++TGA +V    +GV L FTPTVL+  RI L+++ EVSE      +    
Sbjct: 277 EIPIPVAQAGNTTGAITVEFKPFGVSLDFTPTVLADNRISLKVRPEVSEVDANNSVTTGG 336

Query: 346 GDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNR 405
             +P   VR+ +TTVEL SG +  + GLL+         IP L ++PI+G LF +  F  
Sbjct: 337 VTVPGLTVRRVETTVELSSGQSFAIGGLLQSQTANTVSQIPGLGRLPIIGRLFSSKNFQD 396

Query: 406 EETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNY 465
            +TE+ +  TP++V+P     L +  D  +       F   R   +      +       
Sbjct: 397 NKTEVVVIVTPYIVQPTGPGQLEQALDTVARPSSDLEFAVQRNLGLDLMSGETPRP---- 452

Query: 466 KGAIGFIY 473
            GA GF+Y
Sbjct: 453 VGAAGFVY 460


>gi|115358171|ref|YP_775309.1| type II and III secretion system protein [Burkholderia ambifaria
           AMMD]
 gi|115283459|gb|ABI88975.1| type II and III secretion system protein [Burkholderia ambifaria
           AMMD]
          Length = 460

 Score =  306 bits (784), Expect = 4e-81,   Method: Composition-based stats.
 Identities = 123/457 (26%), Positives = 209/457 (45%), Gaps = 29/457 (6%)

Query: 32  ANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFG 91
           A    +      +  G  +SI   K  +L +      + V+DP+ AD+ V SPRT+++FG
Sbjct: 18  APGVALAQRAHAVEAGATLSIATGKGEMLSLSEPATAMFVADPSIADIQVPSPRTVFVFG 77

Query: 92  KNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMV 151
           K  G   +I +G + + +L   ++++ D   L+  L        + V     ++++ G V
Sbjct: 78  KKAGTTTLIALGANHRPILRKTVIVQVDTVSLQAVLDSRFPQLKLSVSGAPGSLMVSGKV 137

Query: 152 RTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILK 211
            +  D+   ++    +L+            ++++N L ++   QV L+V + EV R++ +
Sbjct: 138 PSAADADAVMQSLAPYLNDK----------ERIVNRLTLSRPIQVNLRVRVTEVSRNVTQ 187

Query: 212 QIGFQHSITGSSSGPSKSFAADFG---------GKFVSEGGDFSVKGVLDRFSFETVLHA 262
           Q+G   S  G++                         +            R+S + VL A
Sbjct: 188 QLGINWSSLGAAGNFIGGLFNGRTLMDPTNRLFNLSPTGAYSVLGGFHTGRWSIDVVLDA 247

Query: 263 LERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVS--SSTGATSVTTHDYGVVLHFTP 320
           L++   I  LAEP LTA+SGQ+ASF +GG+         ++TGA +V    +GV L FTP
Sbjct: 248 LDQEGLITMLAEPNLTAMSGQTASFLAGGEIPIPVAQAGNTTGAITVEFKPFGVSLDFTP 307

Query: 321 TVLSPGRIGLRIQTEVSEP----VIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKD 376
           TVL+  RI L+++ EVSE      +      +P   VR+ +TTVEL SG +  + GLL+ 
Sbjct: 308 TVLADNRISLKVRPEVSEVDANNSVTTGGVTVPGLTVRRVETTVELSSGQSFAIGGLLQS 367

Query: 377 DIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSV 436
                   IP L ++PI+G LF +  F   +TE+ +  TP++V+P     L +  D  + 
Sbjct: 368 QTANTVSQIPGLGRLPIIGRLFSSKNFQDNKTEVVVIVTPYIVQPTGPGQLEQALDTVAR 427

Query: 437 EDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIY 473
                 F   R   +      +        GA GF+Y
Sbjct: 428 PSSDLEFAVQRNLGLDLMSGETPRP----VGAAGFVY 460


>gi|150377247|ref|YP_001313842.1| type II and III secretion system protein [Sinorhizobium medicae
           WSM419]
 gi|150031794|gb|ABR63909.1| type II and III secretion system protein [Sinorhizobium medicae
           WSM419]
          Length = 466

 Score =  305 bits (782), Expect = 8e-81,   Method: Composition-based stats.
 Identities = 119/456 (26%), Positives = 214/456 (46%), Gaps = 18/456 (3%)

Query: 14  IFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSD 73
              F    +V     +  + +A  +  ++     + I +   K + ++      ++++ D
Sbjct: 9   FAFFCLVLAVFMGIGVGSSASANGDSVEISSNFSRSIRVAKGKTVTIRAVQRFDEIVIGD 68

Query: 74  PTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIAD 133
           P  A V   + R+ Y+ G  +G  +V +   +   +  +DI +  D   L  T+R+ +  
Sbjct: 69  PEIATVTPLTDRSFYILGNELGSTSVTIFDAEKNPVGIIDIEVTLDTKLLSSTIRQSVPG 128

Query: 134 SNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGE 193
           SN++V   +  +VL G       + +A +++  F              ++++N + I   
Sbjct: 129 SNVKVTSANGRIVLSGSATDAVAATQAEQIASRFAGD-----------EEIINSVKITSS 177

Query: 194 DQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDR 253
            QV L V   E+ RD+ K++G + S   + S  S  F +       +  G      + + 
Sbjct: 178 QQVQLNVRFVEINRDVGKELGTRISAAYAWSNGSVEFNSRPRATSNTPAGSLIGSLIGEG 237

Query: 254 FSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYG 313
           +S +  + ALE     R LAEP L A SG+++SF +GG+     VS   G  +V+   +G
Sbjct: 238 YSVDVAIDALEDRGMARRLAEPNLIARSGETSSFLAGGEFPIP-VSEDDGQIAVSYKKFG 296

Query: 314 VVLHFTPTVLSPGRIGLRIQTEVSEPVIGVN----AGDMPSYRVRKADTTVELPSGGTIV 369
           V L FTPTVLS G I L I+ EVS      +       +P + VR+A T+V+L SG + +
Sbjct: 297 VGLDFTPTVLSDGLIALDIEPEVSAIDNTASYRVRNISIPGFSVRRARTSVDLKSGQSFM 356

Query: 370 LAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAM-RDLS 428
           +AGLL+ +   + + +P L ++PILGALF +  + R ET++ I  TP LVKP+   + ++
Sbjct: 357 IAGLLQSENNLITQRVPGLGQLPILGALFSSKAYQRRETDLVIIVTPHLVKPMDPLKKVA 416

Query: 429 RPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQN 464
            P D      +A+ F    ++++           Q 
Sbjct: 417 SPSDRTKRPTEAEFFL-GNIDEVNADDRTRTASTQA 451


>gi|113866744|ref|YP_725233.1| flp pilus assembly protein secretin [Ralstonia eutropha H16]
 gi|113525520|emb|CAJ91865.1| flp pilus assembly protein secretin [Ralstonia eutropha H16]
          Length = 618

 Score =  305 bits (782), Expect = 8e-81,   Method: Composition-based stats.
 Identities = 111/441 (25%), Positives = 207/441 (46%), Gaps = 21/441 (4%)

Query: 32  ANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFG 91
           +  A        I     + + + K  ++ +   V++  + +P      + SP+T+Y+ G
Sbjct: 76  SGEARGPNCTGAIRSESSVMVPVGKSQLITLQEPVRNRTLGNPNVVQATMVSPQTLYVLG 135

Query: 92  KNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGM 150
           + VG  N+I+ G  G     +++++  D   L+ +L + +     IRV   +D +VL G 
Sbjct: 136 RAVGTTNMIVQGRSGSC-SIINVVVNADAGGLQTSLGQLLPGEPGIRVMTAADNLVLTGS 194

Query: 151 VRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDIL 210
           V   Q +Q+A+E+++ + + +            V+N+L++    QV L+V +AEV + +L
Sbjct: 195 VTNAQTAQQAMEIAQAYANAAQGGDGNKK--GGVLNMLSVDTPQQVMLEVKVAEVSKTLL 252

Query: 211 KQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIR 270
            Q+G   ++     G   S++       ++           +   F+  + A +  + ++
Sbjct: 253 NQLGSTVNL----QGGFGSWSGGLVTSLLTGASSAIFASKANNRPFDIAIDAQKNDSLVK 308

Query: 271 TLAEPTLTAISGQSASFTSGGQHLYK----TVSSSTGATSVTTHDYGVVLHFTPTVLSPG 326
            LAEP L  ISGQ ASF +GG+         V +  G  ++   ++GV L FTPTVL+ G
Sbjct: 309 ILAEPNLVTISGQEASFLAGGKIYIPVAQANVLNGAGTVTLQEEEFGVGLKFTPTVLANG 368

Query: 327 RIGLRIQTEVSEPVIGVNAGD---------MPSYRVRKADTTVELPSGGTIVLAGLLKDD 377
           RI L++  EVSE                  +P    R+A TTV++  G +  + GLL D 
Sbjct: 369 RIHLKVSPEVSELSPTGATIRGGTLAGQSILPVITTRRASTTVQMRDGESFAIGGLLTDS 428

Query: 378 IQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVE 437
            +   + +P   ++P+LG LFR++++ ++ TE+    TP LVKP+   +   P D +S  
Sbjct: 429 ARGSLKALPGAGEVPVLGTLFRSTQYQQDLTELVFVITPRLVKPMQTSNYPLPTDSFSTP 488

Query: 438 DDAKAFFFNRVNKIYGPKEAS 458
           +    +F   +      +   
Sbjct: 489 NPLSLYFMGNMEGSGKRQPQP 509


>gi|302343419|ref|YP_003807948.1| type II and III secretion system protein [Desulfarculus baarsii DSM
           2075]
 gi|301640032|gb|ADK85354.1| type II and III secretion system protein [Desulfarculus baarsii DSM
           2075]
          Length = 466

 Score =  305 bits (781), Expect = 9e-81,   Method: Composition-based stats.
 Identities = 113/485 (23%), Positives = 192/485 (39%), Gaps = 43/485 (8%)

Query: 11  MMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVL 70
           M      +    +        A+A           +  ++ +      ++ +P  ++ V 
Sbjct: 1   MSGFCRLAVAALIVAFAVATPASAR-------AEARTGRLEVAAGHSRLVDLPAPLKRVS 53

Query: 71  VSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRF 130
           V+D T ADV+V +PR +Y+ G+  G  N+ +     + +    + + RD   L+    R 
Sbjct: 54  VADETVADVLVINPRQIYVNGRKPGNTNITVWDRAERVIAAYAVGVGRDYTRLKAAFARV 113

Query: 131 IADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNI 190
           +    I V  +   +VL G V +    ++A  ++  F              ++V NLL +
Sbjct: 114 LPGEAIEVHELEGALVLAGSVSSESAREKAESIARLF------------EKERVSNLLEV 161

Query: 191 AGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSS--GPSKSFAADFGGKF---------- 238
             + QV LK+  AEV R   K++         +       +F  +  G            
Sbjct: 162 VDQKQVLLKLRFAEVNRQAAKRMNVNLGYWDPARPGNIFFTFLDNMTGPPSIDYSKGSIE 221

Query: 239 --VSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYK 296
             +S               +   L  L++    + LAEP L  +SG+ A+F +GG+    
Sbjct: 222 FDLSANVGAWGGLNDSGRQYMAFLDILKQNGLAKILAEPNLVCVSGKKANFLAGGEFPIP 281

Query: 297 TVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIG----VNAGDMPSYR 352
                   T++    YGV L F P VL  G+I L ++ EVSE         +   +P   
Sbjct: 282 VP--GRDYTAIVFKKYGVQLTFLPKVLPNGKISLEVEPEVSELDYSPGVVTDGFVVPGLT 339

Query: 353 VRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFI 412
            R+A T +EL  G    +AGLLK D+ +     P L  +PILGALFR+S++   ETE+ I
Sbjct: 340 TRRASTQLELGDGQGFAIAGLLKQDVTRSVSKWPFLGDLPILGALFRSSQYRNRETELLI 399

Query: 413 AATPFLVKPVAMRDLSRPDDH-YSVEDDAKAFFFNRV---NKIYGPKEASEVEGQNYKGA 468
             TP +V+P             +   DD   + + +    ++  G   A        +G 
Sbjct: 400 VVTPHIVRPGDKTPDPLIGPRDFDDPDDMDFYLWGKTGGDDEPPGRAGAKAERSMEMEGR 459

Query: 469 IGFIY 473
            G   
Sbjct: 460 FGHEV 464


>gi|84386797|ref|ZP_00989822.1| type II and III secretion system protein [Vibrio splendidus 12B01]
 gi|84378325|gb|EAP95183.1| type II and III secretion system protein [Vibrio splendidus 12B01]
          Length = 465

 Score =  305 bits (781), Expect = 9e-81,   Method: Composition-based stats.
 Identities = 109/460 (23%), Positives = 196/460 (42%), Gaps = 45/460 (9%)

Query: 44  IGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIG 103
                   + +N+  ++++P   + + +S+   A+    +   + +FGK  G A + ++ 
Sbjct: 21  ASTASTFDVTINEARMIRLPEKAKSIFISNTHIANYQTLTNTKVMIFGKQAGSATITVLN 80

Query: 104 HDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVEL 163
              + +    I +  +       ++    ++++  E +   + L G V +   +   V L
Sbjct: 81  EQERVIYTNKIRVTHNSREFNELVKNKFPEASVNAESLGGKLWLKGRVPSPMMAHNIVSL 140

Query: 164 SETFLSQSGRNQYANS-----------------------SSKKVMNLLNIAGEDQVTLKV 200
           ++ +LS    +                            +  +++N L +   +QV ++V
Sbjct: 141 AKGYLSPIVGSTEQQESSNSQGNSNNSSSSTNQNQQTQLNDDELINQLVVTMPNQVNIRV 200

Query: 201 TIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVL 260
            IAEV R++  ++G +        G                           + S   ++
Sbjct: 201 KIAEVSRNVSNKLGIKWGSIAGGVGQFSF-------------SKLPNVSSWGKPSITALI 247

Query: 261 HALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTP 320
            AL     +  LAEP LTA+SG+ A F  GGQ     +++ T  T +   D+GV L+FTP
Sbjct: 248 DALATNGMMSVLAEPNLTAMSGEDAEFLVGGQVPLPLITADT--TQIEYKDFGVKLNFTP 305

Query: 321 TVLSPGRIGLRIQTEVSEPVIG----VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKD 376
           TVLS  RI L++  EVS   I     +N  + PS+  R A TT+EL SG +  L GLLK 
Sbjct: 306 TVLSQNRISLKVNPEVSNISIESQQVINGTNFPSFTTRSASTTIELASGQSFALGGLLKS 365

Query: 377 DIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSV 436
           +  +  + +PL+ +IP+LG+LFR++ F R ETE+ I  T +LV+P     +  P D    
Sbjct: 366 EDIEQLQKVPLIGEIPVLGSLFRSTEFTRRETELIIIVTAYLVQPTRSDSMPLPTDGLIP 425

Query: 437 EDDAKAFF---FNRVNKIYGPKEASEVEGQNYKGAIGFIY 473
             D +        +          ++ +     G  GF Y
Sbjct: 426 LSDVERLLAWPREQQKTSNNKATYTDNQKPRLLGDNGFYY 465


>gi|110632971|ref|YP_673179.1| type II and III secretion system protein [Mesorhizobium sp. BNC1]
 gi|110283955|gb|ABG62014.1| type II and III secretion system protein [Chelativorans sp. BNC1]
          Length = 464

 Score =  305 bits (781), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 127/470 (27%), Positives = 218/470 (46%), Gaps = 25/470 (5%)

Query: 2   RYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQ 61
           + L R  F + ++  F               ++A  +   V + K   I +   K + ++
Sbjct: 10  KRLTRYVFAVCALAFFG-------CAFGTMDSSANGDSIQVSVAKDSAIRVARGKPLTVE 62

Query: 62  VPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIA 121
           +     ++++ DP  A +   +  + Y+ G+ +G   + L     + +   D+ +  D  
Sbjct: 63  IAEAFDEIVIGDPEIATINPLTDHSFYVLGQGLGTTGIALYDESKRLIGTFDVEVTLDTK 122

Query: 122 HLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSS 181
            L  T+R+ +  SNI+V   +  +VL G       +++A +++  F              
Sbjct: 123 MLAGTIRQSVPGSNIKVTSANGRIVLSGSAPDAVAAEKASQIAARFAGD----------- 171

Query: 182 KKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSE 241
           + V+N ++I    QV L V   E+ R + K++G + S    +SG   SF +D      + 
Sbjct: 172 EDVINTIDITSSQQVQLNVRFVEINRAVGKELGTKISAAYVTSGGGISFNSDPRASSNTP 231

Query: 242 GGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSS 301
            GD     V D FS +  + ALE     R LAEP L A SG++ASF +GG+     VS  
Sbjct: 232 AGDLIGGLVSDGFSIDVAIEALEDRGVARRLAEPNLIARSGETASFLAGGEFPIP-VSEE 290

Query: 302 TGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIG----VNAGDMPSYRVRKAD 357
            GA +V+   +GV L+FTPTVLS G I L I+ EVS         V    +P + VR+A 
Sbjct: 291 NGAVTVSYKKFGVGLNFTPTVLSDGLIALDIEPEVSSIDTTSSYRVGNIAIPGFTVRRAR 350

Query: 358 TTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPF 417
           T+++L SG + ++AGLL+   +   + +P L ++P+LGALF +  + R ET++ I  TP 
Sbjct: 351 TSIDLRSGQSFMMAGLLQSQNEINTQRVPGLGQLPVLGALFSSKAYQRRETDLVIIVTPH 410

Query: 418 LVKPVAM-RDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYK 466
           LV P+     ++ P D      D + F    V ++   +  +        
Sbjct: 411 LVSPIPPGNKVATPADRTKPARDGEVFL-GNVEEVRLQQRTAANAPSAGH 459


>gi|307300715|ref|ZP_07580490.1| type II and III secretion system protein [Sinorhizobium meliloti
           BL225C]
 gi|306904249|gb|EFN34834.1| type II and III secretion system protein [Sinorhizobium meliloti
           BL225C]
          Length = 466

 Score =  305 bits (781), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 118/461 (25%), Positives = 211/461 (45%), Gaps = 18/461 (3%)

Query: 14  IFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSD 73
              F    ++     +    +A  +  ++     + I +   K + ++      ++++ D
Sbjct: 9   FAFFCFVVALCTGIGVSPPASANGDSVEISSNFSRSIKVAKGKTVTIRAVQRFDEIVIGD 68

Query: 74  PTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIAD 133
           P  A V   + R+ Y+ G  +G  +V +   +   +  +DI +  D   L  T+R+ +  
Sbjct: 69  PEIATVTPLTDRSFYILGNELGSTSVTIFDAEKNPVGIIDIEVTLDTKLLSSTIRQSVPG 128

Query: 134 SNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGE 193
           S+++V   +  +VL G       + +A +++  F              ++V+N + I   
Sbjct: 129 SSVKVTSANGRIVLSGSATDAVAATQAEQIASRFAGD-----------EEVINSIKITSS 177

Query: 194 DQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDR 253
            QV L V   E+ RD+ K++G Q S   + S  S  F +       +  G      + + 
Sbjct: 178 QQVQLNVRFVEINRDVGKELGTQISAAYAWSNGSVEFNSSPRATSNTPAGSLIGSLIGEG 237

Query: 254 FSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYG 313
           +S +  + ALE     R LAEP L A SG+++SF +GG+          G  +V+   +G
Sbjct: 238 YSVDVAIDALEDRGMARRLAEPNLIARSGETSSFLAGGEFPIPISEQ-DGTITVSYKKFG 296

Query: 314 VVLHFTPTVLSPGRIGLRIQTEVSEPVIG----VNAGDMPSYRVRKADTTVELPSGGTIV 369
           V L FTPTVLS G I L I+ EVS         V    +P + VR+A T+V+L SG + +
Sbjct: 297 VGLDFTPTVLSDGLIALDIEPEVSAIDNTASYRVGNIAIPGFSVRRARTSVDLKSGQSFM 356

Query: 370 LAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAM-RDLS 428
           +AGLL+ +   + + +P L ++PILGALF +  + R ET++ I  TP LVKP+   + ++
Sbjct: 357 IAGLLQSENNLITQRVPGLGQLPILGALFSSKAYQRRETDLVIIVTPHLVKPIDPLKKVA 416

Query: 429 RPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAI 469
            P D      +A+ F    ++++           Q      
Sbjct: 417 SPSDRTKRPTEAEFFL-GNIDEVEVNGRGRSASRQARVARA 456


>gi|193782542|ref|NP_435332.2| PilQ2 pilus assembly protein [Sinorhizobium meliloti 1021]
 gi|307319126|ref|ZP_07598556.1| type II and III secretion system protein [Sinorhizobium meliloti
           AK83]
 gi|193072997|gb|AAK64744.2| PilQ2 pilus assembly protein [Sinorhizobium meliloti 1021]
 gi|306895233|gb|EFN25989.1| type II and III secretion system protein [Sinorhizobium meliloti
           AK83]
          Length = 466

 Score =  305 bits (780), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 118/456 (25%), Positives = 211/456 (46%), Gaps = 18/456 (3%)

Query: 14  IFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSD 73
              F    ++     +    +A  +  ++     + I +   K + ++      ++++ D
Sbjct: 9   FAFFCFVVALCTGIGVSPPASANGDSVEISSNFSRSIKVAKGKTVTIRAVQRFDEIVIGD 68

Query: 74  PTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIAD 133
           P  A V   + R+ Y+ G  +G  +V +   +   +  +DI +  D   L  T+R+ +  
Sbjct: 69  PEIATVTPLTDRSFYILGNELGSTSVTIFDAEKNPVGIIDIEVTLDTKLLSSTIRQSVPG 128

Query: 134 SNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGE 193
           S+++V   +  +VL G       + +A +++  F              ++V+N + I   
Sbjct: 129 SSVKVTSANGRIVLSGSATDAVAATQAEQIASRFAGD-----------EEVINSIKITSS 177

Query: 194 DQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDR 253
            QV L V   E+ RD+ K++G Q S   + S  S  F +       +  G      + + 
Sbjct: 178 QQVQLNVRFVEINRDVGKELGTQISAAYAWSNGSVEFNSSPRATSNTPAGSLIGSLIGEG 237

Query: 254 FSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYG 313
           +S +  + ALE     R LAEP L A SG+++SF +GG+          G  +V+   +G
Sbjct: 238 YSVDVAIDALEDRGMARRLAEPNLIARSGETSSFLAGGEFPIPISEQ-DGTITVSYKKFG 296

Query: 314 VVLHFTPTVLSPGRIGLRIQTEVSEPVIG----VNAGDMPSYRVRKADTTVELPSGGTIV 369
           V L FTPTVLS G I L I+ EVS         V    +P + VR+A T+V+L SG + +
Sbjct: 297 VGLDFTPTVLSDGLIALDIEPEVSAIDNTASYRVGNIAIPGFSVRRARTSVDLKSGQSFM 356

Query: 370 LAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAM-RDLS 428
           +AGLL+ +   + + +P L ++PILGALF +  + R ET++ I  TP LVKP+   + ++
Sbjct: 357 IAGLLQSENNLITQRVPGLGQLPILGALFSSKAYQRRETDLVIIVTPHLVKPIDPLKKVA 416

Query: 429 RPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQN 464
            P D      +A+ F    ++++           Q 
Sbjct: 417 SPSDRTKRPTEAEFFL-GNIDEVEVNGRGRSASRQA 451


>gi|172065273|ref|YP_001815985.1| type II and III secretion system protein [Burkholderia ambifaria
           MC40-6]
 gi|171997515|gb|ACB68432.1| type II and III secretion system protein [Burkholderia ambifaria
           MC40-6]
          Length = 656

 Score =  304 bits (779), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 121/434 (27%), Positives = 213/434 (49%), Gaps = 19/434 (4%)

Query: 42  VEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVIL 101
             +     +S+ L K +++ +P  V++  + +P  A   + SP+T+Y+ G +VG  N+I+
Sbjct: 92  GAVRDATSVSVPLGKSLLVPMPEPVRNRTIGNPAVAQATMVSPQTLYILGLSVGTTNMIV 151

Query: 102 IGHDGKQMLNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRA 160
            G  G     +D+ +  D   L+ +L++ +    +I V   + T+VL G V   Q +Q+A
Sbjct: 152 QGRSGACR-VIDVAVGADAGGLQSSLQQLMPGERDIHVSTAAGTIVLAGTVSNSQAAQQA 210

Query: 161 VELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSIT 220
           V+++  + S S  +         V+N+L +    QV L+V +AEV + ++ Q+G   +I 
Sbjct: 211 VQIAHAY-SDSAGDGGGAGKGAGVLNMLAVTSPQQVMLEVKVAEVSKTLINQMGSAFNIQ 269

Query: 221 GSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAI 280
           G     S +  ++      S G    +    +   F     A      ++ LAEP L  I
Sbjct: 270 GGFGSWSGALVSNLLAGVASAG----IFNKANNKPFSVAADAQNTDNLVKILAEPNLVTI 325

Query: 281 SGQSASFTSGGQHLYKTVSSSTGAT---SVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS 337
           SGQ A+F +GG+       SS   T   ++   ++GV L FTPTVL+ GRI L++  EVS
Sbjct: 326 SGQEATFLAGGKIFIPIPQSSGNGTSSITLQEEEFGVALKFTPTVLANGRISLKVAPEVS 385

Query: 338 EPVIGV---------NAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLL 388
           E                  +P    R+A TTV++  G +  + GL+KD+     + IP +
Sbjct: 386 ELSQTGVTLSATNIGGTSILPLITTRRASTTVQMSDGESFAIGGLIKDNATGALKAIPGV 445

Query: 389 SKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRV 448
            ++P+LGALFR++ F ++ TE+    TP LV+P+   D+  P D +S  ++   +    +
Sbjct: 446 GEVPVLGALFRSTSFQQDRTELIFLITPHLVRPLQTADVPLPTDSFSKPNEVDVYATGNM 505

Query: 449 NKIYGPKEASEVEG 462
               G ++A+    
Sbjct: 506 EGRKGVRKATMQPS 519


>gi|16520026|ref|NP_444146.1| outermembrane protein RhcC2; component of type III secretion
           apparatus [Sinorhizobium fredii NGR234]
 gi|2495099|sp|P55702|Y4XJ_RHISN RecName: Full=Uncharacterized protein y4xJ
 gi|2182718|gb|AAB91933.1| outermembrane protein RhcC2; component of type III secretion
           apparatus [Sinorhizobium fredii NGR234]
          Length = 423

 Score =  304 bits (779), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 136/446 (30%), Positives = 205/446 (45%), Gaps = 30/446 (6%)

Query: 36  VINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVG 95
           +   +   I     +S  L K   + +P     + V+DPT AD    S RT+++FGK  G
Sbjct: 1   MPRAAPNSINATLNLSSSLGK--TVHLPAPAATIFVADPTIADYQAPSNRTIFVFGKKFG 58

Query: 96  QANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQ 155
           + ++  +  +G+ +  L +++ + IA L   LR  + D  I V       +L G     +
Sbjct: 59  RTSLFALDENGEALAELHVVVTQPIADLRAMLRDQVGDYPIHVSYTPRGAILSGTAPNAE 118

Query: 156 DSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGF 215
               A  ++E FL               ++N + +AG  QV L V +AEV R  LK +G 
Sbjct: 119 VVDIAKRVTEQFLGDGA----------PIVNNIKVAGSLQVNLSVRVAEVSRSGLKALGI 168

Query: 216 QHSITGSSSGPSKSFA--ADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLA 273
             S  G                G     GG   +    D  S   VL AL +      LA
Sbjct: 169 NLSAFGQFGNFKVGVLNRGAGLGSATGSGGTAEIGFDNDAVSVGAVLDALAKEHIASVLA 228

Query: 274 EPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQ 333
           EP LTA+SG++ASF +GG+     V    G TSV    +GV L F PTVL    I + ++
Sbjct: 229 EPNLTAMSGETASFLAGGEFPIP-VLQENGQTSVEFRRFGVSLEFVPTVLDNNLINIHVK 287

Query: 334 TEVSEPV----IGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLS 389
            EVSE      + VN   +P+   R+ADT VEL SG + V+ GL++ ++       P L 
Sbjct: 288 PEVSELSLQGAVQVNGIAVPAVSTRRADTVVELASGQSFVIGGLIRRNVNNDISAFPWLG 347

Query: 390 KIPILGALFRNSRFNREETEIFIAATPFLVKP-VAMRDLSRPDDHYSVEDDAKAFFFNRV 448
           +IPILGALFR+S F +EE+E+ I  TP++V+P      +S P D  +            +
Sbjct: 348 RIPILGALFRSSSFQKEESELVILVTPYIVRPGSNPNQMSAPTDRMAPA----------L 397

Query: 449 NKIYGPKEASEVEGQNYKGAIGFIYK 474
                 + A   +  + KG +GFI +
Sbjct: 398 GTPPRARAAISTDAPSVKGDLGFIIE 423


>gi|187927687|ref|YP_001898174.1| type II and III secretion system protein [Ralstonia pickettii 12J]
 gi|187724577|gb|ACD25742.1| type II and III secretion system protein [Ralstonia pickettii 12J]
          Length = 663

 Score =  304 bits (778), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 118/478 (24%), Positives = 216/478 (45%), Gaps = 35/478 (7%)

Query: 5   QRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPV 64
            R   +       S NP++A  P                +     + + + K  ++ +P 
Sbjct: 65  SRAGASAPVQMTISMNPALATAPVA----DVRGPNCTGAVRGESSVVVPVGKSSLISLPE 120

Query: 65  DVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLE 124
            V++  + +P      + SP++MYL G++VG  N+I+ G  G   +   ++   D   L+
Sbjct: 121 PVRNRTLGNPAVVQATMVSPQSMYLLGRSVGTTNMIVQGRSGACSIVNVVVNA-DAGGLQ 179

Query: 125 MTLRRFIADSN-IRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQS------------ 171
            +L + +   N IRV   +D++VL G V + Q +Q+A+E++  + + +            
Sbjct: 180 TSLAQLMPGENKIRVMTAADSLVLAGNVSSAQAAQQAMEIAHAYAASAQSGADKGGGAAG 239

Query: 172 GRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFA 231
                  +    V+N++ +    QV L+V +AEV + +L Q+G   ++     G   S++
Sbjct: 240 ALGGGGAAGGANVINMMIVDTPQQVMLEVKVAEVSKTLLNQLGSALNV----QGGFGSWS 295

Query: 232 ADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGG 291
                  ++           +   F+  L A +  + ++ LAEP L  +SGQ ASF +GG
Sbjct: 296 GGLLTSLLTGSSTGFFANKANNRPFQVELDAQKNDSLVKILAEPNLVTLSGQEASFLAGG 355

Query: 292 QHLYKTVSSST----GATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGD 347
           +       SS+       ++   +YGV L FTPTV++ GRI L++  EVSE         
Sbjct: 356 KIYIPVAQSSSSGGAPTITLQEEEYGVGLKFTPTVMANGRINLKVAPEVSELSPTGATVT 415

Query: 348 ---------MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALF 398
                    +P    R+A TTV++  G +  + GLL+D+ +   + +P   +IP+LG LF
Sbjct: 416 GANTNGQTILPLITTRRASTTVQMRDGESFAIGGLLQDNARGSLKALPGAGEIPVLGTLF 475

Query: 399 RNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKE 456
           R+++F  + TE+ I  TP LV+P+       P D +S  ++   +    +        
Sbjct: 476 RSTQFQHDLTELVIVITPRLVQPMQTASYPLPTDSFSTPNELAVYLTGNMEGSGAKNR 533


>gi|149912019|ref|ZP_01900613.1| putative membrane protein [Moritella sp. PE36]
 gi|149804918|gb|EDM64952.1| putative membrane protein [Moritella sp. PE36]
          Length = 473

 Score =  304 bits (778), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 120/459 (26%), Positives = 200/459 (43%), Gaps = 42/459 (9%)

Query: 47  GKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDG 106
            + + + LNK  ++++P   + + ++  + AD    +   + +FGK  G  ++ ++    
Sbjct: 25  AQTLDVVLNKARLIELPKTAKSIFIASSSIADYQTLTNTKIMVFGKKTGSTSLYVLDAKE 84

Query: 107 KQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSET 166
             + +  + +  ++  L   + +   D+    E  +  + L G V T   +++ V LSE 
Sbjct: 85  NVIYSATVKVSHNVTELNELIHKEFPDAIFNAESTAGKLFLKGQVPTPSMAEKIVRLSEG 144

Query: 167 FLS--------------------QSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVR 206
           ++S                    Q  +   +N  + +++N L +   +QV L++ IAEV 
Sbjct: 145 YVSTLASTESSDSQQSGNAQSSTQPTQPAASNVDNDELINQLQVTMPNQVNLRIRIAEVS 204

Query: 207 RDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERA 266
           R +  ++G +    G        F         + GG               ++ AL   
Sbjct: 205 RKVSNKLGIKWGSQG--------FGTGTFAFLDNYGGKLGGVNPASWADLSVIVDALATN 256

Query: 267 TAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPG 326
             +  LAEP LTA+SG+ ASF  GG+     V S T    V    +GV L F PTVLS  
Sbjct: 257 GMMSVLAEPNLTAMSGEEASFLVGGEIPIPLVYSDTAT--VEYKTFGVRLDFKPTVLSAN 314

Query: 327 RIGLRIQTEVSEPVIGVN--------AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDI 378
           RI L++ TEVS      N        +   P++  R+A TT+EL SG +  L GLL+   
Sbjct: 315 RISLKVATEVSTVSSETNVQIGGTQGSSSFPTFVTRRASTTIELASGQSFALGGLLQSKD 374

Query: 379 QQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVED 438
            +  + +PLL  IP+LGALFR++ F REETE+ I AT +LV+P     L  P D      
Sbjct: 375 IEQLQKMPLLGDIPVLGALFRSNEFQREETELIIIATAYLVQPTRADILPLPTDGLIPMS 434

Query: 439 DAKAFF----FNRVNKIYGPKEASEVEGQNYKGAIGFIY 473
           D +         +       +  ++       G  GF Y
Sbjct: 435 DVERLLAWPVSKQATNATDNESRTDNRQPRLLGDNGFYY 473


>gi|197106459|ref|YP_002131836.1| pilus assembly protein CpaC [Phenylobacterium zucineum HLK1]
 gi|196479879|gb|ACG79407.1| pilus assembly protein CpaC [Phenylobacterium zucineum HLK1]
          Length = 484

 Score =  304 bits (778), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 110/430 (25%), Positives = 202/430 (46%), Gaps = 20/430 (4%)

Query: 17  FSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTK 76
           F++  +   +     A  + +  + V  G   ++++   K  ++++      V ++DP  
Sbjct: 4   FAAIAAALSVGAGTLAPQSALAAAAVVAGPSSELAVEAGKGRLIRLDRPAATVFIADPKI 63

Query: 77  ADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNI 136
           ADV V SP  +Y+ GK  G  ++  +    + + +L + +  D A L+  L+R   +S I
Sbjct: 64  ADVQVKSPTLVYVLGKAPGATSLFALDAGERMIADLAVNVGIDTARLDQALKRHAPNSQI 123

Query: 137 RVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQV 196
           +VE V   ++L G   +  +    + ++  F+          + + +++N + +   +Q+
Sbjct: 124 QVESVDGALILSGKAGSAAEGADILRIAAEFVP-----GEGEARAGRLINRIVVEQPNQI 178

Query: 197 TLKVTIAEVRRDILKQIGFQHSITG----------SSSGPSKSFAADFGGKFVSEGGDFS 246
            L V +AEV +   + +G      G          +      + A+      ++      
Sbjct: 179 NLHVRVAEVSKQAREVLGVNWDAMGLLGEGMVGLATGRQIFTNPASRETFSRLNGTDTIV 238

Query: 247 VKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATS 306
                       ++ AL++   ++ LAEP LTA+SG+ ASF +GG++            +
Sbjct: 239 GSYQDGDLDLNVLVDALKQKGLVKVLAEPNLTAVSGEPASFLAGGEYPIPVPQRGEDLIT 298

Query: 307 VTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPV----IGVNAGDMPSYRVRKADTTVEL 362
           +    +GV L F  TVL  GRI L ++ EVS+      I V    +P+   R+A+TTVEL
Sbjct: 299 IDYKQFGVSLSFVATVLDGGRISLNVRPEVSQLSEAGAITVQGLTVPALTTRRAETTVEL 358

Query: 363 PSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPV 422
            SG +  +AGLL++   +    +P L  IP+LG LFR+  F + E+E+ I  TP+LVKP 
Sbjct: 359 GSGQSFAIAGLLQNTSNETLRKLPGLGDIPVLGNLFRSKEFQKNESELVIIVTPYLVKPA 418

Query: 423 AMRDLSRPDD 432
           +   L+ P D
Sbjct: 419 SRT-LATPAD 427


>gi|77919345|ref|YP_357160.1| Flp pilus assembly protein CpaC [Pelobacter carbinolicus DSM 2380]
 gi|77545428|gb|ABA88990.1| Flp pilus assembly protein CpaC [Pelobacter carbinolicus DSM 2380]
          Length = 507

 Score =  304 bits (778), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 119/501 (23%), Positives = 204/501 (40%), Gaps = 49/501 (9%)

Query: 1   MRYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIIL 60
           M   +     +  + LF                         +  +   + + +    ++
Sbjct: 1   MTTRRAILPAICFLGLFCLALFTGTAAA--------------DDIEHLTLDVNIGGSELV 46

Query: 61  QVPVDVQD--VLVSDPTKADVVVHSPR--TMYLFGKNVGQANVILIGHDGKQM-LNLDIL 115
           ++    Q   +L+S+          P    +Y  GK +G + V +     +Q+   +D+ 
Sbjct: 47  EIREPSQRMKILISNGDIIGARPLRPNLINVYNLGKKIGFSRVTVWDDAARQVRAIIDVS 106

Query: 116 IERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQ 175
           +  D+  L+  +       NI+V      VVL G V + +  ++ + L+ETFL +     
Sbjct: 107 VNLDLTPLKQKIGELYPHENIKVYASETGVVLSGTVSSPEVVEQVIRLTETFLPKKAEAS 166

Query: 176 YANSSSKK----VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPS---- 227
            +   + K    + NLL++ G  QV L+V  AEV R   +         G          
Sbjct: 167 TSGKGTGKSGSGITNLLSVGGVQQVMLEVKFAEVTRSSGRDWQAALGFNGLGDNSGLVAG 226

Query: 228 ----------KSFAADFGGKFVSEG--GDFSVKGVLDRFSFETVLHALERATAIRTLAEP 275
                       F    G   ++            +    F + L  LE     R LAEP
Sbjct: 227 VGGISGDISGGDFTGKLGSVLLNFADFASNPANIFVQMGDFTSALRFLEDEGLARILAEP 286

Query: 276 TLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTE 335
            L  +SGQ ASF +GG+             ++   ++GV L FTP V+S G+I LR+   
Sbjct: 287 RLVTMSGQEASFLAGGEFPIPVPDEDG--ITIEFREFGVSLRFTPVVMSDGKISLRVAPS 344

Query: 336 VSEPVIG--------VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPL 387
           VS+                ++P+   RK +TTV+L  G T+ LAGLL+D +++    IP 
Sbjct: 345 VSDIASTSSIPSSITGTTYNVPNLTTRKLETTVQLYDGQTLALAGLLQDTLRESVSKIPG 404

Query: 388 LSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNR 447
           L  +PILGALFR++ + +E+T++ IA TP LVKP     LS P ++    +  + +   R
Sbjct: 405 LGDLPILGALFRSTSYTQEKTDLLIAVTPHLVKPSKEGTLSFPGEYMRPPNRLEFYLEGR 464

Query: 448 VNKIYGPKEASEVEGQNYKGA 468
           +     P + S +   ++   
Sbjct: 465 LEGRRFPNDPSALSQHSFAAP 485


>gi|73542329|ref|YP_296849.1| type II and III secretion system protein:transport-associated
           [Ralstonia eutropha JMP134]
 gi|72119742|gb|AAZ62005.1| type II and III secretion system protein:Transport-associated
           [Ralstonia eutropha JMP134]
          Length = 633

 Score =  303 bits (777), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 110/454 (24%), Positives = 206/454 (45%), Gaps = 23/454 (5%)

Query: 15  FLFSSNPSVAKLPPIKEANAAVINISDVEIGKGK---KISIGLNKVIILQVPVDVQDVLV 71
              S  P+                      G  +    + + + K  ++ +   V++  +
Sbjct: 56  MTISMAPAGTAPVGAAAPVPVADARGPNCTGAVRQESSVIVPVGKSQLITLQEPVKNRTL 115

Query: 72  SDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFI 131
            +P      + S +T+Y+ G+ VG  N+I+ G  G     +++++  D   L+ +L + +
Sbjct: 116 GNPNVVQATMVSAQTLYVLGRTVGTTNMIVQGRSGSC-SIINVVVNADAGGLQTSLSQLL 174

Query: 132 ADS-NIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQS-GRNQYANSSSKKVMNLLN 189
                IRV   +D +VL G V   Q + +A+++++ + + +             V+N+L+
Sbjct: 175 PGEPGIRVMTAADNLVLTGSVTNAQSALQAMDIAQAYANAAQVGAGGDAGKKGGVLNMLS 234

Query: 190 IAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKG 249
           +    QV L+V +AEV + +L Q+G   ++     G   S+        ++         
Sbjct: 235 VDTPQQVMLEVKVAEVSKTLLNQLGSSVNL----QGGFGSWTGGLVTSLLTGASGAIFGS 290

Query: 250 VLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYK----TVSSSTGAT 305
             +   F   + A +  + ++ LAEP L  ISGQ ASF +GG+         V +  G  
Sbjct: 291 KANNKPFNFAIDAQKNDSLVKILAEPNLVTISGQEASFLAGGKIYIPVAQANVLNGAGTV 350

Query: 306 SVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGD---------MPSYRVRKA 356
           ++   ++GV L FTPTVL+ GRI L++  EVSE                  +P    R+A
Sbjct: 351 TLQEEEFGVGLKFTPTVLANGRIHLKVAPEVSELSPTGATVSGGTLAGQSVLPLITTRRA 410

Query: 357 DTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATP 416
            TTV++  G +  + GLL+D  +   + +P   ++P+LG LFR++++ ++ TE+    TP
Sbjct: 411 STTVQMRDGESFAIGGLLQDSARGSLKALPGAGEVPVLGTLFRSTQYQQDLTELVFIITP 470

Query: 417 FLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNK 450
            LVKP+A  +   P D ++  D    +F   +  
Sbjct: 471 RLVKPMATNNYPLPTDSFTTPDPFSLYFMGNMEG 504


>gi|254255254|ref|ZP_04948570.1| Flp pilus assembly protein secretin CpaC [Burkholderia dolosa
           AUO158]
 gi|124900991|gb|EAY71741.1| Flp pilus assembly protein secretin CpaC [Burkholderia dolosa
           AUO158]
          Length = 682

 Score =  303 bits (777), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 120/421 (28%), Positives = 215/421 (51%), Gaps = 19/421 (4%)

Query: 42  VEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVIL 101
             +     +S+ L K +++ +P  V++  + +P  A   + SP+T+Y+ G +VG  N+I+
Sbjct: 92  GAVRDSTSVSVPLGKSLLVPMPEPVRNRTIGNPAVAQATMVSPQTLYILGMSVGTTNMIV 151

Query: 102 IGHDGKQMLNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRA 160
            G  G     +D+ +  D A L+ +L + + +  ++ V   + T+VL G V + Q +Q+A
Sbjct: 152 QGKSGACR-VIDVAVGADAAGLQASLMQLMPNERDVHVSTAAGTIVLSGSVSSSQAAQQA 210

Query: 161 VELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSIT 220
           V ++  +   S  +         V+N+L++    QV L+V +AEV + ++ Q+G   +I 
Sbjct: 211 VAIARAY-GDSAGDGNGGGKPGSVLNMLSVTSPQQVMLEVKVAEVSKTLINQLGSAFNIQ 269

Query: 221 GSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAI 280
           G     S +  ++      S      V    +   F   + A      ++ LAEP L  I
Sbjct: 270 GGFGSWSGALVSNLLAGVASGA----VFNKANNRPFSVAVDAQNTDNLVKILAEPNLVTI 325

Query: 281 SGQSASFTSGGQ---HLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS 337
           SGQ A+F +GG+    + ++  + T   ++   ++GV L FTPTVL+ GRI L++  EVS
Sbjct: 326 SGQEATFLAGGKIFIPVPQSSGTGTTTITLQEEEFGVALKFTPTVLANGRISLKVAPEVS 385

Query: 338 EPVIG---------VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLL 388
           E               A  +P    R+A TTV++  G T  + GL+KD+     + IP +
Sbjct: 386 ELSQTGVTLSATNVSGASILPLITTRRASTTVQMSDGETFAIGGLIKDNASGALKAIPGV 445

Query: 389 SKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRV 448
            ++P+LGALFR++ F ++ TE+    TP LVKP++  D++ P D +S  ++A  +    +
Sbjct: 446 GEVPVLGALFRSTSFQQDRTELIFVITPHLVKPLSTADVALPTDSFSKPNEADVYATGYM 505

Query: 449 N 449
            
Sbjct: 506 E 506


>gi|114799407|ref|YP_759869.1| type II/III secretion system protein [Hyphomonas neptunium ATCC
           15444]
 gi|114739581|gb|ABI77706.1| type II/III secretion system protein [Hyphomonas neptunium ATCC
           15444]
          Length = 432

 Score =  303 bits (777), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 128/452 (28%), Positives = 201/452 (44%), Gaps = 36/452 (7%)

Query: 1   MRYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIIL 60
           M  ++R         L  + P++A       A A              ++ +   K  ++
Sbjct: 1   MSGIRRILIASCLAAL-CAQPALAWTQRSAPAGA-------------DQLELRRGKSAVV 46

Query: 61  QVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDI 120
           +       ++V+DP  A+ +  S R+ ++ GK  G   V++    G     +++ ++  +
Sbjct: 47  EADAAFATIVVADPEIAEAMPTSNRSFFVRGKKPGGTTVLIYDEAGAIAELIEVEVKLGL 106

Query: 121 AHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSS 180
             L   L R +    I V  V D V L G V T   +  A++L+E  +            
Sbjct: 107 DELRGDLGRLLPGEIIDVYAVHDGVYLDGKVTTAAAADMALQLAERHV------------ 154

Query: 181 SKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVS 240
              V N L++    QV L+V   E  R  +++IGF ++I  +            G    +
Sbjct: 155 PGGVANGLSVGQSQQVMLEVRFLEASRKAVREIGFGNTIDANDVVAGTEGGTVSGLLEKT 214

Query: 241 EGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSS 300
                +V   +   + +  L ALE    IRTLAEP L A+SG +ASF +GG+      S 
Sbjct: 215 ----LAVFTNVGGENIDVSLRALEEKGVIRTLAEPNLVALSGDTASFLAGGEFPIPVSSR 270

Query: 301 STGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGV----NAGDMPSYRVRKA 356
               T V    +GV L FTPTVL  G + LR++ EVS    G     +  D+P   VR+A
Sbjct: 271 DNEVT-VEFKKFGVSLDFTPTVLGDGLVNLRVRPEVSALDRGNGIRASNIDIPGVSVRRA 329

Query: 357 DTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATP 416
           DTTVEL  G    +AGLL+++        P L  +PILG+LF + R+ R ETE+ I  TP
Sbjct: 330 DTTVELHDGQAFAIAGLLQNNYTNDVRQTPWLGNVPILGSLFSSKRYQRNETELVIIVTP 389

Query: 417 FLVKPVA-MRDLSRPDDHYSVEDDAKAFFFNR 447
            LV+P +    +  P D  S   +A+ F   +
Sbjct: 390 RLVQPFSHPEAIVSPLDSVSEPTEAELFLLGK 421


>gi|167841781|ref|ZP_02468465.1| type II/III secretion system protein [Burkholderia thailandensis
           MSMB43]
          Length = 433

 Score =  303 bits (776), Expect = 4e-80,   Method: Composition-based stats.
 Identities = 125/446 (28%), Positives = 210/446 (47%), Gaps = 27/446 (6%)

Query: 41  DVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVI 100
                    +++      ++++P     V V+DP  ADV V +P+ +++ GK  G   + 
Sbjct: 2   ARAAEPAPVLAVPAGGGEMVKLPEPAVAVFVADPDVADVHVPTPQAVFVLGKKAGTTTLF 61

Query: 101 LIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRA 160
            +G + + +L   ++++ D   L+  L       ++ +     ++++ G V +  D+   
Sbjct: 62  ALGANNRTILRETVVVDVDTPSLQRILDARFPQLHLTLAGAPGSLMVSGRVPSAADADAV 121

Query: 161 VELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSIT 220
            +  + +L Q           + ++N L +A   QV L+V I EV R+I +Q+G   S  
Sbjct: 122 AQTLKPYLRQQ----------ESLVNRLTLARPIQVHLRVRITEVDRNITQQLGINWSAL 171

Query: 221 GSSSGPSKSFAADFG-------GKFVSEGGDFSVKGVL--DRFSFETVLHALERATAIRT 271
           G+S                      +S  G FSV G     R+S + VL AL++   I  
Sbjct: 172 GASGNFVGGLFNGRTLFDTASKAFDLSPSGAFSVLGGFHTSRYSIDGVLDALDQEGLITM 231

Query: 272 LAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLR 331
           LAEP LTAISGQ+ASF +GG+        +TGA ++    YGV L FTPTVL+  RI L+
Sbjct: 232 LAEPNLTAISGQTASFLAGGEFPIPVAQDTTGAITIQFKPYGVSLDFTPTVLADNRISLK 291

Query: 332 IQTEVSEPVIGVNAGD----MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPL 387
           ++ EVSE     +       +P+  VR+ DTTVEL SG +  + GLL+     +   +P 
Sbjct: 292 VRPEVSEIDPTNSVTTGSIKVPALTVRRVDTTVELSSGQSFAIGGLLQSKSSDVLAELPG 351

Query: 388 LSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNR 447
           L+++P+LG LF +  +  ++TE+ +  TP++V+P    +L    D  +       F   R
Sbjct: 352 LARLPVLGKLFSSRNYLNDKTEVVVIVTPYIVQPANPGELHDALDDVTRPSSDIEFVLQR 411

Query: 448 VNKIYGPKEASEVEGQNYKGAIGFIY 473
              I         +     G  GF+Y
Sbjct: 412 SLGIDPLGG----DAPRLAGPAGFVY 433


>gi|194288836|ref|YP_002004743.1| pilus assembly secretion protein [Cupriavidus taiwanensis LMG
           19424]
 gi|193222671|emb|CAQ68674.1| pilus assembly secretion protein [Cupriavidus taiwanensis LMG
           19424]
          Length = 621

 Score =  303 bits (775), Expect = 5e-80,   Method: Composition-based stats.
 Identities = 111/429 (25%), Positives = 206/429 (48%), Gaps = 21/429 (4%)

Query: 41  DVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVI 100
              I     + + + K  ++ +   V++  + +P+     + SP+T+Y+ G+ VG  N+I
Sbjct: 84  TGAIRSESSVVVPVGKSQLITLQEPVRNRTLGNPSVVQATMVSPQTLYVLGRTVGTTNMI 143

Query: 101 LIGHDGKQMLNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQR 159
           + G  G     +++++  D   L+ +L + +     IRV   +D +VL G V   Q +Q+
Sbjct: 144 VQGRSGSC-SIINVVVNADSGGLQTSLGQLLPGEPGIRVTTAADNLVLTGSVTNAQAAQQ 202

Query: 160 AVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSI 219
           A+E+++ + + +         S  V+N++++    QV L+V +AEV + +L Q+G   ++
Sbjct: 203 AMEIAQAYANAAQGGDGNKKGS--VLNMMSVDTPQQVMLEVKVAEVSKTLLNQLGSAVNL 260

Query: 220 TGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTA 279
                G   S++       ++           +   FE  L A +  + ++ LAEP L  
Sbjct: 261 ----QGGFGSWSGGLVTSLLTGASAAVFGSKANNRPFEFALDAQKNDSLVKILAEPNLVT 316

Query: 280 ISGQSASFTSGGQHLYK----TVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTE 335
           ISGQ ASF +GG+         V +  G  ++   ++GV L FTPTVL+ GRI L++  E
Sbjct: 317 ISGQEASFLAGGKIYIPVAQANVLNGAGTVTLQEEEFGVGLKFTPTVLANGRIHLKVAPE 376

Query: 336 VSEPVIGVNAGD---------MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIP 386
           VSE                  +P    R+A TTV++  G +  + GLL D  +   + +P
Sbjct: 377 VSELSPTGATIRGGTLAGQTILPVITTRRASTTVQMRDGESFAIGGLLTDSARGSLKALP 436

Query: 387 LLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFN 446
              ++P+LG LFR++++ ++ +E+    TP LVKP+   +   P D +S  +    +F  
Sbjct: 437 GAGEVPVLGTLFRSTQYQQDLSELVFIITPRLVKPMQTNNYPLPTDSFSAPNPLSLYFMG 496

Query: 447 RVNKIYGPK 455
            +       
Sbjct: 497 NMEGDGKRP 505


>gi|167719684|ref|ZP_02402920.1| type II/III secretion system protein [Burkholderia pseudomallei
           DM98]
 gi|167902788|ref|ZP_02489993.1| type II/III secretion system protein [Burkholderia pseudomallei
           NCTC 13177]
          Length = 448

 Score =  303 bits (775), Expect = 6e-80,   Method: Composition-based stats.
 Identities = 129/458 (28%), Positives = 213/458 (46%), Gaps = 27/458 (5%)

Query: 29  IKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMY 88
                 AV          G  +++      ++++P     V V+DP  ADV V +P+ ++
Sbjct: 5   ALALGMAVAPRFARAADLGPVLAVPAGGGEMVKLPAPAVAVFVADPDVADVHVPTPQAVF 64

Query: 89  LFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLH 148
           + GK  G   +  +G + + +L   ++++ D   L+  L        + +     ++++ 
Sbjct: 65  VLGKKAGTTTLFALGANNRTILRETVVVDVDTPSLQRILDARFPQLRLTLAGAPGSLMVS 124

Query: 149 GMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRD 208
           G V +  D+   V+  + +L Q           + ++N L +A   QV L+V I EV R+
Sbjct: 125 GRVPSAADADAVVQTLKPYLRQQ----------EALVNRLTLARPIQVHLRVRITEVDRN 174

Query: 209 ILKQIGFQHSITGSSSGPSKSFAADFG-------GKFVSEGGDFSVKGVL--DRFSFETV 259
           I +Q+G   S  G+S                      +S  G FSV G     R+S + V
Sbjct: 175 ITQQLGINWSALGASGNFVGGLFNGRTLFDTASKAFDLSPSGAFSVVGGFHTSRYSIDGV 234

Query: 260 LHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFT 319
           L AL++   I  LAEP LTAISGQ+ASF +GG+        +TGA ++    YGV L FT
Sbjct: 235 LDALDQEGLITMLAEPNLTAISGQTASFLAGGEFPIPVAQDTTGAITIQFKPYGVSLDFT 294

Query: 320 PTVLSPGRIGLRIQTEVSEPVIGVNAGD----MPSYRVRKADTTVELPSGGTIVLAGLLK 375
           PTVL+  RI L+++ EVSE     +       +P+  VR+ DTTVEL SG +  + GLL+
Sbjct: 295 PTVLADNRISLKVRPEVSEIDPTNSVTTGSIKVPALTVRRVDTTVELSSGQSFAIGGLLQ 354

Query: 376 DDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYS 435
                +   +P L+++P+LG LF +  +  ++TE+ +  TP++V+P    +L    D  +
Sbjct: 355 SKSSDVLAELPGLARLPVLGKLFSSRNYLNDKTEVVVIVTPYIVQPANPGELRDALDDVT 414

Query: 436 VEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIY 473
                  F   R   I         +     G  GF+Y
Sbjct: 415 RPSSDIEFVLQRSLGIDPLGG----DAPRLAGPAGFVY 448


>gi|171320618|ref|ZP_02909638.1| type II and III secretion system protein [Burkholderia ambifaria
           MEX-5]
 gi|171094131|gb|EDT39218.1| type II and III secretion system protein [Burkholderia ambifaria
           MEX-5]
          Length = 460

 Score =  302 bits (774), Expect = 7e-80,   Method: Composition-based stats.
 Identities = 131/457 (28%), Positives = 214/457 (46%), Gaps = 29/457 (6%)

Query: 32  ANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFG 91
           A    +         G  +SI   K  +L +      + V+DP+ AD+ V SPRT+++FG
Sbjct: 18  APGVALAQRAHAADAGAALSIATGKGEMLSLSEPATAMFVADPSIADIQVPSPRTVFVFG 77

Query: 92  KNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMV 151
           K  G   +I +G + + +L   ++++ D A L+  L        + V     ++++ G V
Sbjct: 78  KKAGTTTLIALGANHRPILRRTVIVQVDTASLQTVLDSRFPQLKLSVSGAPGSLMVSGKV 137

Query: 152 RTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILK 211
            +  D+   ++    +L+            +K++N L ++   QV L+V + EV R++ +
Sbjct: 138 PSAADADAVMQSLTPYLNDK----------EKIVNRLTLSRPIQVNLRVRVTEVSRNVTQ 187

Query: 212 QIGFQHSITGSSSGPSKSFAADFGGKFV-------SEGGDFSVKGVL--DRFSFETVLHA 262
           Q+G   S  G++                       S  G +SV G     R+S + VL A
Sbjct: 188 QLGINWSSLGAAGNFIGGLFNGRTLMDPTTKLFNLSPTGAYSVLGGFHAGRWSIDVVLDA 247

Query: 263 LERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVS--SSTGATSVTTHDYGVVLHFTP 320
           L++   I  LAEP LTA+SGQ+ASF +GG+         S+TGA +V    +GV L FTP
Sbjct: 248 LDQEGLITMLAEPNLTAMSGQTASFLAGGEIPIPVAQAGSTTGAITVEFKPFGVSLDFTP 307

Query: 321 TVLSPGRIGLRIQTEVSEP----VIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKD 376
           TVL+  RI L+++ EVSE      +      +P   VR+ +TTVEL SG +  + GLL+ 
Sbjct: 308 TVLADNRISLKVRPEVSEVDANNSVTTGGVTVPGLTVRRVETTVELSSGQSFAIGGLLQS 367

Query: 377 DIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSV 436
                   IP L ++PI+G LF +  F   +TE+ +  TP++V+P     L +  D  + 
Sbjct: 368 QTADTVSQIPGLGRLPIIGRLFSSKNFQDNKTEVVVIVTPYIVQPTGPGQLEQALDTVAR 427

Query: 437 EDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIY 473
                 F   R   +      +        GA GF+Y
Sbjct: 428 PSSDLEFAVQRNLGLDLLSGET----PRLVGAAGFVY 460


>gi|207744158|ref|YP_002260550.1| pilus assembly protein, secretin cpac [Ralstonia solanacearum
           IPO1609]
 gi|206595562|emb|CAQ62489.1| pilus assembly protein, secretin cpac [Ralstonia solanacearum
           IPO1609]
          Length = 626

 Score =  302 bits (772), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 117/463 (25%), Positives = 215/463 (46%), Gaps = 42/463 (9%)

Query: 24  AKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHS 83
           A        +AA        + +  ++++ + K  ++Q+P  V++  V +P     ++ S
Sbjct: 74  AATAEASRESAAKGPNCTGAMREHSEVTVPVGKSTMVQLPEPVRNRTVGNPHIVQAMLVS 133

Query: 84  PRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADS-NIRVEMVS 142
           P+T+YL G+ VG  N+I+ G  G     +D+ +  D   L+ TLR  +  + N++V   +
Sbjct: 134 PQTLYLLGQEVGTTNMIVQGRSGSC-SVIDVSVGADPGGLQSTLRTLMPGAKNVQVSAAA 192

Query: 143 DTVVLHGMVRTIQDSQRAVELSETFL----------------------SQSGRNQYANSS 180
           D++VL G V     +Q+ ++++  F+                         G    A   
Sbjct: 193 DSLVLGGSVSDSVQAQKVLDIANAFVMHQTRGPAQGDQGGAAQGGGAMQGLGATPGAPPR 252

Query: 181 SKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVS 240
           S +++N++ +    QV L+V +AEV + ++ Q+G   ++    +G   S+       F+S
Sbjct: 253 SPRIINMMAVEAPQQVMLEVKVAEVSKTLIDQMGSALNV----NGAFGSWTFGALANFLS 308

Query: 241 EGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSS 300
              D       +    +  L A +    ++ LAEP+L AISGQ ASF +GG+        
Sbjct: 309 GSNDIVNFSKNNHLPLKFALDAQKGDGLVKVLAEPSLMAISGQEASFLAGGKVFIPVSQG 368

Query: 301 STGA----TSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIG---------VNAGD 347
           +         +    +GV L FTPTV+  GRI L++  EVSE              N   
Sbjct: 369 AATNGVATIILQEETFGVGLRFTPTVMENGRINLKVSPEVSELSPTGVAVTAPNSNNTSI 428

Query: 348 MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREE 407
           +P    R+A TT+++  G +  + GL+K+++    + IP + ++P++GAL R++ F +++
Sbjct: 429 LPLITTRRASTTLQVHDGQSFAIGGLIKNNVTGSLKAIPGIGELPVIGALARSTSFQQDQ 488

Query: 408 TEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNK 450
           TE+    TP LVKP+       P D +   + A+ F    +  
Sbjct: 489 TELVFVVTPHLVKPL-PAQYPLPTDSFGRANPAEIFLNGNMEG 530


>gi|167581961|ref|ZP_02374835.1| type II/III secretion system protein [Burkholderia thailandensis
           TXDOH]
          Length = 441

 Score =  302 bits (772), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 128/454 (28%), Positives = 212/454 (46%), Gaps = 27/454 (5%)

Query: 33  NAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGK 92
            AAV             +++      ++++P     V V+DP  ADV V +P+ +++ GK
Sbjct: 2   GAAVEPRLARAAEPAAVLAVPAGGGEMVKLPQPAVAVFVADPDVADVHVPTPQAVFVLGK 61

Query: 93  NVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVR 152
             G   +  +G + + +L   +++  D   L+  L       ++ +     ++++ G V 
Sbjct: 62  KAGTTTLFALGANDRTILRETVVVNVDTPSLQRILDARFPQLHLTLAGAPGSLMVSGRVP 121

Query: 153 TIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQ 212
           +  D+   V+  + +L Q           + ++N L +A   QV L+V I EV R+I +Q
Sbjct: 122 SAADADAVVQTLKPYLRQQ----------ESLVNRLTLARPIQVHLRVRITEVDRNITQQ 171

Query: 213 IGFQHSITGSSSGPSKSFAADFG-------GKFVSEGGDFSVKGVL--DRFSFETVLHAL 263
           +G   S  G+S                      +S  G FSV G      +S + VL AL
Sbjct: 172 LGINWSALGASGNFVGGLFNGRTLFDTASKAFDLSPSGAFSVVGGFHTSHYSIDGVLDAL 231

Query: 264 ERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVL 323
           ++   I  LAEP LTAISGQ+ASF +GG+        +TGA ++    YGV L FTPTVL
Sbjct: 232 DQEGLITMLAEPNLTAISGQTASFLAGGEFPIPVAQDTTGAITIQFKPYGVSLDFTPTVL 291

Query: 324 SPGRIGLRIQTEVSEPVIGVNAGD----MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQ 379
           +  RI L+++ EVSE     +       +P+  VR+ DTTVEL SG +  + GLL+    
Sbjct: 292 ADNRISLKVRPEVSEIDPTNSVTTGSIKVPALTVRRVDTTVELSSGQSFAIGGLLQSKSS 351

Query: 380 QLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDD 439
            +   +P L+++P+LG LF +  +  ++TE+ +  TP++V+P    +L    D  +    
Sbjct: 352 DVLAELPGLARLPVLGKLFSSRNYLNDKTEVVVIVTPYIVQPANPGELRDALDDITRPSS 411

Query: 440 AKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIY 473
              F   R   I         +     G  GF+Y
Sbjct: 412 DIEFVLQRSLGIDPLGG----DAPRLTGPAGFVY 441


>gi|90406750|ref|ZP_01214943.1| RhcC2 protein [Psychromonas sp. CNPT3]
 gi|90312203|gb|EAS40295.1| RhcC2 protein [Psychromonas sp. CNPT3]
          Length = 459

 Score =  302 bits (772), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 122/458 (26%), Positives = 200/458 (43%), Gaps = 43/458 (9%)

Query: 44  IGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIG 103
             + K +++ L++  +L +P   + + ++    AD    +   + +FGK VG  ++ ++ 
Sbjct: 17  SAQAKTLNVTLDQAKLLVLPKTAKSIFIASDRVADYQTLTNTKIMIFGKRVGSTSLYVLD 76

Query: 104 HDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVEL 163
                + +  + +  ++  L   ++    ++ +  E  +  + L G V T   +++ V L
Sbjct: 77  ARENVIYSATVKVNHNVQELNALIKHEFPNAQVHSESTAGKLFLKGQVSTPSIAEKIVRL 136

Query: 164 SETFLSQSGRNQYANSSS---------------------KKVMNLLNIAGEDQVTLKVTI 202
           +E ++S +G    +  ++                     ++++N L I    QV L+V I
Sbjct: 137 AEGYVSSNGGKSESAGAATEGGAQDDQQGGESAQSTQNTQELINQLVITMPTQVNLRVRI 196

Query: 203 AEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHA 262
           AEV R++  ++G +                   G      G  +    +       ++ A
Sbjct: 197 AEVSRNVSNKLGIKWGAQN-------------IGTISGTFGTKNWLPNVKFPDLSIMIDA 243

Query: 263 LERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTV 322
           L     I  LAEP LTAISG+ ASF  GG+     V   +    +    +GV L F PTV
Sbjct: 244 LASNGLISILAEPNLTAISGERASFLVGGEIPLPVVFGDSAN--IIYKPFGVRLDFKPTV 301

Query: 323 LSPGRIGLRIQTEVSEPVIGVN----AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDI 378
           LS  RI L+I+ EVS      N       +P +  RKA TT+EL SG +  + GLL+   
Sbjct: 302 LSANRIRLQIEPEVSTIAPRTNVQIGGSSLPVFITRKASTTIELASGQSFAIGGLLQSKD 361

Query: 379 QQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVED 438
            +  + IPLL  IPILGALFR+S F REETE+ I AT +LV+P      S P D      
Sbjct: 362 IEQLQKIPLLGDIPILGALFRSSEFQREETELIIIATVYLVQPTRSDKFSLPTDGLLPLS 421

Query: 439 DAKAFF---FNRVNKIYGPKEASEVEGQNYKGAIGFIY 473
           D +        +V        +S        G  GF Y
Sbjct: 422 DIERLLAWPHKKVTPTTMGSFSSTPSQPRLLGDNGFYY 459


>gi|121600042|ref|YP_993006.1| type II/III secretion system protein [Burkholderia mallei SAVP1]
 gi|124383335|ref|YP_001026338.1| type II secretion system protein [Burkholderia mallei NCTC 10229]
 gi|126450127|ref|YP_001080388.1| RhcC2 [Burkholderia mallei NCTC 10247]
 gi|237812165|ref|YP_002896616.1| type II/III secretion system protein [Burkholderia pseudomallei
           MSHR346]
 gi|254178619|ref|ZP_04885274.1| RhcC2 [Burkholderia mallei ATCC 10399]
 gi|254358540|ref|ZP_04974813.1| RhcC2 [Burkholderia mallei 2002721280]
 gi|121228852|gb|ABM51370.1| type II/III secretion system protein [Burkholderia mallei SAVP1]
 gi|124291355|gb|ABN00624.1| putative type II secretion system protein [Burkholderia mallei NCTC
           10229]
 gi|126242997|gb|ABO06090.1| RhcC2 [Burkholderia mallei NCTC 10247]
 gi|148027667|gb|EDK85688.1| RhcC2 [Burkholderia mallei 2002721280]
 gi|160699658|gb|EDP89628.1| RhcC2 [Burkholderia mallei ATCC 10399]
 gi|237503093|gb|ACQ95411.1| type II/III secretion system protein [Burkholderia pseudomallei
           MSHR346]
          Length = 482

 Score =  301 bits (770), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 129/452 (28%), Positives = 213/452 (47%), Gaps = 27/452 (5%)

Query: 35  AVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNV 94
           AV          G  +++      ++++P     V V+DP  ADV V +P+ +++ GK  
Sbjct: 45  AVAPRFARAADLGPVLAVPAGGGEMVKLPAPAVAVFVADPDVADVHVPTPQAVFVLGKKA 104

Query: 95  GQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTI 154
           G   +  +G + + +L   ++++ D   L+  L        + +     ++++ G V + 
Sbjct: 105 GTTTLFALGANNRTILRETVVVDVDTPSLQRILDARFPQLRLTLAGAPGSLMVSGRVPSA 164

Query: 155 QDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIG 214
            D+   V+  + +L Q           + ++N L +A   QV L+V I EV R+I +Q+G
Sbjct: 165 ADADAVVQTLKPYLRQQ----------EALVNRLTLARPIQVHLRVRITEVDRNITQQLG 214

Query: 215 FQHSITGSSSGPSKSFAADFG-------GKFVSEGGDFSVKGVL--DRFSFETVLHALER 265
              S  G+S                      +S  G FSV G     R+S + VL AL++
Sbjct: 215 INWSALGASGNFVGGLFNGRTLFDTASKAFDLSPSGAFSVVGGFHTSRYSIDGVLDALDQ 274

Query: 266 ATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSP 325
              I  LAEP LTAISGQ+ASF +GG+        +TGA ++    YGV L FTPTVL+ 
Sbjct: 275 EGLITMLAEPNLTAISGQTASFLAGGEFPIPVAQDTTGAITIQFKPYGVSLDFTPTVLAD 334

Query: 326 GRIGLRIQTEVSEPVIGVNAGD----MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQL 381
            RI L+++ EVSE     +       +P+  VR+ DTTVEL SG +  + GLL+     +
Sbjct: 335 NRISLKVRPEVSEIDPTNSVTTGSIKVPALTVRRVDTTVELSSGQSFAIGGLLQSKSSDV 394

Query: 382 KEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAK 441
              +P L+++P+LG LF +  +  ++TE+ +  TP++V+P    +L    D  +      
Sbjct: 395 LAELPGLARLPVLGKLFSSRNYLNDKTEVVVIVTPYIVQPANPGELRDALDDVTRPSSDI 454

Query: 442 AFFFNRVNKIYGPKEASEVEGQNYKGAIGFIY 473
            F   R   I         +     G  GF+Y
Sbjct: 455 EFVLQRSLGIDPLGG----DAPRLAGPAGFVY 482


>gi|76811933|ref|YP_333435.1| RhcC2 [Burkholderia pseudomallei 1710b]
 gi|126441311|ref|YP_001058908.1| type II/III secretion system protein [Burkholderia pseudomallei
           668]
 gi|126453026|ref|YP_001066150.1| type II/III secretion system protein [Burkholderia pseudomallei
           1106a]
 gi|134282366|ref|ZP_01769071.1| type II/III secretion system protein [Burkholderia pseudomallei
           305]
 gi|217421397|ref|ZP_03452901.1| type II/III secretion system protein [Burkholderia pseudomallei
           576]
 gi|226196310|ref|ZP_03791892.1| type II/III secretion system protein [Burkholderia pseudomallei
           Pakistan 9]
 gi|242314528|ref|ZP_04813544.1| type II/III secretion system protein [Burkholderia pseudomallei
           1106b]
 gi|254179872|ref|ZP_04886471.1| type II/III secretion system protein [Burkholderia pseudomallei
           1655]
 gi|254188722|ref|ZP_04895233.1| type II/III secretion system protein [Burkholderia pseudomallei
           Pasteur 52237]
 gi|254197611|ref|ZP_04904033.1| type II/III secretion system protein [Burkholderia pseudomallei
           S13]
 gi|254261104|ref|ZP_04952158.1| type II/III secretion system protein [Burkholderia pseudomallei
           1710a]
 gi|254297713|ref|ZP_04965166.1| type II/III secretion system protein [Burkholderia pseudomallei
           406e]
 gi|76581386|gb|ABA50861.1| RhcC2 [Burkholderia pseudomallei 1710b]
 gi|126220804|gb|ABN84310.1| type II/III secretion system protein [Burkholderia pseudomallei
           668]
 gi|126226668|gb|ABN90208.1| type II/III secretion system protein [Burkholderia pseudomallei
           1106a]
 gi|134246404|gb|EBA46493.1| type II/III secretion system protein [Burkholderia pseudomallei
           305]
 gi|157806781|gb|EDO83951.1| type II/III secretion system protein [Burkholderia pseudomallei
           406e]
 gi|157936401|gb|EDO92071.1| type II/III secretion system protein [Burkholderia pseudomallei
           Pasteur 52237]
 gi|169654352|gb|EDS87045.1| type II/III secretion system protein [Burkholderia pseudomallei
           S13]
 gi|184210412|gb|EDU07455.1| type II/III secretion system protein [Burkholderia pseudomallei
           1655]
 gi|217395139|gb|EEC35157.1| type II/III secretion system protein [Burkholderia pseudomallei
           576]
 gi|225931527|gb|EEH27532.1| type II/III secretion system protein [Burkholderia pseudomallei
           Pakistan 9]
 gi|242137767|gb|EES24169.1| type II/III secretion system protein [Burkholderia pseudomallei
           1106b]
 gi|254219793|gb|EET09177.1| type II/III secretion system protein [Burkholderia pseudomallei
           1710a]
          Length = 482

 Score =  301 bits (770), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 129/452 (28%), Positives = 213/452 (47%), Gaps = 27/452 (5%)

Query: 35  AVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNV 94
           AV          G  +++      ++++P     V V+DP  ADV V +P+ +++ GK  
Sbjct: 45  AVAPRFARAADLGPVLAVPAGGGEMVKLPAPAVAVFVADPDVADVHVPTPQAVFVLGKKA 104

Query: 95  GQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTI 154
           G   +  +G + + +L   ++++ D   L+  L        + +     ++++ G V + 
Sbjct: 105 GTTTLFALGANNRTILRETVVVDVDTPSLQRILDARFPQLRLTLAGAPGSLMVSGRVPSA 164

Query: 155 QDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIG 214
            D+   V+  + +L Q           + ++N L +A   QV L+V I EV R+I +Q+G
Sbjct: 165 ADADAVVQTLKPYLRQQ----------EALVNRLTLARPIQVHLRVRITEVDRNITQQLG 214

Query: 215 FQHSITGSSSGPSKSFAADFG-------GKFVSEGGDFSVKGVL--DRFSFETVLHALER 265
              S  G+S                      +S  G FSV G     R+S + VL AL++
Sbjct: 215 INWSALGASGNFVGGLFNGRTLFDTASKAFDLSPSGAFSVVGGFHTSRYSIDGVLDALDQ 274

Query: 266 ATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSP 325
              I  LAEP LTAISGQ+ASF +GG+        +TGA ++    YGV L FTPTVL+ 
Sbjct: 275 EGLITMLAEPNLTAISGQTASFLAGGEFPIPVAQDTTGAITIQFKPYGVSLDFTPTVLAD 334

Query: 326 GRIGLRIQTEVSEPVIGVNAGD----MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQL 381
            RI L+++ EVSE     +       +P+  VR+ DTTVEL SG +  + GLL+     +
Sbjct: 335 NRISLKVRPEVSEIDPTNSVTTGSIKVPALTVRRVDTTVELSSGQSFAIGGLLQSKSSDV 394

Query: 382 KEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAK 441
              +P L+++P+LG LF +  +  ++TE+ +  TP++V+P    +L    D  +      
Sbjct: 395 LAELPGLARLPVLGKLFSSRNYLNDKTEVVVIVTPYIVQPANPGELRDALDDVTRPSSDI 454

Query: 442 AFFFNRVNKIYGPKEASEVEGQNYKGAIGFIY 473
            F   R   I         +     G  GF+Y
Sbjct: 455 EFVLQRSLGIDPLGG----DAPRLAGPAGFVY 482


>gi|27376953|ref|NP_768482.1| RhcC2 protein [Bradyrhizobium japonicum USDA 110]
 gi|27350095|dbj|BAC47107.1| RhcC2 protein [Bradyrhizobium japonicum USDA 110]
          Length = 430

 Score =  300 bits (769), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 122/441 (27%), Positives = 200/441 (45%), Gaps = 17/441 (3%)

Query: 39  ISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQAN 98
                      ++I  ++   + +      + V+DP  AD    S  T+++FGK  G+ +
Sbjct: 2   PRAAPGSTTGTLNITSSQGKTVHLSAPAATIFVADPAIADYQAPSSSTIFVFGKKSGRTS 61

Query: 99  VILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQ 158
           +  +  +G+ +  L I++ + +  L   L+  + D  I+V       +L G+       +
Sbjct: 62  LFALNENGEALAELRIVVTQPLEDLRAALKAEVGDYPIQVSYTPRGAILSGIAPNADVVE 121

Query: 159 RAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHS 218
            A +++E F+           +   V+N + +AG  QV L V +AEV R  +K +    +
Sbjct: 122 AARKVTEQFVG----------AGAPVVNKIQVAGSLQVNLSVRVAEVSRTAVKDLNINFT 171

Query: 219 ITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLT 278
            +G + G   +     G      GG   +       +   VL AL        LAEP LT
Sbjct: 172 ASGPN-GAFLATGKPGGSGRAGGGGTIGIGFSTGNINLSAVLDALASEHLASILAEPNLT 230

Query: 279 AISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE 338
           A+SG++ASF +GG+     V       SV    +GV L F PTVLS  +I +R++ EVSE
Sbjct: 231 AMSGEAASFLAGGEFPIP-VMQDNRQVSVQFRQFGVSLEFVPTVLSNNQIIVRVKPEVSE 289

Query: 339 PVIG----VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPIL 394
                   +N   +P+   R+A T VEL SG +  + GL++ +        P L  +PIL
Sbjct: 290 LSTEGEVKINGMAVPALSTRRASTVVELASGQSFAIGGLIRRNFNTDIGEFPWLGDVPIL 349

Query: 395 GALFRNSRFNREETEIFIAATPFLVKP-VAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYG 453
           GALFR+S F + ETE+ I  TP++V+P      +S P +  +   DA     N V +   
Sbjct: 350 GALFRSSSFQKRETELVIVVTPYIVRPGSNPSQISIPTNRIAPPSDAGRILTNTVARPPQ 409

Query: 454 PKEASEVEGQNYKGAIGFIYK 474
            ++A         G  GFI +
Sbjct: 410 GRDAPRASAPGLTGNAGFIIE 430


>gi|148253058|ref|YP_001237643.1| putative pilus assembly protein CpaC [Bradyrhizobium sp. BTAi1]
 gi|146405231|gb|ABQ33737.1| putative Pilus assembly protein cpaC [Bradyrhizobium sp. BTAi1]
          Length = 496

 Score =  300 bits (769), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 127/495 (25%), Positives = 212/495 (42%), Gaps = 38/495 (7%)

Query: 10  TMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDV 69
           T  ++ L ++  S+         +   + +   +    ++IS+  +K   +++       
Sbjct: 4   TWAAVALMAATISIGIYGIGPARSQ--VRVVQDDPVPARQISVTRDKSRTIKLDKPFASA 61

Query: 70  LVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRR 129
           LV  P  ADV+  S R +Y+ GK +G  NV L   D   +  + + +  DI ++   +R 
Sbjct: 62  LVGAPDIADVLPMSDRIVYIQGKKIGTTNVTLFDQDKNVIGVIGLEVTIDIQNIASKIRS 121

Query: 130 FIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLN 189
                 IRV   ++ +VL G  R   D+++AV ++                 K V+N + 
Sbjct: 122 GTNSPGIRVSSSNNQIVLSGEARDAVDAEKAVAIARGMA----TPPEGKDPEKYVINAMR 177

Query: 190 IAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAAD---------------- 233
           +A   QV L+V   EV R   ++IG       +S     +                    
Sbjct: 178 VAASQQVMLRVRFIEVSRQAEREIGVNWFGANASGTRGINTGTGAISQAGPTATSAGVPV 237

Query: 234 -------FGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSAS 286
                   G    +  G           S + ++ ALE+    R LAEP L A+SG +AS
Sbjct: 238 FNTIGTFAGSTLSAPFGVGLFNLANKGGSVDVLITALEKKGLARRLAEPDLVALSGDTAS 297

Query: 287 FTSGGQHLYKTVSSSTGATSVT---THDYGVVLHFTPTVLSPGRIGLRIQTEVSEPV--- 340
           F +GG++   +V SS+G T V       +GV L F PTVL+ G I LR+   VSE     
Sbjct: 298 FLAGGEYPVPSVQSSSGTTPVITVLYKPFGVQLTFVPTVLASGIINLRLTPSVSELDYTN 357

Query: 341 -IGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFR 399
            + ++   +P+   R+A T +EL  G +  +AGLL+ D  +    +P L  +P+LG LFR
Sbjct: 358 AVAISGTLVPALSKREARTAIELRDGQSFAIAGLLQSDNLRDVGQLPWLGSVPVLGTLFR 417

Query: 400 NSRFNREETEIFIAATPFLVKPVAM-RDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEAS 458
           ++ + ++ET++ +  TP LV P A  + L+ P D     +D   F   R        +  
Sbjct: 418 STSYQQKETDLVVIVTPHLVAPAAPGQALATPFDKQLPGNDVDLFLMGRPEVRKQYTD-Y 476

Query: 459 EVEGQNYKGAIGFIY 473
              G    G  G + 
Sbjct: 477 LTSGGANVGPYGHMM 491


>gi|167829715|ref|ZP_02461186.1| Putative phospholipid-binding domain family protein [Burkholderia
           pseudomallei 9]
          Length = 510

 Score =  300 bits (769), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 123/432 (28%), Positives = 219/432 (50%), Gaps = 20/432 (4%)

Query: 42  VEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVIL 101
            E+ +   +S+ L K +++ +   V++  + +P  A   + SPRT+YL G +VG  N+I+
Sbjct: 72  GEMRESTSVSVPLGKSLLVPLDEPVRNRTIGNPAVAQATMVSPRTLYLVGMSVGTTNMIV 131

Query: 102 IGHDGKQMLNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRA 160
            G  G     +D+ +  D   L+ +LR+ +    +IRV   +DT+VL G V + Q +Q+A
Sbjct: 132 QGKSGACR-IIDVAVGADAGGLQASLRQLMPRERDIRVSTAADTIVLAGNVSSAQAAQQA 190

Query: 161 VELSETFLSQSGRNQYANSSSKK--VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHS 218
           V +++ + +++      +    +  V+N+L +    QV L+V +AEV + ++ Q+G   +
Sbjct: 191 VAIAKAYSNRTNAGAAGSGGGARADVLNMLTVTSPQQVMLEVKVAEVSKTLINQMGSAVN 250

Query: 219 ITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLT 278
           I G     + +         ++  G        ++      + A      ++ LAEP L 
Sbjct: 251 IQGGFGSWTGALVTSL----LTGVGSGIAASKSNKLPLNGSIDAQNTDQPVKILAEPRLV 306

Query: 279 AISGQSASFTSGGQHLYKTVSSS---TGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTE 335
            ISGQ A+F +GG+       SS   T   ++   ++GV L FTPTVLS GRI L++  E
Sbjct: 307 TISGQEATFLAGGKIFIPVPQSSGIGTNTITLQEEEFGVGLKFTPTVLSNGRISLKVAPE 366

Query: 336 VSEPVIG---------VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIP 386
           VSE              N   +P    R+A TTV++  G T  + GL+KD+ Q   + +P
Sbjct: 367 VSELSPTGVTLSAANVGNVSILPLITTRRASTTVQMGDGETFAIGGLIKDNAQGTLKALP 426

Query: 387 LLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFN 446
            + ++P+LGALFR++ F ++ TE+    TP LV+P+   D+  P D ++  ++A  +   
Sbjct: 427 GIGELPVLGALFRSTSFQQDRTELVFIITPHLVQPLETADVPLPTDSFTKPNEADVYATG 486

Query: 447 RVNKIYGPKEAS 458
            +    G ++  
Sbjct: 487 NMEGRGGLRQHG 498


>gi|134291857|ref|YP_001115626.1| type II and III secretion system protein [Burkholderia
           vietnamiensis G4]
 gi|134135046|gb|ABO59371.1| type II and III secretion system protein [Burkholderia
           vietnamiensis G4]
          Length = 647

 Score =  300 bits (768), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 121/434 (27%), Positives = 210/434 (48%), Gaps = 18/434 (4%)

Query: 42  VEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVIL 101
             +     +S+ L K +++ +P  V++  + +P  A   + SP+T+Y+ G +VG  N+I+
Sbjct: 92  GAVRDSTSVSVPLGKSLLVPMPEAVRNRTIGNPAVAQATMVSPQTLYILGLSVGTTNMIV 151

Query: 102 IGHDGKQMLNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRA 160
            G  G     +D+ +  D   L+ +L + +    +I V   + T+VL G V   Q +Q+A
Sbjct: 152 QGKSGACR-VIDVAVGADAGGLQASLLQLMPAERDIHVSTAAGTIVLAGTVSNSQAAQQA 210

Query: 161 VELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSIT 220
           V+++  +   +G  +   +    V+N+L++    QV L+V +AEV + ++ Q+G   +I 
Sbjct: 211 VQIARAYSDSAGGGEGGTAKGGGVLNMLSVTSPQQVMLEVKVAEVSKTLINQMGSALNIQ 270

Query: 221 GSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAI 280
           G     S +  ++      S      V    +   F     A      ++ LAEP L  I
Sbjct: 271 GGFGSWSGALVSNLLAGVASAA----VFNKANNKPFSIAADAQNTDNLVKILAEPNLVTI 326

Query: 281 SGQSASFTSGGQHLYKTVSSSTGATSV---TTHDYGVVLHFTPTVLSPGRIGLRIQTEVS 337
           SGQ A+F +GG+       SS    S       ++GV L FTPTVL+ GRI L++  EVS
Sbjct: 327 SGQEATFLAGGKIFIPVPQSSGTGVSTITLQQEEFGVALKFTPTVLANGRISLKVAPEVS 386

Query: 338 EPVIG---------VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLL 388
           E                  +P    R+A TTV++  G +  + GL+KD+     + IP +
Sbjct: 387 ELSQTGVTLSATNIGGTSILPLITTRRASTTVQMSDGESFAIGGLIKDNATGALKAIPGV 446

Query: 389 SKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRV 448
            ++P+LGALFR++ F ++ TE+    TP LVKP+   D   P D +S  ++A  +    +
Sbjct: 447 GEVPVLGALFRSTSFQQDRTELIFLITPHLVKPLQSADQPMPTDSFSKPNEADVYATGNM 506

Query: 449 NKIYGPKEASEVEG 462
              +G +  +    
Sbjct: 507 EGRHGVRRPAAQPA 520


>gi|148976307|ref|ZP_01813031.1| type II and III secretion system protein [Vibrionales bacterium
           SWAT-3]
 gi|145964401|gb|EDK29656.1| type II and III secretion system protein [Vibrionales bacterium
           SWAT-3]
          Length = 464

 Score =  300 bits (768), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 114/459 (24%), Positives = 204/459 (44%), Gaps = 44/459 (9%)

Query: 44  IGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIG 103
                 + + +N+  ++++P   + + +S    AD    +   + +FGK  G A + ++ 
Sbjct: 21  ASAASALDVTINEAKMIRLPEKAKSIFISSTHIADYQTLTNTKVMVFGKRAGSATITVLN 80

Query: 104 HDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVEL 163
              + +    I +  +       ++    ++++  E +   + L G V +   +   V L
Sbjct: 81  EQERVIYTNKIRVTHNSREFNELVKNKFPEASVNAESLGGKLWLKGRVPSPMMAHNIVSL 140

Query: 164 SETFLS----------------------QSGRNQYANSSSKKVMNLLNIAGEDQVTLKVT 201
           ++ +LS                         ++Q  +S  ++++N L +   +QV ++V 
Sbjct: 141 AKGYLSPIVNQTEQKEGSNTNKNNSSDSALTQSQPTSSKEEELINQLVVTMPNQVNIRVK 200

Query: 202 IAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLH 261
           IAEV R++  ++G +        G                   F       + S  T++ 
Sbjct: 201 IAEVSRNVSNKLGIKWGSLAGGVGQFYF-------------AKFPNVSSWGKPSITTLVD 247

Query: 262 ALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPT 321
           AL     +  LAEP LTA+SG+ A F  GGQ     +++ T  T +   D+GV L+FTPT
Sbjct: 248 ALASNGMMSVLAEPNLTAMSGEDAEFLVGGQVPLPLITADT--TQIEYKDFGVKLNFTPT 305

Query: 322 VLSPGRIGLRIQTEVSEPVIG----VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDD 377
           VLS  RI L++  EVS   I     +   + PS+  R A TT+EL SG +  L GLLK +
Sbjct: 306 VLSQNRISLKVNPEVSNVSIDGQQVIQGANFPSFTTRSASTTIELASGQSFALGGLLKSE 365

Query: 378 IQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVE 437
             +  + +PL+++IP+LG+LFR++ F R ETE+ I  T +LV+P     +  P D     
Sbjct: 366 DIEQLQKVPLVAEIPVLGSLFRSTEFTRRETELIIIVTAYLVQPTRSDSMQLPTDGLIPL 425

Query: 438 DDAKAFF-FNRVNKIYGPKEASEVE--GQNYKGAIGFIY 473
            D +      R+ +     + +  +       G  GF Y
Sbjct: 426 SDVERLLALPRIQRKRTHDQDTYTDNQKPRLLGDNGFYY 464


>gi|207728106|ref|YP_002256500.1| pilus assembly protein, secretin cpac [Ralstonia solanacearum
           MolK2]
 gi|206591351|emb|CAQ56963.1| pilus assembly protein, secretin cpac [Ralstonia solanacearum
           MolK2]
          Length = 626

 Score =  300 bits (768), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 116/463 (25%), Positives = 214/463 (46%), Gaps = 42/463 (9%)

Query: 24  AKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHS 83
                    +AA        + +  ++++ + K  ++Q+P  V++  V +P     ++ S
Sbjct: 74  PATAEASRESAAKGPNCTGAMREHSEVTVPVGKSTMVQLPEPVRNRTVGNPHIVQAMLVS 133

Query: 84  PRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADS-NIRVEMVS 142
           P+T+YL G+ VG  N+I+ G  G     +D+ +  D   L+ TLR  +  + N++V   +
Sbjct: 134 PQTLYLLGQEVGTTNMIVQGRSGSC-SVIDVSVGADPGGLQSTLRTLMPGAKNVQVSAAA 192

Query: 143 DTVVLHGMVRTIQDSQRAVELSETFL----------------------SQSGRNQYANSS 180
           D++VL G V     +Q+ ++++  F+                         G    A   
Sbjct: 193 DSLVLGGSVSDSVQAQKVLDIANAFVMRQTRGPAQGDQGGAAQGGGAMQGLGATPGAPPR 252

Query: 181 SKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVS 240
           S +++N++ +    QV L+V +AEV + ++ Q+G   ++    +G   S+       F+S
Sbjct: 253 SPRIINMMAVEAPQQVMLEVKVAEVSKTLIDQMGSALNV----NGAFGSWTFGALANFLS 308

Query: 241 EGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSS 300
              D       +    +  L A +    ++ LAEP+L AISGQ ASF +GG+        
Sbjct: 309 GSNDIVNFSKNNHLPLKFALDAQKGDGLVKVLAEPSLMAISGQEASFLAGGKVFIPVSQG 368

Query: 301 STGA----TSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIG---------VNAGD 347
           +         +    +GV L FTPTV+  GRI L++  EVSE              N   
Sbjct: 369 AATNGVATIILQEETFGVGLRFTPTVMENGRINLKVSPEVSELSPTGVAVTAPNSNNTSI 428

Query: 348 MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREE 407
           +P    R+A TT+++  G +  + GL+K+++    + IP + ++P++GAL R++ F +++
Sbjct: 429 LPLITTRRASTTLQVHDGQSFAIGGLIKNNVTGSLKAIPGIGELPVIGALARSTSFQQDQ 488

Query: 408 TEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNK 450
           TE+    TP LVKP+       P D +   + A+ F    +  
Sbjct: 489 TELVFVVTPHLVKPL-PAQYPLPTDSFGRANPAEIFLNGNMEG 530


>gi|53719431|ref|YP_108417.1| putative fimbriae assembly-related protein [Burkholderia
           pseudomallei K96243]
 gi|167815898|ref|ZP_02447578.1| RhcC2 [Burkholderia pseudomallei 91]
 gi|167845816|ref|ZP_02471324.1| RhcC2 [Burkholderia pseudomallei B7210]
 gi|52209845|emb|CAH35817.1| putative fimbriae assembly-related protein [Burkholderia
           pseudomallei K96243]
          Length = 439

 Score =  300 bits (768), Expect = 4e-79,   Method: Composition-based stats.
 Identities = 129/452 (28%), Positives = 213/452 (47%), Gaps = 27/452 (5%)

Query: 35  AVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNV 94
           AV          G  +++      ++++P     V V+DP  ADV V +P+ +++ GK  
Sbjct: 2   AVAPRFARAADLGPVLAVPAGGGEMVKLPAPAVAVFVADPDVADVHVPTPQAVFVLGKKA 61

Query: 95  GQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTI 154
           G   +  +G + + +L   ++++ D   L+  L        + +     ++++ G V + 
Sbjct: 62  GTTTLFALGANNRTILRETVVVDVDTPSLQRILDARFPQLRLTLAGAPGSLMVSGRVPSA 121

Query: 155 QDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIG 214
            D+   V+  + +L Q           + ++N L +A   QV L+V I EV R+I +Q+G
Sbjct: 122 ADADAVVQTLKPYLRQQ----------EALVNRLTLARPIQVHLRVRITEVDRNITQQLG 171

Query: 215 FQHSITGSSSGPSKSFAADFG-------GKFVSEGGDFSVKGVL--DRFSFETVLHALER 265
              S  G+S                      +S  G FSV G     R+S + VL AL++
Sbjct: 172 INWSALGASGNFVGGLFNGRTLFDTASKAFDLSPSGAFSVVGGFHTSRYSIDGVLDALDQ 231

Query: 266 ATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSP 325
              I  LAEP LTAISGQ+ASF +GG+        +TGA ++    YGV L FTPTVL+ 
Sbjct: 232 EGLITMLAEPNLTAISGQTASFLAGGEFPIPVAQDTTGAITIQFKPYGVSLDFTPTVLAD 291

Query: 326 GRIGLRIQTEVSEPVIGVNAGD----MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQL 381
            RI L+++ EVSE     +       +P+  VR+ DTTVEL SG +  + GLL+     +
Sbjct: 292 NRISLKVRPEVSEIDPTNSVTTGSIKVPALTVRRVDTTVELSSGQSFAIGGLLQSKSSDV 351

Query: 382 KEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAK 441
              +P L+++P+LG LF +  +  ++TE+ +  TP++V+P    +L    D  +      
Sbjct: 352 LAELPGLARLPVLGKLFSSRNYLNDKTEVVVIVTPYIVQPANPGELRDALDDVTRPSSDI 411

Query: 442 AFFFNRVNKIYGPKEASEVEGQNYKGAIGFIY 473
            F   R   I         +     G  GF+Y
Sbjct: 412 EFVLQRSLGIDPLGG----DAPRLAGPAGFVY 439


>gi|258405291|ref|YP_003198033.1| type II and III secretion system protein [Desulfohalobium retbaense
           DSM 5692]
 gi|257797518|gb|ACV68455.1| type II and III secretion system protein [Desulfohalobium retbaense
           DSM 5692]
          Length = 455

 Score =  300 bits (768), Expect = 4e-79,   Method: Composition-based stats.
 Identities = 119/441 (26%), Positives = 202/441 (45%), Gaps = 22/441 (4%)

Query: 11  MMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKG--KKISIGLNKVIILQVPVDVQD 68
           ++   +      V  +P   +A    I  +         + + +   K ++L+   ++  
Sbjct: 11  LLIAAIMVLTFCVWSIPQEPQAQEFRIIPTKNSADDSIMRSLELTYGKSVVLKSNREITR 70

Query: 69  VLVSDPTKA-DVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTL 127
           V   DP    D ++  P  +YL     G AN+IL     +     +I ++ D++ L+  L
Sbjct: 71  VSEPDPNVLKDPLLIGPNELYLTPAGAGTANLILW-QGKEVSTVYEITVKHDLSRLKQRL 129

Query: 128 RRFIADSN-IRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMN 186
                + N +RV   ++++ L G V +     + + L+ET+  + G           + N
Sbjct: 130 HELFPEENELRVLSTNESITLSGQVSSASALDQIMALAETYAPEGG-----------IKN 178

Query: 187 LLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFS 246
            + + G  QV L+V +AEV R  L ++G    +   ++  S  F            G F+
Sbjct: 179 QVTVKGIHQVMLEVKVAEVSRQSLDRLGINFDLINDAAEFSIGFLGAASAGSSGS-GSFN 237

Query: 247 VKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATS 306
                D   F  +   L+R    + LAEP+L ++SGQ++SF +GG+     V  S G   
Sbjct: 238 FWRNGDNVDFNGLFDFLKREGLAKILAEPSLISMSGQTSSFLAGGEIPIPDV-DSDGNIG 296

Query: 307 VTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIG----VNAGDMPSYRVRKADTTVEL 362
           V    YG+ L FTPTV+S  RI +++   VSE        +N   +P  +VR+A+TTVEL
Sbjct: 297 VEFKSYGIELAFTPTVMSKERIAIKVVPVVSELDEASGTVINGAQVPGLKVRRANTTVEL 356

Query: 363 PSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPV 422
             G +  +AGLL ++ ++     P L  +P+LG LF +  F  +ETE+ I  TP LV P+
Sbjct: 357 GDGQSFAIAGLLSENSEETVSKFPGLGDLPVLGPLFTSKSFTSDETELVIMVTPKLVTPL 416

Query: 423 AMRDLSRPDDHYSVEDDAKAF 443
                S P D +    DA+ +
Sbjct: 417 VAEKQSLPTDFFIHPTDAEFY 437


>gi|167824270|ref|ZP_02455741.1| type II/III secretion system protein [Burkholderia pseudomallei 9]
 gi|167919049|ref|ZP_02506140.1| type II/III secretion system protein [Burkholderia pseudomallei
           BCC215]
          Length = 444

 Score =  300 bits (768), Expect = 4e-79,   Method: Composition-based stats.
 Identities = 129/458 (28%), Positives = 213/458 (46%), Gaps = 27/458 (5%)

Query: 29  IKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMY 88
                 AV          G  +++      ++++P     V V+DP  ADV V +P+ ++
Sbjct: 1   ALALGMAVAPRFARAADLGPVLAVPAGGGEMVKLPAPAVAVFVADPDVADVHVPTPQAVF 60

Query: 89  LFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLH 148
           + GK  G   +  +G + + +L   ++++ D   L+  L        + +     ++++ 
Sbjct: 61  VLGKKAGTTTLFALGANNRTILRETVVVDVDTPSLQRILDARFPQLRLTLAGAPGSLMVS 120

Query: 149 GMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRD 208
           G V +  D+   V+  + +L Q           + ++N L +A   QV L+V I EV R+
Sbjct: 121 GRVPSAADADAVVQTLKPYLRQQ----------EALVNRLTLARPIQVHLRVRITEVDRN 170

Query: 209 ILKQIGFQHSITGSSSGPSKSFAADFG-------GKFVSEGGDFSVKGVL--DRFSFETV 259
           I +Q+G   S  G+S                      +S  G FSV G     R+S + V
Sbjct: 171 ITQQLGINWSALGASGNFVGGLFNGRTLFDTASKAFDLSPSGAFSVVGGFHTSRYSIDGV 230

Query: 260 LHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFT 319
           L AL++   I  LAEP LTAISGQ+ASF +GG+        +TGA ++    YGV L FT
Sbjct: 231 LDALDQEGLITMLAEPNLTAISGQTASFLAGGEFPIPVAQDTTGAITIQFKPYGVSLDFT 290

Query: 320 PTVLSPGRIGLRIQTEVSEPVIGVNAGD----MPSYRVRKADTTVELPSGGTIVLAGLLK 375
           PTVL+  RI L+++ EVSE     +       +P+  VR+ DTTVEL SG +  + GLL+
Sbjct: 291 PTVLADNRISLKVRPEVSEIDPTNSVTTGSIKVPALTVRRVDTTVELSSGQSFAIGGLLQ 350

Query: 376 DDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYS 435
                +   +P L+++P+LG LF +  +  ++TE+ +  TP++V+P    +L    D  +
Sbjct: 351 SKSSDVLAELPGLARLPVLGKLFSSRNYLNDKTEVVVIVTPYIVQPANPGELRDALDDVT 410

Query: 436 VEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIY 473
                  F   R   I         +     G  GF+Y
Sbjct: 411 RPSSDIEFVLQRSLGIDPLGG----DAPRLAGPAGFVY 444


>gi|83719085|ref|YP_442980.1| type II/III secretion system protein [Burkholderia thailandensis
           E264]
 gi|257139204|ref|ZP_05587466.1| type II/III secretion system protein [Burkholderia thailandensis
           E264]
 gi|83652910|gb|ABC36973.1| type II/III secretion system protein [Burkholderia thailandensis
           E264]
          Length = 492

 Score =  300 bits (767), Expect = 4e-79,   Method: Composition-based stats.
 Identities = 126/451 (27%), Positives = 210/451 (46%), Gaps = 27/451 (5%)

Query: 36  VINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVG 95
           V             +++      ++++P     V V+DP  ADV V +P+ +++ GK  G
Sbjct: 56  VAPRLARAAEPAAVLAVPAGGGEMVKLPQPAVAVFVADPDVADVHVPTPQAVFVLGKKAG 115

Query: 96  QANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQ 155
              +  +G + + +L   +++  D   L+  L       ++ +     ++++ G V +  
Sbjct: 116 TTTLFALGANDRTILRETVVVNVDTPSLQRILDARFPQLHLTLAGAPGSLMVSGRVPSAA 175

Query: 156 DSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGF 215
           D+   V+  + +L Q           + ++N L +A   QV L+V I EV R+I +Q+G 
Sbjct: 176 DADAVVQTLKPYLRQQ----------ESLVNRLTLARPIQVHLRVRITEVDRNITQQLGI 225

Query: 216 QHSITGSSSGPSKSFAADFG-------GKFVSEGGDFSVKGVL--DRFSFETVLHALERA 266
             S  G+S                      +S  G FSV G      +S + VL AL++ 
Sbjct: 226 NWSALGASGNFVGGLFNGRTLFDTASKAFDLSPSGAFSVVGGFHTSHYSIDGVLDALDQE 285

Query: 267 TAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPG 326
             I  LAEP LTAISGQ+ASF +GG+        +TGA ++    YGV L FTPTVL+  
Sbjct: 286 GLITMLAEPNLTAISGQTASFLAGGEFPIPVAQDTTGAITIQFKPYGVSLDFTPTVLADN 345

Query: 327 RIGLRIQTEVSEPVIGVNAGD----MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLK 382
           RI L+++ EVSE     +       +P+  VR+ DTTVEL SG +  + GLL+     + 
Sbjct: 346 RISLKVRPEVSEIDPTNSVTTGSIKVPALTVRRVDTTVELSSGQSFAIGGLLQSKSSDVL 405

Query: 383 EGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKA 442
             +P L+++P+LG LF +  +  ++TE+ +  TP++V+P    +L    D  +       
Sbjct: 406 AELPGLARLPVLGKLFSSRNYLNDKTEVVVIVTPYIVQPANPGELRDALDDITRPSSDIE 465

Query: 443 FFFNRVNKIYGPKEASEVEGQNYKGAIGFIY 473
           F   R   I         +     G  GF+Y
Sbjct: 466 FVLQRSLGIDPLGG----DAPRLTGPAGFVY 492


>gi|254182583|ref|ZP_04889177.1| type II/III secretion system protein [Burkholderia pseudomallei
           1655]
 gi|184213118|gb|EDU10161.1| type II/III secretion system protein [Burkholderia pseudomallei
           1655]
          Length = 690

 Score =  300 bits (767), Expect = 4e-79,   Method: Composition-based stats.
 Identities = 123/432 (28%), Positives = 219/432 (50%), Gaps = 20/432 (4%)

Query: 42  VEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVIL 101
            E+ +   +S+ L K +++ +   V++  + +P  A   + SPRT+YL G +VG  N+I+
Sbjct: 94  GEMRESTSVSVPLGKSLLVPLDEPVRNRTIGNPAVAQATMVSPRTLYLVGMSVGTTNMIV 153

Query: 102 IGHDGKQMLNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRA 160
            G  G     +D+ +  D   L+ +LR+ +    +IRV   +DT+VL G V + Q +Q+A
Sbjct: 154 QGKSGACR-IIDVAVGADAGGLQASLRQLMPREHDIRVSTAADTIVLAGNVSSAQAAQQA 212

Query: 161 VELSETFLSQSGRNQYANSSSKK--VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHS 218
           V +++ + +++      +    +  V+N+L +    QV L+V +AEV + ++ Q+G   +
Sbjct: 213 VAIAKAYSNRTNAGAAGSGGGARADVLNMLTVTSPQQVMLEVKVAEVSKTLINQMGSAVN 272

Query: 219 ITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLT 278
           I G     + +         ++  G        ++      + A      ++ LAEP L 
Sbjct: 273 IQGGFGSWTGALVTSL----LTGVGSGIAASKSNKLPLNGSIDAQNTDQPVKILAEPRLV 328

Query: 279 AISGQSASFTSGGQHLYKTVSSS---TGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTE 335
            ISGQ A+F +GG+       SS   T   ++   ++GV L FTPTVLS GRI L++  E
Sbjct: 329 TISGQEATFLAGGKIFIPVPQSSGIGTNTITLQEEEFGVGLKFTPTVLSNGRISLKVAPE 388

Query: 336 VSEPVIGV---------NAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIP 386
           VSE              N   +P    R+A TTV++  G T  + GL+KD+ Q   + +P
Sbjct: 389 VSELSPTGVTLSAANVGNVSILPLITTRRASTTVQMGDGETFAIGGLIKDNAQGTLKALP 448

Query: 387 LLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFN 446
            + ++P+LGALFR++ F ++ TE+    TP LV+P+   D+  P D ++  ++A  +   
Sbjct: 449 GIGELPVLGALFRSTSFQQDRTELVFIITPHLVQPLETADVPLPTDSFTKPNEADVYATG 508

Query: 447 RVNKIYGPKEAS 458
            +    G ++  
Sbjct: 509 NMEGRGGLRQHG 520


>gi|167911033|ref|ZP_02498124.1| type II/III secretion system protein [Burkholderia pseudomallei
           112]
          Length = 438

 Score =  300 bits (767), Expect = 4e-79,   Method: Composition-based stats.
 Identities = 129/452 (28%), Positives = 213/452 (47%), Gaps = 27/452 (5%)

Query: 35  AVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNV 94
           AV          G  +++      ++++P     V V+DP  ADV V +P+ +++ GK  
Sbjct: 1   AVAPRFARAADLGPVLAVPAGGGEMVKLPAPAVAVFVADPDVADVHVPTPQAVFVLGKKA 60

Query: 95  GQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTI 154
           G   +  +G + + +L   ++++ D   L+  L        + +     ++++ G V + 
Sbjct: 61  GTTTLFALGANNRTILRETVVVDVDTPSLQRILDARFPQLRLTLAGAPGSLMVSGRVPSA 120

Query: 155 QDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIG 214
            D+   V+  + +L Q           + ++N L +A   QV L+V I EV R+I +Q+G
Sbjct: 121 ADADAVVQTLKPYLRQQ----------EALVNRLTLARPIQVHLRVRITEVDRNITQQLG 170

Query: 215 FQHSITGSSSGPSKSFAADFG-------GKFVSEGGDFSVKGVL--DRFSFETVLHALER 265
              S  G+S                      +S  G FSV G     R+S + VL AL++
Sbjct: 171 INWSALGASGNFVGGLFNGRTLFDTASKAFDLSPSGAFSVVGGFHTSRYSIDGVLDALDQ 230

Query: 266 ATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSP 325
              I  LAEP LTAISGQ+ASF +GG+        +TGA ++    YGV L FTPTVL+ 
Sbjct: 231 EGLITMLAEPNLTAISGQTASFLAGGEFPIPVAQDTTGAITIQFKPYGVSLDFTPTVLAD 290

Query: 326 GRIGLRIQTEVSEPVIGVNAGD----MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQL 381
            RI L+++ EVSE     +       +P+  VR+ DTTVEL SG +  + GLL+     +
Sbjct: 291 NRISLKVRPEVSEIDPTNSVTTGSIKVPALTVRRVDTTVELSSGQSFAIGGLLQSKSSDV 350

Query: 382 KEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAK 441
              +P L+++P+LG LF +  +  ++TE+ +  TP++V+P    +L    D  +      
Sbjct: 351 LAELPGLARLPVLGKLFSSRNYLNDKTEVVVIVTPYIVQPANPGELRDALDDVTRPSSDI 410

Query: 442 AFFFNRVNKIYGPKEASEVEGQNYKGAIGFIY 473
            F   R   I         +     G  GF+Y
Sbjct: 411 EFVLQRSLGIDPLGG----DAPRLAGPAGFVY 438


>gi|323493503|ref|ZP_08098625.1| Flp pilus assembly protein CpaC [Vibrio brasiliensis LMG 20546]
 gi|323312326|gb|EGA65468.1| Flp pilus assembly protein CpaC [Vibrio brasiliensis LMG 20546]
          Length = 458

 Score =  300 bits (767), Expect = 4e-79,   Method: Composition-based stats.
 Identities = 113/453 (24%), Positives = 194/453 (42%), Gaps = 38/453 (8%)

Query: 44  IGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIG 103
                 + + +N+  ++ +P D + + +S+   AD    +   + +FG   G A + ++ 
Sbjct: 21  ASLAAPLEVTINQAKMINLPQDAKSIFISNTHVADYQPMTNTKIMVFGLQAGSATITILN 80

Query: 104 HDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVEL 163
              + + N  I +  D   L   +     +++++ E +   + L G V T   +   V +
Sbjct: 81  AQERVIYNNKIRVTHDTFELNSLISSQFPEASVKSESLGGKLWLKGSVPTPVMAHSIVNI 140

Query: 164 SETFLSQSGRN----------------QYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRR 207
           ++ +LS                     +    S  +++N L +    QV ++V IAEV R
Sbjct: 141 AKGYLSPPTAGQSSDSSSDSESSNNTSEQQGDSGNELVNQLVVTMPTQVNIRVRIAEVSR 200

Query: 208 DILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERAT 267
           ++  ++G +     S  G      A                    + +   ++ AL    
Sbjct: 201 NVSNKLGIKWGSLESGMGSFLYTKA-------------WDVSSWGKPTLGALIDALASDG 247

Query: 268 AIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGR 327
            +  LAEP LTA+SG+ A+F  GG+     +   T    V    +GV L+FTP VL P R
Sbjct: 248 TMSILAEPNLTAMSGEEANFLVGGEIPLPLIIGDTAT--VEYKPFGVNLNFTPVVLGPDR 305

Query: 328 IGLRIQTEVS----EPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKE 383
           I LR+  EVS    +    +N    PS+  R+A TT+EL SG +  L GLL+       +
Sbjct: 306 ISLRVSPEVSSISVDNQTTLNGNTYPSFTSRRATTTIELASGQSFALGGLLQSSEIDQLQ 365

Query: 384 GIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAF 443
            +P +  +P+LG LFR+S + R ETE+ I AT +LV+PV    +  P D      D +  
Sbjct: 366 KLPGIGDMPVLGGLFRSSDYQRRETELIIIATAYLVEPVRNDAIPLPTDSLLPLSDLERL 425

Query: 444 F---FNRVNKIYGPKEASEVEGQNYKGAIGFIY 473
                 R  ++ G    ++       G  GF Y
Sbjct: 426 LAIPRKRDKQVKGKATYTDNRAPRLLGDNGFYY 458


>gi|167620125|ref|ZP_02388756.1| type II/III secretion system protein [Burkholderia thailandensis
           Bt4]
          Length = 427

 Score =  300 bits (767), Expect = 4e-79,   Method: Composition-based stats.
 Identities = 125/441 (28%), Positives = 209/441 (47%), Gaps = 27/441 (6%)

Query: 46  KGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHD 105
               +++      ++++P     V V+DP  ADV V +P+ +++ GK  G   +  +G +
Sbjct: 1   PAAVLAVPAGGGEMVKLPQPAVAVFVADPDVADVHVPTPQAVFVLGKKAGTTTLFALGAN 60

Query: 106 GKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSE 165
            + +L   +++  D   L+  L       ++ +     ++++ G V +  D+   V+  +
Sbjct: 61  DRTILRETVVVNVDTPSLQRILDARFPQLHLTLAGAPGSLMVSGRVPSAADADAVVQTLK 120

Query: 166 TFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSG 225
            +L Q           + ++N L +A   QV L+V I EV R+I +Q+G   S  G+S  
Sbjct: 121 PYLRQQ----------ESLVNRLTLARPIQVHLRVRITEVDRNITQQLGINWSALGASGN 170

Query: 226 PSKSFAADFG-------GKFVSEGGDFSVKGVL--DRFSFETVLHALERATAIRTLAEPT 276
                               +S  G FSV G      +S + VL AL++   I  LAEP 
Sbjct: 171 FVGGLFNGRTLFDTASKAFDLSPSGAFSVVGGFHTSHYSIDGVLDALDQEGLITMLAEPN 230

Query: 277 LTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEV 336
           LTAISGQ+ASF +GG+        +TGA ++    YGV L FTPTVL+  RI L+++ EV
Sbjct: 231 LTAISGQTASFLAGGEFPIPVAQDTTGAITIQFKPYGVSLDFTPTVLADNRISLKVRPEV 290

Query: 337 SEPVIGVNAGD----MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIP 392
           SE     +       +P+  VR+ DTTVEL SG +  + GLL+     +   +P L+++P
Sbjct: 291 SEIDPTNSVTTGSIKVPALTVRRVDTTVELSSGQSFAIGGLLQSKSSDVLAELPGLARLP 350

Query: 393 ILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIY 452
           +LG LF +  +  ++TE+ +  TP++V+P    +L    D  +       F   R   I 
Sbjct: 351 VLGKLFSSRNYLNDKTEVVVIVTPYIVQPANPGELRDALDDITRPSSDIEFVLQRSLGID 410

Query: 453 GPKEASEVEGQNYKGAIGFIY 473
                   +     G  GF+Y
Sbjct: 411 PLGG----DAPRLTGPAGFVY 427


>gi|237509564|ref|ZP_04522279.1| type II/III secretion system protein [Burkholderia pseudomallei
           MSHR346]
 gi|235001769|gb|EEP51193.1| type II/III secretion system protein [Burkholderia pseudomallei
           MSHR346]
          Length = 690

 Score =  300 bits (767), Expect = 4e-79,   Method: Composition-based stats.
 Identities = 123/430 (28%), Positives = 219/430 (50%), Gaps = 20/430 (4%)

Query: 42  VEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVIL 101
            E+ +   +S+ L K +++ +   V++  + +P  A   + SPRT+YL G +VG  N+I+
Sbjct: 94  GEMRESTSVSVPLGKSLLVPLDEPVRNRTIGNPAVAQATMVSPRTLYLVGMSVGTTNMIV 153

Query: 102 IGHDGKQMLNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRA 160
            G  G     +D+ +  D   L+ +LR+ +    +IRV   +DT+VL G V + Q +Q+A
Sbjct: 154 QGKSGACR-IIDVAVGADAGGLQASLRQLMPREHDIRVSTAADTIVLAGNVSSAQAAQQA 212

Query: 161 VELSETFLSQSGRNQYANSSSKK--VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHS 218
           V +++ + +++      +    +  V+N+L +    QV L+V +AEV + ++ Q+G   +
Sbjct: 213 VAIAKAYSNRTNAGAAGSGGGARADVLNMLTVTSPQQVMLEVKVAEVSKTLINQMGSAVN 272

Query: 219 ITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLT 278
           I G     + +         ++  G        ++      + A      ++ LAEP L 
Sbjct: 273 IQGGFGSWTGALVTSL----LTGVGSGIAASKSNKLPLNGSIDAQNTDQPVKILAEPRLV 328

Query: 279 AISGQSASFTSGGQHLYKTVSSS---TGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTE 335
            ISGQ A+F +GG+       SS   T   ++   ++GV L FTPTVLS GRI L++  E
Sbjct: 329 TISGQEATFLAGGKIFIPVPQSSGIGTNTITLQEEEFGVGLKFTPTVLSNGRISLKVAPE 388

Query: 336 VSEPVIGV---------NAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIP 386
           VSE              N   +P    R+A TTV++  G T  + GL+KD+ Q   + +P
Sbjct: 389 VSELSPTGVTLSAANVGNVSILPLITTRRASTTVQMGDGETFAIGGLIKDNAQGTLKALP 448

Query: 387 LLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFN 446
            + ++P+LGALFR++ F ++ TE+    TP LV+P+   D+  P D ++  ++A  +   
Sbjct: 449 GIGELPVLGALFRSTSFQQDRTELVFIITPHLVQPLETADVPLPTDSFTKPNEADVYATG 508

Query: 447 RVNKIYGPKE 456
            +    G ++
Sbjct: 509 NMEGRGGLRQ 518


>gi|187919324|ref|YP_001888355.1| type II and III secretion system protein [Burkholderia phytofirmans
           PsJN]
 gi|187717762|gb|ACD18985.1| type II and III secretion system protein [Burkholderia phytofirmans
           PsJN]
          Length = 595

 Score =  300 bits (767), Expect = 4e-79,   Method: Composition-based stats.
 Identities = 122/477 (25%), Positives = 214/477 (44%), Gaps = 45/477 (9%)

Query: 13  SIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVS 72
                +++              A        + +   ++I + K  ++ V   V+   V 
Sbjct: 78  VHLTIAASGMGPGAASGGAQQGARGPNCSGPVAEHSSVTIPVGKSTMVDVREPVKSRSVG 137

Query: 73  DPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIA 132
           +P     ++ SP+T+YL G +VG  N+I+ G  G     +D+ +  D   L+ TL   + 
Sbjct: 138 NPAIVQAMLVSPQTLYLLGSDVGTTNMIVQGRSGSC-TIIDVSVGADPGGLQQTLAALMP 196

Query: 133 DS-NIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQY--------------- 176
           +   I+V+  +DT+VL G V     ++R +EL+  F+++                     
Sbjct: 197 EETGIQVKAAADTLVLTGTVSDAVKAERVLELARAFVARPTAALQGGAPMGSGPLPVGAA 256

Query: 177 -----------ANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSG 225
                        +S ++++N++++A   QV L+V +AEV + ++ Q+G   +I G    
Sbjct: 257 PRAMGMPAPTLGGASGERIINMMHVAAPQQVMLEVKVAEVSKTLIDQLGVAANINGGIGS 316

Query: 226 PSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSA 285
            S    AD    ++S G         +       + A +    ++ LAEP L AISGQ A
Sbjct: 317 WSFGLLAD----YLSGGLSALTASKANNSPLRAAIDAQKTDQLVKILAEPNLMAISGQEA 372

Query: 286 SFTSGGQHLYKTVSS---STGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIG 342
           SF +GG+       S   +     +    YGV L FTPTVL  GRI L++  EVSE    
Sbjct: 373 SFLAGGKVYIPVPQSNGANGTTIVLQEEQYGVGLTFTPTVLEGGRINLKVSPEVSELSST 432

Query: 343 ---------VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPI 393
                     N   +P    R+A TT+++  G +  + GLLK +I    +G+P  +++P+
Sbjct: 433 GVVVSAGNSNNQTILPLITTRRASTTLQVFDGQSFAIGGLLKSNITGSIKGLPGAAELPV 492

Query: 394 LGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNK 450
           LGALFR++ + +++TE+    TP L KP+  +    P DH+    +A  +    +  
Sbjct: 493 LGALFRSTSYEQDKTELVFVVTPRLAKPL-PQHYPLPTDHFGDASEANVYLTGHMEG 548


>gi|167738675|ref|ZP_02411449.1| type II/III secretion system protein [Burkholderia pseudomallei 14]
          Length = 434

 Score =  300 bits (767), Expect = 5e-79,   Method: Composition-based stats.
 Identities = 127/446 (28%), Positives = 211/446 (47%), Gaps = 27/446 (6%)

Query: 41  DVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVI 100
                 G  +++      ++++P     V V+DP  ADV V +P+ +++ GK  G   + 
Sbjct: 3   ARAADLGPVLAVPAGGGEMVKLPAPAVAVFVADPDVADVHVPTPQAVFVLGKKAGTTTLF 62

Query: 101 LIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRA 160
            +G + + +L   ++++ D   L+  L        + +     ++++ G V +  D+   
Sbjct: 63  ALGANNRTILRETVVVDVDTPSLQRILDARFPQLRLTLAGAPGSLMVSGRVPSAADADAV 122

Query: 161 VELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSIT 220
           V+  + +L Q           + ++N L +A   QV L+V I EV R+I +Q+G   S  
Sbjct: 123 VQTLKPYLRQQ----------EALVNRLTLARPIQVHLRVRITEVDRNITQQLGINWSAL 172

Query: 221 GSSSGPSKSFAADFG-------GKFVSEGGDFSVKGVL--DRFSFETVLHALERATAIRT 271
           G+S                      +S  G FSV G     R+S + VL AL++   I  
Sbjct: 173 GASGNFVGGLFNGRTLFDTASKAFDLSPSGAFSVVGGFHTSRYSIDGVLDALDQEGLITM 232

Query: 272 LAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLR 331
           LAEP LTAISGQ+ASF +GG+        +TGA ++    YGV L FTPTVL+  RI L+
Sbjct: 233 LAEPNLTAISGQTASFLAGGEFPIPVAQDTTGAITIQFKPYGVSLDFTPTVLADNRISLK 292

Query: 332 IQTEVSEPVIGVNAGD----MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPL 387
           ++ EVSE     +       +P+  VR+ DTTVEL SG +  + GLL+     +   +P 
Sbjct: 293 VRPEVSEIDPTNSVTTGSIKVPALTVRRVDTTVELSSGQSFAIGGLLQSKSSDVLAELPG 352

Query: 388 LSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNR 447
           L+++P+LG LF +  +  ++TE+ +  TP++V+P    +L    D  +       F   R
Sbjct: 353 LARLPVLGKLFSSRNYLNDKTEVVVIVTPYIVQPANPGELRDALDDVTRPSSDIEFVLQR 412

Query: 448 VNKIYGPKEASEVEGQNYKGAIGFIY 473
              I         +     G  GF+Y
Sbjct: 413 SLGIDPLGG----DAPRLAGPAGFVY 434


>gi|167744175|ref|ZP_02416949.1| Putative phospholipid-binding domain family protein [Burkholderia
           pseudomallei 14]
          Length = 439

 Score =  299 bits (766), Expect = 6e-79,   Method: Composition-based stats.
 Identities = 123/438 (28%), Positives = 219/438 (50%), Gaps = 20/438 (4%)

Query: 42  VEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVIL 101
            E+ +   +S+ L K +++ +   V++  + +P  A   + SPRT+YL G +VG  N+I+
Sbjct: 6   GEMRESTSVSVPLGKSLLVPLDEPVRNRTIGNPAVAQATMVSPRTLYLVGMSVGTTNMIV 65

Query: 102 IGHDGKQMLNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRA 160
            G  G     +D+ +  D   L+ +LR+ +    +IRV   +DT+VL G V + Q +Q+A
Sbjct: 66  QGKSGACR-IIDVAVGADAGGLQASLRQLMPRERDIRVSTAADTIVLAGNVSSAQAAQQA 124

Query: 161 VELSETFLSQSGRNQYANSSSKK--VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHS 218
           V +++ + +++      +    +  V+N+L +    QV L+V +AEV + ++ Q+G   +
Sbjct: 125 VAIAKAYSNRTNAGAAGSGGGARADVLNMLTVTSPQQVMLEVKVAEVSKTLINQMGSAVN 184

Query: 219 ITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLT 278
           I G     + +         ++  G        ++      + A      ++ LAEP L 
Sbjct: 185 IQGGFGSWTGALVTSL----LTGVGSGIAASKSNKLPLNGSIDAQNTDQPVKILAEPRLV 240

Query: 279 AISGQSASFTSGGQHLYKTVSSS---TGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTE 335
            ISGQ A+F +GG+       SS   T   ++   ++GV L FTPTVLS GRI L++  E
Sbjct: 241 TISGQEATFLAGGKIFIPVPQSSGIGTNTITLQEEEFGVGLKFTPTVLSNGRISLKVAPE 300

Query: 336 VSEPVIGV---------NAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIP 386
           VSE              N   +P    R+A TTV++  G T  + GL+KD+ Q   + +P
Sbjct: 301 VSELSPTGVTLSAANVGNVSILPLITTRRASTTVQMGDGETFAIGGLIKDNAQGTLKALP 360

Query: 387 LLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFN 446
            + ++P+LGALFR++ F ++ TE+    TP LV+P+   D+  P D ++  ++A  +   
Sbjct: 361 GIGELPVLGALFRSTSFQQDRTELVFIITPHLVQPLETADVPLPTDSFTKPNEADVYATG 420

Query: 447 RVNKIYGPKEASEVEGQN 464
            +    G ++        
Sbjct: 421 NMEGRGGLRQHGAAPAAA 438


>gi|260463894|ref|ZP_05812090.1| type II and III secretion system protein [Mesorhizobium
           opportunistum WSM2075]
 gi|259030269|gb|EEW31549.1| type II and III secretion system protein [Mesorhizobium
           opportunistum WSM2075]
          Length = 481

 Score =  299 bits (766), Expect = 6e-79,   Method: Composition-based stats.
 Identities = 123/478 (25%), Positives = 218/478 (45%), Gaps = 26/478 (5%)

Query: 1   MRYL-----QRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLN 55
           MR L     +  F   +++ +  +  ++        A+  ++ +S  +      I +   
Sbjct: 3   MRTLYGMTGRSCFVRALAMAVSLAAGAMLAFAGAARADNDIVYVSATKNA---SIKVAKG 59

Query: 56  KVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDIL 115
           K   +        +++ DP  A+V   + ++ Y+ G N+G   + L     + +  +DI 
Sbjct: 60  KPKTIITSAAFYQIVIGDPEIANVNPLTDKSFYVLGNNLGTTGIALFDDKKQLVGTVDIE 119

Query: 116 IERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQ 175
           +  D   L  T+R  + D+ I+V   +  VVL G       +++A +++  F        
Sbjct: 120 VTLDTDELANTIRASVPDAKIKVGSANGRVVLSGEADDAVAAEKANKIATRFSGN----- 174

Query: 176 YANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFG 235
                 ++V+N +NI+   QV L V   E+ R   + +G ++S   +     +  + + G
Sbjct: 175 ------EEVINSVNISSSQQVQLNVRFVEINRQAGQDLGAKYSANFAYGFGGRDVSLEPG 228

Query: 236 GKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLY 295
               +  G+   + + +  S +  + ALE     R LAEP L A SG++ASF +GG+   
Sbjct: 229 TVPAAGTGEIIGRLLSNGVSIDIAIKALEERGLARRLAEPNLIARSGETASFLAGGEFPI 288

Query: 296 KTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIG----VNAGDMPSY 351
             VS   G  SV+   YGV L F PTVL  G + L I  EVS         +    +P +
Sbjct: 289 P-VSEENGKISVSYKKYGVSLDFKPTVLKDGLVSLDIAPEVSSIDASASYNIGNISVPGF 347

Query: 352 RVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIF 411
            VR+A T+V+L +G + ++AGLL+         IP L K+P+LGALF +  + R ET++ 
Sbjct: 348 IVRRARTSVDLKNGQSFMIAGLLQSQNDITTSRIPGLGKMPVLGALFSSKSYQRRETDLV 407

Query: 412 IAATPFLVKPVAM-RDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGA 468
           I  TP+LVKPV   + ++ P +      +A  +F N   ++ G      +   +   A
Sbjct: 408 IIVTPYLVKPVDPSKKMAEPTNGTQPASNAD-YFLNNTEEVKGSDTNRALAMADGGAA 464


>gi|167821374|ref|ZP_02453054.1| Putative phospholipid-binding domain family protein [Burkholderia
           pseudomallei 91]
          Length = 494

 Score =  299 bits (765), Expect = 7e-79,   Method: Composition-based stats.
 Identities = 123/437 (28%), Positives = 219/437 (50%), Gaps = 20/437 (4%)

Query: 42  VEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVIL 101
            E+ +   +S+ L K +++ +   V++  + +P  A   + SPRT+YL G +VG  N+I+
Sbjct: 63  GEMRESTSVSVPLGKSLLVPLDEPVRNRTIGNPAVAQATMVSPRTLYLVGMSVGTTNMIV 122

Query: 102 IGHDGKQMLNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRA 160
            G  G     +D+ +  D   L+ +LR+ +    +IRV   +DT+VL G V + Q +Q+A
Sbjct: 123 QGKSGACR-IIDVAVGADAGGLQASLRQLMPRERDIRVSTAADTIVLAGNVSSAQAAQQA 181

Query: 161 VELSETFLSQSGRNQYANSSSKK--VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHS 218
           V +++ + +++      +    +  V+N+L +    QV L+V +AEV + ++ Q+G   +
Sbjct: 182 VAIAKAYSNRTNAGAAGSGGGARADVLNMLTVTSPQQVMLEVKVAEVSKTLINQMGSAVN 241

Query: 219 ITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLT 278
           I G     + +         ++  G        ++      + A      ++ LAEP L 
Sbjct: 242 IQGGFGSWTGALVTSL----LTGVGSGIAASKSNKLPLNGSIDAQNTDQPVKILAEPRLV 297

Query: 279 AISGQSASFTSGGQHLYKTVSSS---TGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTE 335
            ISGQ A+F +GG+       SS   T   ++   ++GV L FTPTVLS GRI L++  E
Sbjct: 298 TISGQEATFLAGGKIFIPVPQSSGIGTNTITLQEEEFGVGLKFTPTVLSNGRISLKVAPE 357

Query: 336 VSEPVIG---------VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIP 386
           VSE              N   +P    R+A TTV++  G T  + GL+KD+ Q   + +P
Sbjct: 358 VSELSPTGVTLSAANVGNVSILPLITTRRASTTVQMGDGETFAIGGLIKDNAQGTLKALP 417

Query: 387 LLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFN 446
            + ++P+LGALFR++ F ++ TE+    TP LV+P+   D+  P D ++  ++A  +   
Sbjct: 418 GIGELPVLGALFRSTSFQQDRTELVFIITPHLVQPLETADVPLPTDSFTKPNEADVYATG 477

Query: 447 RVNKIYGPKEASEVEGQ 463
            +    G ++       
Sbjct: 478 NMEGRGGLRQHGAAPAA 494


>gi|186474103|ref|YP_001861445.1| type II and III secretion system protein [Burkholderia phymatum
           STM815]
 gi|184196435|gb|ACC74399.1| type II and III secretion system protein [Burkholderia phymatum
           STM815]
          Length = 700

 Score =  299 bits (765), Expect = 7e-79,   Method: Composition-based stats.
 Identities = 123/468 (26%), Positives = 218/468 (46%), Gaps = 47/468 (10%)

Query: 41  DVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVI 100
              I   + ++I + K  ++ V   V+   V +P+    ++ SP+T+YL G +VG  N+I
Sbjct: 109 TGAIADHQTVTIPIGKSTMVNVRESVKTRTVGNPSIVQAMLVSPQTLYLLGTDVGTTNMI 168

Query: 101 LIGHDGKQMLNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQR 159
           + G  G     +D+ +  D   L+ TL   + +   ++V+  +DT+VL G V     ++R
Sbjct: 169 VQGRSGSC-TVIDVAVGADPGGLQQTLAVLMPEESGVQVKAAADTLVLTGTVSDSVKAER 227

Query: 160 AVELSETFLSQSG--------------------------RNQYANSSSKKVMNLLNIAGE 193
            VEL+  ++++                                 N ++++++N++++A  
Sbjct: 228 IVELARAYVARQAAPVPVAAPANAGGAQGGAMIPAVLKPAGASGNGNNERIVNMMHVAAP 287

Query: 194 DQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDR 253
            QV L+V +AEV + ++ Q+G       +  G + S++      F+S G    +    + 
Sbjct: 288 QQVMLEVKVAEVSKTLIDQLGMA----ANIQGGTGSWSFGLLADFLSGGMGALLGSKANN 343

Query: 254 FSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSS---TGATSVTTH 310
                 + A +    ++ LAEPTL AISGQ ASF +GG+       S+        +   
Sbjct: 344 KPLNFAIDAQKTDQLVKVLAEPTLMAISGQEASFLAGGRVFIPVPQSNGAAGSTIILQEE 403

Query: 311 DYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIG---------VNAGDMPSYRVRKADTTVE 361
            +GV L FTPTVL  GRI L++  EVSE                  +P    R+A TT++
Sbjct: 404 TFGVGLTFTPTVLDNGRINLKVSPEVSELSPTGVAVTAGTVSTTAVLPLITTRRASTTLQ 463

Query: 362 LPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKP 421
           +  G +  + GL+K ++    +G+P L ++P+LGALFR++ F  ++TE+    TP L KP
Sbjct: 464 VYDGQSFAIGGLMKSNVTGTLKGLPGLGEVPVLGALFRSTNFQEDKTELVFVVTPRLAKP 523

Query: 422 VAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAI 469
           +  ++   P DH+    +A  FF   +       +A         GA 
Sbjct: 524 L-PQNYPLPTDHFGKVTEAGVFFTGNMEG--KKPQAPAEAVPPSTGAA 568


>gi|76819084|ref|YP_336469.1| phospholipid-binding domain-containing protein [Burkholderia
           pseudomallei 1710b]
 gi|254264517|ref|ZP_04955382.1| type II/III secretion system protein [Burkholderia pseudomallei
           1710a]
 gi|76583557|gb|ABA53031.1| Putative phospholipid-binding domain family [Burkholderia
           pseudomallei 1710b]
 gi|254215519|gb|EET04904.1| type II/III secretion system protein [Burkholderia pseudomallei
           1710a]
          Length = 690

 Score =  299 bits (765), Expect = 7e-79,   Method: Composition-based stats.
 Identities = 123/432 (28%), Positives = 219/432 (50%), Gaps = 20/432 (4%)

Query: 42  VEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVIL 101
            E+ +   +S+ L K +++ +   V++  + +P  A   + SPRT+YL G +VG  N+I+
Sbjct: 94  GEMRESTSVSVPLGKSLLVPLDEPVRNRTIGNPAVAQATMVSPRTLYLVGMSVGTTNMIV 153

Query: 102 IGHDGKQMLNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRA 160
            G  G     +D+ +  D   L+ +LR+ +    +IRV   +DT+VL G V + Q +Q+A
Sbjct: 154 QGKSGACR-IIDVAVGADAGGLQASLRQLMPRERDIRVSTAADTIVLAGNVSSAQAAQQA 212

Query: 161 VELSETFLSQSGRNQYANSSSKK--VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHS 218
           V +++ + +++      +    +  V+N+L +    QV L+V +AEV + ++ Q+G   +
Sbjct: 213 VAIAKAYSNRTNAGAAGSGGGARADVLNMLTVTSPQQVMLEVKVAEVSKTLINQMGSAVN 272

Query: 219 ITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLT 278
           I G     + +         ++  G        ++      + A      ++ LAEP L 
Sbjct: 273 IQGGFGSWTGALVTSL----LTGVGSGIAASKSNKLPLNGSIDAQNTDQPVKILAEPRLV 328

Query: 279 AISGQSASFTSGGQHLYKTVSSS---TGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTE 335
            ISGQ A+F +GG+       SS   T   ++   ++GV L FTPTVLS GRI L++  E
Sbjct: 329 TISGQEATFLAGGKIFIPVPQSSGIGTNTITLQEEEFGVGLKFTPTVLSNGRISLKVAPE 388

Query: 336 VSEPVIGV---------NAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIP 386
           VSE              N   +P    R+A TTV++  G T  + GL+KD+ Q   + +P
Sbjct: 389 VSELSPTGVTLSAANVGNVSILPLITTRRASTTVQMGDGETFAIGGLIKDNAQGTLKALP 448

Query: 387 LLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFN 446
            + ++P+LGALFR++ F ++ TE+    TP LV+P+   D+  P D ++  ++A  +   
Sbjct: 449 GIGELPVLGALFRSTSFQQDRTELVFIITPHLVQPLETADVPLPTDSFTKPNEADVYATG 508

Query: 447 RVNKIYGPKEAS 458
            +    G ++  
Sbjct: 509 NMEGRGGLRQHG 520


>gi|126456485|ref|YP_001076989.1| type II/III secretion system protein [Burkholderia pseudomallei
           1106a]
 gi|242311194|ref|ZP_04810211.1| type II/III secretion system protein [Burkholderia pseudomallei
           1106b]
 gi|126230253|gb|ABN93666.1| type II/III secretion system protein [Burkholderia pseudomallei
           1106a]
 gi|242134433|gb|EES20836.1| type II/III secretion system protein [Burkholderia pseudomallei
           1106b]
          Length = 690

 Score =  299 bits (765), Expect = 7e-79,   Method: Composition-based stats.
 Identities = 123/430 (28%), Positives = 219/430 (50%), Gaps = 20/430 (4%)

Query: 42  VEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVIL 101
            E+ +   +S+ L K +++ +   V++  + +P  A   + SPRT+YL G +VG  N+I+
Sbjct: 94  GEMRESTSVSVPLGKSLLVPLDEPVRNRTIGNPAVAQATMVSPRTLYLVGMSVGTTNMIV 153

Query: 102 IGHDGKQMLNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRA 160
            G  G     +D+ +  D   L+ +LR+ +    +IRV   +DT+VL G V + Q +Q+A
Sbjct: 154 QGKSGACR-IIDVAVGADAGGLQASLRQLMPRERDIRVSTAADTIVLAGNVSSAQAAQQA 212

Query: 161 VELSETFLSQSGRNQYANSSSKK--VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHS 218
           V +++ + +++      +    +  V+N+L +    QV L+V +AEV + ++ Q+G   +
Sbjct: 213 VAIAKAYSNRTNAGAAGSGGGARADVLNMLTVTSPQQVMLEVKVAEVSKTLINQMGSAVN 272

Query: 219 ITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLT 278
           I G     + +         ++  G        ++      + A      ++ LAEP L 
Sbjct: 273 IQGGFGSWTGALVTSL----LTGVGSGIAASKSNKLPLNGSIDAQNTDQPVKILAEPRLV 328

Query: 279 AISGQSASFTSGGQHLYKTVSSS---TGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTE 335
            ISGQ A+F +GG+       SS   T   ++   ++GV L FTPTVLS GRI L++  E
Sbjct: 329 TISGQEATFLAGGKIFIPVPQSSGIGTNTITLQEEEFGVGLKFTPTVLSNGRISLKVAPE 388

Query: 336 VSEPVIGV---------NAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIP 386
           VSE              N   +P    R+A TTV++  G T  + GL+KD+ Q   + +P
Sbjct: 389 VSELSPTGVTLSAANVGNVSILPLITTRRASTTVQMGDGETFAIGGLIKDNAQGTLKALP 448

Query: 387 LLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFN 446
            + ++P+LGALFR++ F ++ TE+    TP LV+P+   D+  P D ++  ++A  +   
Sbjct: 449 GIGELPVLGALFRSTSFQQDRTELVFIITPHLVQPLETADVPLPTDSFTKPNEADVYATG 508

Query: 447 RVNKIYGPKE 456
            +    G ++
Sbjct: 509 NMEGRGGLRQ 518


>gi|167841773|ref|ZP_02468457.1| type II/III secretion system protein [Burkholderia thailandensis
           MSMB43]
          Length = 484

 Score =  299 bits (765), Expect = 8e-79,   Method: Composition-based stats.
 Identities = 129/438 (29%), Positives = 221/438 (50%), Gaps = 26/438 (5%)

Query: 42  VEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVIL 101
            E+ +   +S+ L K +++ +   V++  + +P  A   + SPRT+YL G +VG  N+I+
Sbjct: 15  GEMRESTNVSVPLGKSLLVPLDEPVRNRTIGNPAVAQATMVSPRTLYLVGMSVGTTNMIV 74

Query: 102 IGHDGKQMLNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRA 160
            G  G     +D+ +  D   L+ +LR+ +    +IRV   +DT+VL G V + Q +Q+A
Sbjct: 75  QGKSGAC-QIIDVAVGADADGLQTSLRQLMPRERDIRVSTAADTIVLAGNVSSAQAAQQA 133

Query: 161 VELSETFLSQSGRNQYAN--------SSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQ 212
           V +++ +  ++      N        SS   V+N+L +    QV L+V +AEV + ++ Q
Sbjct: 134 VAIAKAYSDRTNAGAAGNGNGNGGGGSSRADVLNMLTVTSPQQVMLEVKVAEVSKTLINQ 193

Query: 213 IGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTL 272
           +G   +I     G   S+        ++  G   V    ++      + A +    ++ L
Sbjct: 194 MGSAVNI----QGGFGSWTGALMTSLLTGVGSGIVASKSNKLPLSGAIDAQDTDQPVKIL 249

Query: 273 AEPTLTAISGQSASFTSGGQHLYKTVSSS---TGATSVTTHDYGVVLHFTPTVLSPGRIG 329
           AEP L  ISGQ A+F +GG+       SS   T   ++   ++GV L FTPTVLS GRI 
Sbjct: 250 AEPRLVTISGQEATFLAGGKIFIPVPQSSGIGTNTITLQEEEFGVGLKFTPTVLSNGRIS 309

Query: 330 LRIQTEVSEPVIGV---------NAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQ 380
           L++  EVSE              N   +P    R+A TTV++  G T  + GL+KD+ Q 
Sbjct: 310 LKVAPEVSELSPTGVTLSASNVGNVSILPLITTRRASTTVQMNDGETFAIGGLIKDNAQG 369

Query: 381 LKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDA 440
             + +P + ++P+LGALFR++ F ++ TE+    TP LVKP+   D+  P D ++  ++A
Sbjct: 370 TLKALPGIGELPVLGALFRSTSFQQDRTELVFIITPHLVKPLDTADVPLPTDSFTKPNEA 429

Query: 441 KAFFFNRVNKIYGPKEAS 458
             +    +    G ++  
Sbjct: 430 DVYATGNMEGRGGLRQHG 447


>gi|296156489|ref|ZP_06839327.1| type II and III secretion system protein [Burkholderia sp. Ch1-1]
 gi|295893088|gb|EFG72868.1| type II and III secretion system protein [Burkholderia sp. Ch1-1]
          Length = 599

 Score =  299 bits (765), Expect = 8e-79,   Method: Composition-based stats.
 Identities = 121/485 (24%), Positives = 216/485 (44%), Gaps = 46/485 (9%)

Query: 7   TFFTMMSIFLFSSNPSVAKLPPIKEANAA-VINISDVEIGKGKKISIGLNKVIILQVPVD 65
           T  +  S+ L  +   +        A            + +   ++I + K  ++ V   
Sbjct: 75  TVASNGSVHLTIAASGMGPGAYSGGAQQGGRGPNCTGPVAEHSSVTIPVGKSAMVDVREP 134

Query: 66  VQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEM 125
           V+   V +P+    ++ SP+T+YL G +VG  N+I+ G  G     +D+ +  D   L+ 
Sbjct: 135 VKSRTVGNPSIVQAMLVSPQTLYLLGSDVGTTNMIVQGRSGSC-TIIDVSVGADPGGLQQ 193

Query: 126 TLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQY-------- 176
           TL   + +   I+V+  +DT+VL G V     + R +EL+  F+++              
Sbjct: 194 TLAALMPEETGIQVKAAADTLVLTGTVSDAVKADRVLELARAFVARPTTALQGGAPMGSG 253

Query: 177 ------------------ANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHS 218
                               +  ++++N++++A   QV L+V +AEV + ++ Q+G   +
Sbjct: 254 PLPVGAAPRAMGMPAPSLGGAGGERIINMMHVAAPQQVMLEVKVAEVSKTLIDQLGVAAN 313

Query: 219 ITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLT 278
           I G     S    AD    ++S G         +    +  + A +    ++ LAEP L 
Sbjct: 314 INGGIGSWSFGLLAD----YLSGGLSALTASKANNSPLKAAIDAQKTDQLVKILAEPNLM 369

Query: 279 AISGQSASFTSGGQHLYKTVS---SSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTE 335
           AISGQ ASF +GG+          S      +    YGV L FTPTVL  GRI L++  E
Sbjct: 370 AISGQEASFLAGGKVYIPVPQSNGSGGTTIVLQEEQYGVGLTFTPTVLEGGRINLKVSPE 429

Query: 336 VSEPVIG---------VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIP 386
           VSE                  +P    R+A TT+++  G +  + GLLK ++    +G+P
Sbjct: 430 VSELSSTGVVVSAGNSNTTSILPLITTRRASTTLQVFDGQSFAIGGLLKSNVTGSIKGLP 489

Query: 387 LLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFN 446
             +++P+LGALFR++ + +++TE+    TP L KP+  +    P D++    +A  +   
Sbjct: 490 GAAELPVLGALFRSTSYEQDKTELVFVVTPRLAKPL-PQHYPLPTDNFGDASEANVYLTG 548

Query: 447 RVNKI 451
            +   
Sbjct: 549 HMEGT 553


>gi|261251598|ref|ZP_05944172.1| type II/IV secretion system secretin RcpA/CpaC associated with Flp
           pilus assembly [Vibrio orientalis CIP 102891]
 gi|260938471|gb|EEX94459.1| type II/IV secretion system secretin RcpA/CpaC associated with Flp
           pilus assembly [Vibrio orientalis CIP 102891]
          Length = 457

 Score =  299 bits (765), Expect = 8e-79,   Method: Composition-based stats.
 Identities = 117/449 (26%), Positives = 199/449 (44%), Gaps = 37/449 (8%)

Query: 47  GKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDG 106
              + + +N+  ++ +P D + + +S+   AD    +   + +FG   G A + ++    
Sbjct: 24  AAPLEVNINEAKMINLPQDAKSIFISNTHIADYQPMTNTKIMVFGMQAGTATITILNAQE 83

Query: 107 KQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSET 166
           + + N  I +  D   L+  +     ++++  E +   + L G V T   +   V +++ 
Sbjct: 84  RVIYNNKIRVVHDTKELDSLIAAQFPEASVHSESLGGKLWLKGNVPTPVMAHSIVSVAKG 143

Query: 167 FLS---------------QSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILK 211
           +LS                S      + +S +++N L +    QV ++V IAEV R++  
Sbjct: 144 YLSPVIAPQQSENGSTSSDSSTQNSGSDNSDELVNQLMVTMPTQVNIRVRIAEVSRNVSN 203

Query: 212 QIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRT 271
           ++G +     +  G      A                    + +   ++ AL     +  
Sbjct: 204 KLGIKWGSLQAGMGSFLYTKA-------------WDVSSWGKPTLGALVDALASDGTMSI 250

Query: 272 LAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLR 331
           LAEP LTA+SG+ ASF  GG+     ++  T    V    +GV L+FTP VL P RI LR
Sbjct: 251 LAEPNLTAMSGEDASFLVGGEIPLPLINGDTAT--VEYKPFGVNLNFTPVVLGPDRISLR 308

Query: 332 IQTEVS----EPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPL 387
           +  EVS    +    +N    PS+  R+A TT+EL SG +  L GLL+       + +P 
Sbjct: 309 VSPEVSSVSVDNQTTLNGNTYPSFTSRRATTTIELASGQSFALGGLLQSSEIDQLQKLPG 368

Query: 388 LSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFF--- 444
              IPILG LFR+S + R+ETE+ I AT +LV+PV    L  P D+     D +      
Sbjct: 369 AGDIPILGGLFRSSEYQRKETELIIIATAYLVEPVRNDALPLPTDNLLPLSDLERLLAIP 428

Query: 445 FNRVNKIYGPKEASEVEGQNYKGAIGFIY 473
            +R  ++ G    ++       G  GF Y
Sbjct: 429 RSRGKQVKGKDTYTDNRAPRLLGDNGFYY 457


>gi|167851182|ref|ZP_02476690.1| Putative phospholipid-binding domain family protein [Burkholderia
           pseudomallei B7210]
          Length = 449

 Score =  299 bits (765), Expect = 8e-79,   Method: Composition-based stats.
 Identities = 125/445 (28%), Positives = 220/445 (49%), Gaps = 20/445 (4%)

Query: 29  IKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMY 88
              A          E+ +   +S+ L K ++L +   V++  + +P  A   + SPRT+Y
Sbjct: 1   AAAAVPLRGPSCVGEMRESTSVSVPLGKSLLLPLDEPVRNRTIGNPAVAQATMVSPRTLY 60

Query: 89  LFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVL 147
           L G +VG  N+I+ G  G     +D+ +  D   L+ +LR+ +    +IRV   +DT+VL
Sbjct: 61  LVGMSVGTTNMIVQGKSGACR-IIDVAVGADAGGLQASLRQLMPRERDIRVSTAADTIVL 119

Query: 148 HGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKK--VMNLLNIAGEDQVTLKVTIAEV 205
            G V + Q +Q+AV +++ + +++      +    +  V+N+L +    QV L+V +AEV
Sbjct: 120 AGNVSSAQAAQQAVAIAKAYSNRTNAGAAGSGGGARADVLNMLTVTSPQQVMLEVKVAEV 179

Query: 206 RRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALER 265
            + ++ Q+G   +I G     + +         ++  G        ++      + A   
Sbjct: 180 SKTLINQMGSAVNIQGGFGSWTGALVTSL----LTGVGSGIAASKSNKLPLNGSIDAQNT 235

Query: 266 ATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSS---TGATSVTTHDYGVVLHFTPTV 322
              ++ LAEP L  ISGQ A+F +GG+       SS   T   ++   ++GV L FTPTV
Sbjct: 236 DQPVKILAEPRLVTISGQEATFLAGGKIFIPVPQSSGIGTNTITLQEEEFGVGLKFTPTV 295

Query: 323 LSPGRIGLRIQTEVSEPVIGV---------NAGDMPSYRVRKADTTVELPSGGTIVLAGL 373
           LS GRI L++  EVSE              N   +P    R+A TTV++  G T  + GL
Sbjct: 296 LSNGRISLKVAPEVSELSPTGVTLSAANVGNVSILPLITTRRASTTVQMGDGETFAIGGL 355

Query: 374 LKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDH 433
           +KD+ Q   + +P + ++P+LGALFR++ F ++ TE+    TP LV+P+   D+  P D 
Sbjct: 356 IKDNAQGTLKALPGIGELPVLGALFRSTSFQQDRTELVFIITPHLVQPLETADVPLPTDS 415

Query: 434 YSVEDDAKAFFFNRVNKIYGPKEAS 458
           ++  ++A  +    +    G ++  
Sbjct: 416 FTKPNEADVYATGNMEGRGGLRQHG 440


>gi|302381756|ref|YP_003817579.1| type II and III secretion system protein [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302192384|gb|ADK99955.1| type II and III secretion system protein [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 520

 Score =  299 bits (765), Expect = 8e-79,   Method: Composition-based stats.
 Identities = 141/508 (27%), Positives = 238/508 (46%), Gaps = 68/508 (13%)

Query: 25  KLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSP 84
            LP    A     + +       + I++       + +P D +DV+VS+P  A+  VHSP
Sbjct: 23  TLPSAVLAQDHAGSQTVAAGSGPRLINLPRGTSFAVDLPADARDVIVSNPAVAEANVHSP 82

Query: 85  RTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDT 144
           R + + G   G+ + + +   G+ +L L + ++  +  L+ TL R    + +  E V+D+
Sbjct: 83  RRITVIGIAPGETDAVFLDAAGRSILTLRVRVDAGVTALQDTLSRVAPGAQVHAEAVNDS 142

Query: 145 VVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAE 204
           +VL G+V +   S++  +++  F+          S+ +KV+N+L IAG DQVTLKV I E
Sbjct: 143 IVLTGLVTSAAQSEQVAQVARAFV----------SAPEKVLNMLTIAGSDQVTLKVRIIE 192

Query: 205 VRRDILKQIGFQHSITGSSSGPSKSFAA-----DFGGKFVSEGGDFSVKGVLDRFSF--- 256
           V+R+ +KQ+GF  +      G ++   +        G  +        +     F     
Sbjct: 193 VQRNAIKQLGFDTAAALGRVGDTQFLLSQAASFGVNGSLLGGISAGVSRNTTQNFQLQGP 252

Query: 257 -----------------------------------------ETVLHALERATAIRTLAEP 275
                                                      ++ A ER   IRTLAEP
Sbjct: 253 CGPGFPADSLCPFTVDGPEDASNWDTAQPGTGPGSDDLNKGNAMIKAFERVGLIRTLAEP 312

Query: 276 TLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTE 335
            LT+++G+SASF +GG+    T     G  ++    YGV L F P VLS GRI L+I  E
Sbjct: 313 NLTSVNGESASFLAGGEFPVPTGRDRDGNVTIEFKPYGVSLGFRPIVLSEGRISLQISAE 372

Query: 336 VSEPVIG---------VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIP 386
           VSE               A ++    VR+   TVE+PSGG++++AGLL++  +Q  + +P
Sbjct: 373 VSELTQTGGITLGAGTSTALNIAGLNVRRVQNTVEIPSGGSMMIAGLLQESTRQAIDSLP 432

Query: 387 LLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFN 446
            L  +P+LG LFR+  +   ETE+ +   P++V P +   L  P D   +  DA+  FF 
Sbjct: 433 GLGGLPVLGQLFRSRDYLSGETELVVIVEPYIVTPTSPNRLQTPADGLRIATDAQTIFFG 492

Query: 447 RVNKIYGPKEASEVEGQNYKGAIGFIYK 474
           ++N+ YG    ++     ++G +G++ +
Sbjct: 493 QLNQAYGSPAPTDTASAGWQGPVGYVIE 520


>gi|167916476|ref|ZP_02503567.1| Putative phospholipid-binding domain family protein [Burkholderia
           pseudomallei 112]
          Length = 452

 Score =  298 bits (764), Expect = 9e-79,   Method: Composition-based stats.
 Identities = 124/445 (27%), Positives = 220/445 (49%), Gaps = 20/445 (4%)

Query: 29  IKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMY 88
              A          E+ +   +S+ L K +++ +   V++  + +P  A   + SPRT+Y
Sbjct: 1   AAAAVPLRGPSCVGEMRESTSVSVPLGKSLLVPLDEPVRNRTIGNPAVAQATMVSPRTLY 60

Query: 89  LFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVL 147
           L G +VG  N+I+ G  G     +D+ +  D   L+ +LR+ +    +IRV   +DT+VL
Sbjct: 61  LVGMSVGTTNMIVQGKSGACR-IIDVAVGADAGGLQASLRQLMPRERDIRVSTAADTIVL 119

Query: 148 HGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKK--VMNLLNIAGEDQVTLKVTIAEV 205
            G V + Q +Q+AV +++ + +++      +    +  V+N+L +    QV L+V +AEV
Sbjct: 120 AGNVSSAQAAQQAVAIAKAYSNRTNAGAAGSGGGARADVLNMLTVTSPQQVMLEVKVAEV 179

Query: 206 RRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALER 265
            + ++ Q+G   +I G     + +         ++  G        ++      + A   
Sbjct: 180 SKTLINQMGSAVNIQGGFGSWTGALVTSL----LTGVGSGIAASKSNKLPLNGSIDAQNT 235

Query: 266 ATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSS---TGATSVTTHDYGVVLHFTPTV 322
              ++ LAEP L  ISGQ A+F +GG+       SS   T   ++   ++GV L FTPTV
Sbjct: 236 DQPVKILAEPRLVTISGQEATFLAGGKIFIPVPQSSGIGTNTITLQEEEFGVGLKFTPTV 295

Query: 323 LSPGRIGLRIQTEVSEPVIGV---------NAGDMPSYRVRKADTTVELPSGGTIVLAGL 373
           LS GRI L++  EVSE              N   +P    R+A TTV++  G T  + GL
Sbjct: 296 LSNGRISLKVAPEVSELSPTGVTLSAANVGNVSILPLITTRRASTTVQMGDGETFAIGGL 355

Query: 374 LKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDH 433
           +KD+ Q   + +P + ++P+LGALFR++ F ++ TE+    TP LV+P+   D+  P D 
Sbjct: 356 IKDNAQGTLKALPGIGELPVLGALFRSTSFQQDRTELVFIITPHLVQPLETADVPLPTDS 415

Query: 434 YSVEDDAKAFFFNRVNKIYGPKEAS 458
           ++  ++A  +    +    G ++  
Sbjct: 416 FTKPNEADVYATGNMEGRGGLRQHG 440


>gi|300704930|ref|YP_003746533.1| pilus assembly secretion protein [Ralstonia solanacearum CFBP2957]
 gi|299072594|emb|CBJ43944.1| pilus assembly secretion protein [Ralstonia solanacearum CFBP2957]
          Length = 622

 Score =  298 bits (764), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 117/463 (25%), Positives = 215/463 (46%), Gaps = 42/463 (9%)

Query: 24  AKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHS 83
           A        +AA        + +  ++++ + K  ++Q+P  V++  V +P     ++ S
Sbjct: 74  AATAEASRESAAKGPNCTGAMREHSEVTVPVGKSTMVQLPEPVRNRTVGNPHIVQAMLVS 133

Query: 84  PRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADS-NIRVEMVS 142
           P+T+YL G+ VG  N+I+ G  G     +D+ +  D   L+ TLR  +  + N++V   +
Sbjct: 134 PQTLYLLGQEVGTTNMIVQGRSGSC-SVIDVSVGADPGGLQSTLRTLVPGAKNVQVSAAA 192

Query: 143 DTVVLHGMVRTIQDSQRAVELSETFL----------------------SQSGRNQYANSS 180
           D++VL G V     +Q+ ++++  F+                         G    A   
Sbjct: 193 DSLVLSGSVSDSVQAQKVLDIANAFVMRQTRGPAQGDQGGAAQGGGAMQGLGATPGAPPR 252

Query: 181 SKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVS 240
           S +++N++ +    QV L+V +AEV + ++ Q+G   ++    +G   S+       F+S
Sbjct: 253 SPRIINMMAVEAPQQVMLEVKVAEVSKTLIDQMGSALNV----NGAFGSWTFGALANFLS 308

Query: 241 EGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSS 300
              D       +    +  L A +    ++ LAEP+L AISGQ ASF +GG+        
Sbjct: 309 GSNDIVNFSKNNHLPLKFALDAQKGDGLVKVLAEPSLMAISGQEASFLAGGKVFIPVAQG 368

Query: 301 STGA----TSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIG---------VNAGD 347
           +         +    +GV L FTPTV+  GRI L++  EVSE              N   
Sbjct: 369 AATNGVATIILQEETFGVGLRFTPTVMENGRINLKVSPEVSELSPTGVAVTAPNSNNTSI 428

Query: 348 MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREE 407
           +P    R+A TT+++  G +  + GL+K+++    + IP + ++P++GAL R++ F +++
Sbjct: 429 LPLITTRRASTTLQVHDGQSFAIGGLIKNNVTGSLKAIPGIGELPVIGALARSTSFQQDQ 488

Query: 408 TEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNK 450
           TE+    TP LVKP+       P D +   + A+ F    +  
Sbjct: 489 TELVFVVTPRLVKPL-PAQYPLPTDSFGQANPAEIFLNGNMEG 530


>gi|167894387|ref|ZP_02481789.1| type II/III secretion system protein [Burkholderia pseudomallei
           7894]
          Length = 426

 Score =  298 bits (764), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 126/437 (28%), Positives = 210/437 (48%), Gaps = 27/437 (6%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           +++      ++++P     V V+DP  ADV V +P+ +++ GK  G   +  +G + + +
Sbjct: 4   LAVPAGGGEMVKLPAPAVAVFVADPDVADVHVPTPQAVFVLGKKAGTTTLFALGANNRTI 63

Query: 110 LNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLS 169
           L   ++++ D   L+  L        + +     ++++ G V +  D+   V+  + +L 
Sbjct: 64  LRETVVVDVDTPSLQRILDARFPQLRLTLAGAPGSLMVSGRVPSAADADAVVQTLKPYLR 123

Query: 170 QSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKS 229
           Q           + ++N L +A   QV L+V I EV R+I +Q+G   S  G+S      
Sbjct: 124 QQ----------EALVNRLTLARPIQVHLRVRITEVDRNITQQLGINWSALGASGNFVGG 173

Query: 230 FAADFG-------GKFVSEGGDFSVKGVL--DRFSFETVLHALERATAIRTLAEPTLTAI 280
                           +S  G FSV G     R+S + VL AL++   I  LAEP LTAI
Sbjct: 174 LFNGRTLFDTASKAFDLSPSGAFSVVGGFHTSRYSIDGVLDALDQEGLITMLAEPNLTAI 233

Query: 281 SGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPV 340
           SGQ+ASF +GG+        +TGA ++    YGV L FTPTVL+  RI L+++ EVSE  
Sbjct: 234 SGQTASFLAGGEFPIPVAQDTTGAITIQFKPYGVSLDFTPTVLADNRISLKVRPEVSEID 293

Query: 341 IGVNAGD----MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGA 396
              +       +P+  VR+ DTTVEL SG +  + GLL+     +   +P L+++P+LG 
Sbjct: 294 PTNSVTTGSIKVPALTVRRVDTTVELSSGQSFAIGGLLQSKSSDVLAELPGLARLPVLGK 353

Query: 397 LFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKE 456
           LF +  +  ++TE+ +  TP++V+P    +L    D  +       F   R   I     
Sbjct: 354 LFSSRNYLNDKTEVVVIVTPYIVQPANPGELRDALDDVTRPSSDIEFVLQRSLGIDPLGG 413

Query: 457 ASEVEGQNYKGAIGFIY 473
               +     G  GF+Y
Sbjct: 414 ----DAPRLAGPAGFVY 426


>gi|167574003|ref|ZP_02366877.1| type II/III secretion system protein [Burkholderia oklahomensis
           C6786]
          Length = 548

 Score =  298 bits (764), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 124/429 (28%), Positives = 216/429 (50%), Gaps = 22/429 (5%)

Query: 42  VEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVIL 101
            E+ +   +S+ L K +++ +   V++  + +P  A   + SPRT+YL G +VG  N+I+
Sbjct: 90  GEMREATSVSVPLGKSLLVPLDEPVRNRTIGNPAVAQATMVSPRTLYLVGLSVGTTNMIV 149

Query: 102 IGHDGKQMLNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRA 160
            G  G     +D+ +  D   L+ +LR+ +    +IRV   +DT+VL G V   Q +Q+A
Sbjct: 150 QGRSGAC-QIIDVAVGADAGGLQTSLRQLMPAERDIRVSTAADTIVLAGNVSDAQAAQQA 208

Query: 161 VELSETFLSQSGRNQYANSSSKK----VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQ 216
           V +++ +  ++     A + +      V+N+L +    QV L+V +AEV + ++ Q+G  
Sbjct: 209 VAIAKAYSDRTNVGPGAGAGAGGPRGGVLNMLTVTSPQQVLLEVKVAEVSKTLINQMGSA 268

Query: 217 HSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPT 276
            +I G     +    +          G+       ++  F+  L A      ++ LAEP 
Sbjct: 269 INIQGGFGSWTGMLVSSLLAGV----GNGIAASKSNKLPFKAALDAQNTDQPVKILAEPR 324

Query: 277 LTAISGQSASFTSGGQ---HLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQ 333
           L  ISGQ A+F +GG+    + ++  + T   ++   ++GV L FTPTVLS GRI L++ 
Sbjct: 325 LVTISGQEATFLAGGKIFIPVPQSSGTGTTTITLQEEEFGVGLKFTPTVLSNGRISLKVA 384

Query: 334 TEVSEPVIG---------VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEG 384
            EVSE                  +P    R+A TTV++  G T  + GL+KD+ Q     
Sbjct: 385 PEVSELSPTGVTLSATNVSGVSILPLITTRRASTTVQMGDGETFAIGGLIKDNAQGTLRA 444

Query: 385 IPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFF 444
           +P + +IP+LGALFR++ F ++ TE+    TP LVKP+   D+  P D ++  ++   + 
Sbjct: 445 LPGIGEIPVLGALFRSTSFQQDRTELVFIITPHLVKPLETADVPLPTDSFTKPNEVDVYA 504

Query: 445 FNRVNKIYG 453
              +    G
Sbjct: 505 TGNMEGRGG 513


>gi|53723207|ref|YP_112192.1| outer membrane protein [Burkholderia pseudomallei K96243]
 gi|52213621|emb|CAH39675.1| putative outer membrane protein [Burkholderia pseudomallei K96243]
          Length = 690

 Score =  298 bits (763), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 123/432 (28%), Positives = 219/432 (50%), Gaps = 20/432 (4%)

Query: 42  VEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVIL 101
            E+ +   +S+ L K +++ +   V++  + +P  A   + SPRT+YL G +VG  N+I+
Sbjct: 94  GEMRESTSVSVPLGKSLLVPLDEPVRNRTIGNPAVAQATMVSPRTLYLVGMSVGTTNMIV 153

Query: 102 IGHDGKQMLNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRA 160
            G  G     +D+ +  D   L+ +LR+ +    +IRV   +DT+VL G V + Q +Q+A
Sbjct: 154 QGKSGACR-IIDVAVGADAGGLQASLRQLMPRERDIRVSTAADTIVLAGNVSSAQAAQQA 212

Query: 161 VELSETFLSQSGRNQYANSSSKK--VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHS 218
           V +++ + +++      +    +  V+N+L +    QV L+V +AEV + ++ Q+G   +
Sbjct: 213 VAIAKAYSNRTNAGAAGSGGGARADVLNMLTVTSPQQVMLEVKVAEVSKTLINQMGSAVN 272

Query: 219 ITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLT 278
           I G     + +         ++  G        ++      + A      ++ LAEP L 
Sbjct: 273 IQGGFGSWTGALVTSL----LTGVGSGIAASKSNKLPLNGSIDAQNTDQPVKILAEPRLV 328

Query: 279 AISGQSASFTSGGQHLYKTVSSS---TGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTE 335
            ISGQ A+F +GG+       SS   T   ++   ++GV L FTPTVLS GRI L++  E
Sbjct: 329 TISGQEATFLAGGKIFIPVPQSSGIGTNTITLQEEEFGVGLKFTPTVLSNGRISLKVAPE 388

Query: 336 VSEPVIGV---------NAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIP 386
           VSE              N   +P    R+A TTV++  G T  + GL+KD+ Q   + +P
Sbjct: 389 VSELSPTGVTLSAANVGNVSILPLITTRRASTTVQMGDGETFAIGGLIKDNAQGTLKALP 448

Query: 387 LLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFN 446
            + ++P+LGALFR++ F ++ TE+    TP LV+P+   D+  P D ++  ++A  +   
Sbjct: 449 GIGELPVLGALFRSTSFQQDRTELVFIITPHLVQPLETADVPLPTDSFTKPNEADVYATG 508

Query: 447 RVNKIYGPKEAS 458
            +    G ++  
Sbjct: 509 NMEGRGGLRQHG 520


>gi|326388864|ref|ZP_08210446.1| type II and III secretion system protein [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326206464|gb|EGD57299.1| type II and III secretion system protein [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 565

 Score =  298 bits (763), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 131/482 (27%), Positives = 220/482 (45%), Gaps = 38/482 (7%)

Query: 7   TFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDV 66
                +   L ++ P +   P           ++       + ++I + +  ++ +P ++
Sbjct: 33  AILPGLPAALSAATPHMKAKPRALAVLHTTPPMTPGVTAPARSLAISIGRGELVTLPGNM 92

Query: 67  QDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMT 126
            DV V++   ADV V S   +Y+FGK  G+  V      G  + + +I +  ++  ++  
Sbjct: 93  TDVFVANENIADVQVKSGNQLYIFGKAGGETTVYASNGRGDVIWSANIRVGNNLDSIDQM 152

Query: 127 LRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMN 186
           L   + +++I    +++TV+L G V   +D+  A  L + F+ +             V++
Sbjct: 153 LHMAMPEAHIATATMNNTVLLTGTVSAPEDAAEAERLVKAFVGEKT----------NVIS 202

Query: 187 LLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAAD------------- 233
            L +A   QV L V  AEV R + + I    +   ++SG                     
Sbjct: 203 RLKMATPLQVNLHVKFAEVSRTLTRSIQSNWTTADATSGLKFGLGQGRSFFPQYVPGGPL 262

Query: 234 ----------FGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQ 283
                          VS G   ++   +   SF   L   E    + TLAEP LTA+SG+
Sbjct: 263 GMGTATTTGATAVSPVSTGTTLALASKVFGLSFLAALDLAESIGLVSTLAEPNLTALSGE 322

Query: 284 SASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPV--- 340
           +A F +GG++    VSS  G   V   +YGV L +TPTVL+ GRI LR++ EVSE     
Sbjct: 323 TAEFLAGGEYPIP-VSSGLGTVPVQYKNYGVSLAYTPTVLANGRISLRVRPEVSELSSDG 381

Query: 341 -IGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFR 399
            + +N   +P+  VR+A+TT+EL SG + ++AGLLK+  Q     +P    +PILG+LFR
Sbjct: 382 AVSLNGYSVPALSVRRAETTIELGSGQSFMIAGLLKNSSQNTIAKMPGAGDLPILGSLFR 441

Query: 400 NSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASE 459
           ++ + R ETE+ I  TP+LV PV   ++  P D +      K    N  +      E  +
Sbjct: 442 STSYQRGETELVIIVTPYLVNPVDPSEIHLPTDGFKSAGALKQILGNLESDGVVDGERPK 501

Query: 460 VE 461
             
Sbjct: 502 PT 503


>gi|217424167|ref|ZP_03455666.1| outer membrane protein [Burkholderia pseudomallei 576]
 gi|217392632|gb|EEC32655.1| outer membrane protein [Burkholderia pseudomallei 576]
          Length = 673

 Score =  298 bits (763), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 123/432 (28%), Positives = 219/432 (50%), Gaps = 20/432 (4%)

Query: 42  VEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVIL 101
            E+ +   +S+ L K +++ +   V++  + +P  A   + SPRT+YL G +VG  N+I+
Sbjct: 94  GEMRESTSVSVPLGKSLLVPLDEPVRNRTIGNPAVAQATMVSPRTLYLVGMSVGTTNMIV 153

Query: 102 IGHDGKQMLNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRA 160
            G  G     +D+ +  D   L+ +LR+ +    +IRV   +DT+VL G V + Q +Q+A
Sbjct: 154 QGKSGACR-IIDVAVGADAGGLQASLRQLMPRERDIRVSTAADTIVLAGNVSSAQAAQQA 212

Query: 161 VELSETFLSQSGRNQYANSSSKK--VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHS 218
           V +++ + +++      +    +  V+N+L +    QV L+V +AEV + ++ Q+G   +
Sbjct: 213 VAIAKAYSNRTNAGAAGSGVGARADVLNMLTVTSPQQVMLEVKVAEVSKTLINQMGSAVN 272

Query: 219 ITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLT 278
           I G     + +         ++  G        ++      + A      ++ LAEP L 
Sbjct: 273 IQGGFGSWTGALVTSL----LTGVGSGIAASKSNKLPLNGSIDAQNTDQPVKILAEPRLV 328

Query: 279 AISGQSASFTSGGQHLYKTVSSS---TGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTE 335
            ISGQ A+F +GG+       SS   T   ++   ++GV L FTPTVLS GRI L++  E
Sbjct: 329 TISGQEATFLAGGKIFIPVPQSSGIGTNTITLQEEEFGVGLKFTPTVLSNGRISLKVAPE 388

Query: 336 VSEPVIGV---------NAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIP 386
           VSE              N   +P    R+A TTV++  G T  + GL+KD+ Q   + +P
Sbjct: 389 VSELSPTGVTLSAANVGNVSILPLITTRRASTTVQMGDGETFAIGGLIKDNAQGTLKALP 448

Query: 387 LLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFN 446
            + ++P+LGALFR++ F ++ TE+    TP LV+P+   D+  P D ++  ++A  +   
Sbjct: 449 GIGELPVLGALFRSTSFQQDRTELVFIITPHLVQPLETADVPLPTDSFTKPNEADVYATG 508

Query: 447 RVNKIYGPKEAS 458
            +    G ++  
Sbjct: 509 NMEGRGGLRQHG 520


>gi|254192422|ref|ZP_04898861.1| type II/III secretion system protein [Burkholderia pseudomallei
           S13]
 gi|169649180|gb|EDS81873.1| type II/III secretion system protein [Burkholderia pseudomallei
           S13]
          Length = 690

 Score =  298 bits (763), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 123/430 (28%), Positives = 219/430 (50%), Gaps = 20/430 (4%)

Query: 42  VEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVIL 101
            E+ +   +S+ L K +++ +   V++  + +P  A   + SPRT+YL G +VG  N+I+
Sbjct: 94  GEMRESTSVSVPLGKSLLVPLDEPVRNRTIGNPAVAQATMVSPRTLYLVGMSVGTTNMIV 153

Query: 102 IGHDGKQMLNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRA 160
            G  G     +D+ +  D   L+ +LR+ +    +IRV   +DT+VL G V + Q +Q+A
Sbjct: 154 QGKSGACR-IIDVAVGADAGGLQASLRQLMPRERDIRVSTAADTIVLAGNVSSAQAAQQA 212

Query: 161 VELSETFLSQSGRNQYANSSSKK--VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHS 218
           V +++ + +++      +    +  V+N+L +    QV L+V +AEV + ++ Q+G   +
Sbjct: 213 VAIAKAYSNRTNAGAAGSGGGARADVLNMLTVTSPQQVMLEVKVAEVSKTLINQMGSAVN 272

Query: 219 ITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLT 278
           I G     + +         ++  G        ++      + A      ++ LAEP L 
Sbjct: 273 IQGGFGSWTGALVTSL----LTGVGSGIAASKSNKLPLNGSIDAQNTDQPVKILAEPRLV 328

Query: 279 AISGQSASFTSGGQHLYKTVSSS---TGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTE 335
            ISGQ A+F +GG+       SS   T   ++   ++GV L FTPTVLS GRI L++  E
Sbjct: 329 TISGQEATFLAGGKIFIPVPQSSGIGTNTITLQEEEFGVGLKFTPTVLSNGRISLKVAPE 388

Query: 336 VSEPVIGV---------NAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIP 386
           VSE              N   +P    R+A TTV++  G T  + GL+KD+ Q   + +P
Sbjct: 389 VSELSPTGVTLSAANVGNVSILPLITTRRASTTVQMGDGETFAIGGLIKDNAQGTLKALP 448

Query: 387 LLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFN 446
            + ++P+LGALFR++ F ++ TE+    TP LV+P+   D+  P D ++  ++A  +   
Sbjct: 449 GIGELPVLGALFRSTSFQQDRTELVFIITPHLVQPLETADVPLPTDSFTKPNEADVYATG 508

Query: 447 RVNKIYGPKE 456
            +    G ++
Sbjct: 509 NMEGRGGLRQ 518


>gi|126445563|ref|YP_001064076.1| type II/III secretion system protein [Burkholderia pseudomallei
           668]
 gi|126225054|gb|ABN88559.1| type II/III secretion system protein [Burkholderia pseudomallei
           668]
          Length = 690

 Score =  298 bits (763), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 123/436 (28%), Positives = 218/436 (50%), Gaps = 24/436 (5%)

Query: 42  VEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVIL 101
            E+ +   +S+ L K +++ +   V++  + +P  A   + SPRT+YL G +VG  N+I+
Sbjct: 94  GEMRESTSVSVPLGKSLLVPLDEPVRNRTIGNPAVAQATMVSPRTLYLVGMSVGTTNMIV 153

Query: 102 IGHDGKQMLNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRA 160
            G  G     +D+ +  D   L+ +LR+ +    +IRV   +DT+VL G V + Q +Q+A
Sbjct: 154 QGKSGACR-IIDVAVGADAGGLQASLRQLMPREHDIRVSTAADTIVLAGNVSSAQAAQQA 212

Query: 161 VELSETFLSQSGRNQYANSSSKK------VMNLLNIAGEDQVTLKVTIAEVRRDILKQIG 214
           V +++ + +++      +           V+N+L +    QV L+V +AEV + ++ Q+G
Sbjct: 213 VAIAKAYSNRTNAGAAGSGGGNGGGARADVLNMLTVTSPQQVMLEVKVAEVSKTLINQMG 272

Query: 215 FQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAE 274
              +I G     + +         ++  G        ++      + A      ++ LAE
Sbjct: 273 SAVNIQGGFGSWTGALVTSL----LTGVGSGIAASKSNKLPLNGSIDAQNTDQPVKILAE 328

Query: 275 PTLTAISGQSASFTSGGQHLYKTVSSS---TGATSVTTHDYGVVLHFTPTVLSPGRIGLR 331
           P L  ISGQ A+F +GG+       SS   T   ++   ++GV L FTPTVLS GRI L+
Sbjct: 329 PRLVTISGQEATFLAGGKIFIPVPQSSGIGTNTITLQEEEFGVGLKFTPTVLSNGRISLK 388

Query: 332 IQTEVSEPVIGV---------NAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLK 382
           +  EVSE              N   +P    R+A TTV++  G T  + GL+KD+ Q   
Sbjct: 389 VAPEVSELSPTGVTLSAANVGNVSILPLITTRRASTTVQMGDGETFAIGGLIKDNAQGTL 448

Query: 383 EGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKA 442
           + +P + ++P+LGALFR++ F ++ TE+    TP LV+P+   D+  P D ++  ++A  
Sbjct: 449 KALPGIGELPVLGALFRSTSFQQDRTELVFIITPHLVQPLETADVPLPTDSFTKPNEADV 508

Query: 443 FFFNRVNKIYGPKEAS 458
           +    +    G ++  
Sbjct: 509 YATGNMEGRGGLRQHG 524


>gi|167725247|ref|ZP_02408483.1| Putative phospholipid-binding domain family protein [Burkholderia
           pseudomallei DM98]
          Length = 448

 Score =  298 bits (763), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 124/445 (27%), Positives = 220/445 (49%), Gaps = 20/445 (4%)

Query: 29  IKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMY 88
              A          E+ +   +S+ L K +++ +   V++  + +P  A   + SPRT+Y
Sbjct: 1   AAAAVPLRGPNCVGEMRESTSVSVPLGKSLLVPLDEPVRNRTIGNPAVAQATMVSPRTLY 60

Query: 89  LFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVL 147
           L G +VG  N+I+ G  G     +D+ +  D   L+ +LR+ +    +IRV   +DT+VL
Sbjct: 61  LVGMSVGTTNMIVQGKSGACR-IIDVAVGADAGGLQASLRQLMPRERDIRVSTAADTIVL 119

Query: 148 HGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKK--VMNLLNIAGEDQVTLKVTIAEV 205
            G V + Q +Q+AV +++ + +++      +    +  V+N+L +    QV L+V +AEV
Sbjct: 120 AGNVSSAQAAQQAVAIAKAYSNRTNAGAAGSGGGARADVLNMLTVTSPQQVMLEVKVAEV 179

Query: 206 RRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALER 265
            + ++ Q+G   +I G     + +         ++  G        ++      + A   
Sbjct: 180 SKTLINQMGSAVNIQGGFGSWTGALVTSL----LTGVGSGIAASKSNKLPLNGSIDAQNT 235

Query: 266 ATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSS---TGATSVTTHDYGVVLHFTPTV 322
              ++ LAEP L  ISGQ A+F +GG+       SS   T   ++   ++GV L FTPTV
Sbjct: 236 DQPVKILAEPRLVTISGQEATFLAGGKIFIPVPQSSGIGTNTITLQEEEFGVGLKFTPTV 295

Query: 323 LSPGRIGLRIQTEVSEPVIGV---------NAGDMPSYRVRKADTTVELPSGGTIVLAGL 373
           LS GRI L++  EVSE              N   +P    R+A TTV++  G T  + GL
Sbjct: 296 LSNGRISLKVAPEVSELSPTGVTLSAANVGNVSILPLITTRRASTTVQMGDGETFAIGGL 355

Query: 374 LKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDH 433
           +KD+ Q   + +P + ++P+LGALFR++ F ++ TE+    TP LV+P+   D+  P D 
Sbjct: 356 IKDNAQGTLKALPGIGELPVLGALFRSTSFQQDRTELVFIITPHLVQPLETADVPLPTDS 415

Query: 434 YSVEDDAKAFFFNRVNKIYGPKEAS 458
           ++  ++A  +    +    G ++  
Sbjct: 416 FTKPNEADVYATGNMEGRGGLRQHG 440


>gi|86360580|ref|YP_472468.1| cpaC pilus assembly Q protein [Rhizobium etli CFN 42]
 gi|86284682|gb|ABC93741.1| cpaC pilus assembly Q protein [Rhizobium etli CFN 42]
          Length = 495

 Score =  298 bits (763), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 125/495 (25%), Positives = 218/495 (44%), Gaps = 35/495 (7%)

Query: 1   MRYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKG-KKISIGLNKVII 59
           M   +R      S+   ++  S         A +A      + +G+  + +++  N+ + 
Sbjct: 1   MANGRRRIARTKSLAALAAVFSACVCLGPGFAGSASAQEKSITLGESVQHVTLPPNETLT 60

Query: 60  LQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERD 119
           L       D+++      DVV  S +++++ GK  G  N+ + G D   +  +DI +  D
Sbjct: 61  LNTGQPFGDLVIGSADMIDVVPLSDKSLFIRGKKTGATNISVYGDDKSLLGVIDIRVASD 120

Query: 120 IAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANS 179
            + +   +R     + +RV   +D + L G VR   + QR +E+++++            
Sbjct: 121 FSEVASAIRSAAPSARVRVINSNDRIRLTGFVRDGIELQRVMEIAQSY------------ 168

Query: 180 SSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAA------- 232
           S + V+N L ++   QV L+V + E  R   + +G   S  G+++   K+  +       
Sbjct: 169 SDQPVLNQLRVSDSQQVMLEVRVIEASRQTGRDLGIGWSGYGNNNRIGKATTSQGIAVDD 228

Query: 233 -----------DFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAIS 281
                            +  G   +    +     + V++ALE+   +R LA+P L A+S
Sbjct: 229 GSLARTLLDPKGAATGALPFGQLIAKVLEISGGHIDVVINALEQKGLVRRLAQPNLIAMS 288

Query: 282 GQSASFTSGGQHL--YKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEP 339
           G +ASF +GG+      T + +T AT      +GV L F P VL  G I L I+ EVSE 
Sbjct: 289 GSTASFHAGGEVPILKTTNNGTTVATETDYRPFGVRLTFKPVVLDDGLINLEIEPEVSEI 348

Query: 340 VIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFR 399
              +N    P +  R A TTV L  G +  LAGLL+    +  + +P L +IP+LGALFR
Sbjct: 349 DPSINVNGNPGFISRAASTTVALRDGQSFALAGLLQSINAKDIQQLPGLGQIPVLGALFR 408

Query: 400 NSRFNREETEIFIAATPFLVKPVAM-RDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEAS 458
           ++ F ++E+++ I  TP +V+P     DL  P D     +D + F    +  +       
Sbjct: 409 STSFQKKESDLVIVVTPHIVRPARPGEDLYSPLDQTRSSNDVELFALGVLE-VDKDMLRR 467

Query: 459 EVEGQNYKGAIGFIY 473
              G    G  G   
Sbjct: 468 FRNGVGVTGPYGHRL 482


>gi|134281876|ref|ZP_01768583.1| type II/III secretion system protein [Burkholderia pseudomallei
           305]
 gi|134246938|gb|EBA47025.1| type II/III secretion system protein [Burkholderia pseudomallei
           305]
          Length = 685

 Score =  298 bits (762), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 124/432 (28%), Positives = 219/432 (50%), Gaps = 20/432 (4%)

Query: 42  VEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVIL 101
            E+ +   +S+ L K ++L +   V++  + +P  A   + SPRT+YL G +VG  N+I+
Sbjct: 94  GEMRESTSVSVPLGKSLLLPLDEPVRNRTIGNPAVAQATMVSPRTLYLVGMSVGTTNMIV 153

Query: 102 IGHDGKQMLNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRA 160
            G  G     +D+ +  D   L+ +LR+ +    +IRV   +DT+VL G V + Q +Q+A
Sbjct: 154 QGKSGACR-IIDVAVGADAGGLQASLRQLMPRERDIRVSTAADTIVLAGNVSSAQAAQQA 212

Query: 161 VELSETFLSQSGRNQYANSSSKK--VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHS 218
           V +++ + +++      +    +  V+N+L +    QV L+V +AEV + ++ Q+G   +
Sbjct: 213 VAIAKAYSNRTNAGAAGSGGGARADVLNMLTVTSPQQVMLEVKVAEVSKTLINQMGSAVN 272

Query: 219 ITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLT 278
           I G     + +         ++  G        ++      + A      ++ LAEP L 
Sbjct: 273 IQGGFGSWTGALVTSL----LTGVGSGIAASKSNKLPLNGSIDAQNTDQPVKILAEPRLV 328

Query: 279 AISGQSASFTSGGQHLYKTVSSS---TGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTE 335
            ISGQ A+F +GG+       SS   T   ++   ++GV L FTPTVLS GRI L++  E
Sbjct: 329 TISGQEATFLAGGKIFIPVPQSSGIGTNTITLQEEEFGVGLKFTPTVLSNGRISLKVAPE 388

Query: 336 VSEPVIGV---------NAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIP 386
           VSE              N   +P    R+A TTV++  G T  + GL+KD+ Q   + +P
Sbjct: 389 VSELSPTGVTLSAANMGNVSILPLITTRRASTTVQMGDGETFAIGGLIKDNAQGTLKALP 448

Query: 387 LLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFN 446
            + ++P+LGALFR++ F ++ TE+    TP LV+P+   D+  P D ++  ++A  +   
Sbjct: 449 GIGELPVLGALFRSTSFQQDRTELVFIITPHLVQPLETADVPLPTDSFTKPNEADVYATG 508

Query: 447 RVNKIYGPKEAS 458
            +    G ++  
Sbjct: 509 NMEGRGGLRQHG 520


>gi|167908129|ref|ZP_02495334.1| type II/III secretion system protein [Burkholderia pseudomallei
           NCTC 13177]
          Length = 460

 Score =  298 bits (762), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 124/430 (28%), Positives = 219/430 (50%), Gaps = 20/430 (4%)

Query: 42  VEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVIL 101
            E+ +   +S+ L K ++L +   V++  + +P  A   + SPRT+YL G +VG  N+I+
Sbjct: 19  GEMRESTSVSVPLGKSLLLPLDEPVRNRTIGNPAVAQATMVSPRTLYLVGMSVGTTNMIV 78

Query: 102 IGHDGKQMLNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRA 160
            G  G     +D+ +  D   L+ +LR+ +    +IRV   +DT+VL G V + Q +Q+A
Sbjct: 79  QGKSGACR-IIDVAVGADAGGLQASLRQLMPRERDIRVSTAADTIVLAGNVSSAQAAQQA 137

Query: 161 VELSETFLSQSGRNQYANSSSKK--VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHS 218
           V +++ + +++      +    +  V+N+L +    QV L+V +AEV + ++ Q+G   +
Sbjct: 138 VAIAKAYSNRTNAGAAGSGGGARADVLNMLTVTSPQQVMLEVKVAEVSKTLINQMGSAVN 197

Query: 219 ITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLT 278
           I G     + +         ++  G        ++      + A      ++ LAEP L 
Sbjct: 198 IQGGFGSWTGALVTSL----LTGVGSGIAASKSNKLPLNGSIDAQNTDQPVKILAEPRLV 253

Query: 279 AISGQSASFTSGGQHLYKTVSSS---TGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTE 335
            ISGQ A+F +GG+       SS   T   ++   ++GV L FTPTVLS GRI L++  E
Sbjct: 254 TISGQEATFLAGGKIFIPVPQSSGIGTNTITLQEEEFGVGLKFTPTVLSNGRISLKVAPE 313

Query: 336 VSEPVIGV---------NAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIP 386
           VSE              N   +P    R+A TTV++  G T  + GL+KD+ Q   + +P
Sbjct: 314 VSELSPTGVTLSAANMGNVSILPLITTRRASTTVQMGDGETFAIGGLIKDNAQGTLKALP 373

Query: 387 LLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFN 446
            + ++P+LGALFR++ F ++ TE+    TP LV+P+   D+  P D ++  ++A  +   
Sbjct: 374 GIGELPVLGALFRSTSFQQDRTELVFIITPHLVQPLETADVPLPTDSFTKPNEADVYATG 433

Query: 447 RVNKIYGPKE 456
            +    G ++
Sbjct: 434 NMEGRGGLRQ 443


>gi|312883754|ref|ZP_07743473.1| Flp pilus assembly protein CpaC [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309368503|gb|EFP96036.1| Flp pilus assembly protein CpaC [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 460

 Score =  298 bits (762), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 115/452 (25%), Positives = 196/452 (43%), Gaps = 40/452 (8%)

Query: 47  GKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDG 106
            + + + +N+  ++ +  D + + +S+   AD    +   + +FG   G A + ++    
Sbjct: 24  AEPLEVNINEAKMINLSQDAKSIFISNTHIADYQPMTNTKIMVFGMQAGTATITILNAQE 83

Query: 107 KQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSET 166
           + + N  I +  D   L+  +     ++++  E +   + L G V T   +   V +++ 
Sbjct: 84  RVIYNNKIRVVHDTKELDSLIAAQFPEASVHSESLGGKLWLKGNVPTPVMAHSIVSVAKG 143

Query: 167 FLSQSGRNQY---------------ANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILK 211
           +LS    N                  N +  +++N L +    QV ++V IAEV R++  
Sbjct: 144 YLSPVTANAQSEKGSTSPDSSTHSRGNENEDELINQLVVTMPTQVNIRVRIAEVSRNVSN 203

Query: 212 QIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRT 271
           ++G +    G   G      A                    + +   ++ AL     +  
Sbjct: 204 KLGIKWGSVGEGIGSFLYTKA-------------WDVSSWGKPTLSGLVDALASDGTMSI 250

Query: 272 LAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLR 331
           LAEP LTA+SG+ ASF  GG+     ++  T    V    +GV L+FTP VL P RI LR
Sbjct: 251 LAEPNLTAMSGEEASFLVGGEIPLPLINGDTAT--VEYKPFGVNLNFTPVVLGPDRISLR 308

Query: 332 IQTEVSE----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPL 387
           +  EVS         +N    PS+  R+A TT+EL SG +  L GLL+       + +P 
Sbjct: 309 VSPEVSSVSVSNQTTLNGNTYPSFTSRRATTTIELASGQSFALGGLLQSSEIDQLQKLPG 368

Query: 388 LSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFF--- 444
              IPILG LFR++ + R+ETE+ I AT +LV+PV    L  P D+     D +      
Sbjct: 369 AGDIPILGGLFRSNEYQRKETELIIIATAYLVEPVRNDTLPLPTDNLLPRSDLERLLVAF 428

Query: 445 ---FNRVNKIYGPKEASEVEGQNYKGAIGFIY 473
                +  ++ G    ++       G  GF Y
Sbjct: 429 PRKRGKQKQVKGKDTYTDNRAPRLLGDNGFYY 460


>gi|167617230|ref|ZP_02385861.1| Bacterial type II and III secretion system protein domain protein
           [Burkholderia thailandensis Bt4]
          Length = 468

 Score =  298 bits (762), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 124/433 (28%), Positives = 216/433 (49%), Gaps = 21/433 (4%)

Query: 42  VEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVIL 101
             +G+   +S+ L K +++ +   V++  + +P  A   + SPRT+YL G +VG  N+I+
Sbjct: 15  GAMGESTSVSVPLGKSLLVPLDEPVRNRTIGNPAVAQATMVSPRTLYLVGMSVGTTNMIV 74

Query: 102 IGHDGKQMLNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRA 160
            G  G     +D+ +  D   L+ +LR+ +    +IRV   +DT+VL G V + Q +Q+A
Sbjct: 75  QGKSGACR-IIDVAVGADAGGLQASLRQLMPRERDIRVSTAADTIVLAGNVSSAQAAQQA 133

Query: 161 VELSETFLSQSGRNQYANSSSKK---VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQH 217
           V +++ +  ++               V+N+L +    QV L+V +AEV + ++ Q+G   
Sbjct: 134 VAIAKAYSDRTNAGALGGGGGGTRAGVLNMLTVTSPQQVMLEVKVAEVSKTLINQMGSAV 193

Query: 218 SITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTL 277
           ++ G     + +         ++  G+       ++      + A      ++ LAEP L
Sbjct: 194 NLQGGFGSWTGALVTSL----LTGVGNGIAVSKSNKLPLNGSIDAQNTDQPVKILAEPRL 249

Query: 278 TAISGQSASFTSGGQHLYKTVSSSTGATSV---TTHDYGVVLHFTPTVLSPGRIGLRIQT 334
             ISGQ A+F +GG+       SS   TS       ++GV L FTPTVLS GRI L++  
Sbjct: 250 VTISGQEATFLAGGKIFIPVPQSSGVGTSTITLQQEEFGVGLKFTPTVLSNGRINLKVAP 309

Query: 335 EVSEPVIGV---------NAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGI 385
           EVSE                  +P    R+A TTV++  G T  + GL+KD+ Q   + +
Sbjct: 310 EVSELSPTGVTLSAANVGGVSILPLITTRRASTTVQMNDGETFAIGGLIKDNAQGTLKAL 369

Query: 386 PLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFF 445
           P + ++P+LGALFR++ F ++ TE+    TP LVKP+A  D+  P D ++  ++A  +  
Sbjct: 370 PGIGELPVLGALFRSTSFQQDRTELVFIITPHLVKPLAAADVPLPTDSFTQPNEADVYAT 429

Query: 446 NRVNKIYGPKEAS 458
             +    G ++  
Sbjct: 430 GNMEGRGGLRQHG 442


>gi|167579115|ref|ZP_02371989.1| Bacterial type II and III secretion system protein domain protein
           [Burkholderia thailandensis TXDOH]
          Length = 462

 Score =  298 bits (762), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 124/433 (28%), Positives = 216/433 (49%), Gaps = 21/433 (4%)

Query: 42  VEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVIL 101
             +G+   +S+ L K +++ +   V++  + +P  A   + SPRT+YL G +VG  N+I+
Sbjct: 15  GAMGESTSVSVPLGKSLLVPLDEPVRNRTIGNPAVAQATMVSPRTLYLVGMSVGTTNMIV 74

Query: 102 IGHDGKQMLNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRA 160
            G  G     +D+ +  D   L+ +LR+ +    +IRV   +DT+VL G V + Q +Q+A
Sbjct: 75  QGKSGACR-IIDVAVGADAGGLQASLRQLMPRERDIRVSTAADTIVLAGNVSSAQAAQQA 133

Query: 161 VELSETFLSQSGRNQYANSSSKK---VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQH 217
           V +++ +  ++               V+N+L +    QV L+V +AEV + ++ Q+G   
Sbjct: 134 VAIAKAYSDRTNAAALGGGGGGPRAGVLNMLTVTSPQQVMLEVKVAEVSKTLINQMGSAV 193

Query: 218 SITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTL 277
           ++ G     + +         ++  G+       ++      + A      ++ LAEP L
Sbjct: 194 NLQGGFGSWTGALVTSL----LTGVGNGIAVSKSNKLPLNGSIDAQNTDQPVKILAEPRL 249

Query: 278 TAISGQSASFTSGGQHLYKTVSSSTGATSV---TTHDYGVVLHFTPTVLSPGRIGLRIQT 334
             ISGQ A+F +GG+       SS   TS       ++GV L FTPTVLS GRI L++  
Sbjct: 250 VTISGQEATFLAGGKIFIPVPQSSGVGTSTITLQQEEFGVGLKFTPTVLSNGRINLKVAP 309

Query: 335 EVSEPVIGV---------NAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGI 385
           EVSE                  +P    R+A TTV++  G T  + GL+KD+ Q   + +
Sbjct: 310 EVSELSPTGVTLSAANVGGVSILPLITTRRASTTVQMNDGETFAIGGLIKDNAQGTLKAL 369

Query: 386 PLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFF 445
           P + ++P+LGALFR++ F ++ TE+    TP LVKP+A  D+  P D ++  ++A  +  
Sbjct: 370 PGIGELPVLGALFRSTSFQQDRTELVFIITPHLVKPLAAADVPLPTDSFTQPNEADVYAT 429

Query: 446 NRVNKIYGPKEAS 458
             +    G ++  
Sbjct: 430 GNMEGRGGLRQHG 442


>gi|46204251|ref|ZP_00050268.2| COG4964: Flp pilus assembly protein, secretin CpaC
           [Magnetospirillum magnetotacticum MS-1]
          Length = 472

 Score =  298 bits (762), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 132/435 (30%), Positives = 218/435 (50%), Gaps = 24/435 (5%)

Query: 3   YLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQV 62
            L+     ++S       P+     P   A     +      G+ +++ +   + +I+ +
Sbjct: 6   RLRTIVLALLSAACLGQVPARRAKTPDCPAR-PRSDDRAERSGQSRRVELSKGRSLIVDL 64

Query: 63  PVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAH 122
           P D ++V V++P  A+ VV S R ++L G   G  ++ ++  +G+Q+  LD+ I RDI  
Sbjct: 65  PRDAKEVFVANPAVANAVVRSSRKLFLIGIENGATSIFVMDAEGRQIAALDVTIARDINV 124

Query: 123 LEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSK 182
           L  +L++ +   +I V+ V D++VL G V +  ++Q+A++++              ++  
Sbjct: 125 LRQSLQQSLPGRHIDVKAVGDSLVLSGGVSSASEAQQAIDIANA--FVGIAGGAGGAARG 182

Query: 183 KVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGP--------SKSFAADF 234
            V+N L I  +DQV ++VT+ EV R ++KQ G   +   S+  P        + +     
Sbjct: 183 AVINNLTIRNKDQVMIRVTVVEVARSVIKQFGISTTGNWSALNPLDSTGNFLTNNTGFPL 242

Query: 235 GGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHL 294
            G F   G   +       FS +  L A E+A   R LAEPTLTAISG++A FT+GG+  
Sbjct: 243 TGAFTPSGNALTASVRSGGFSLQATLRAFEQAGVSRILAEPTLTAISGEAAKFTAGGEIP 302

Query: 295 YKT-----VSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVN----- 344
                      S    S+    YGV L FTP VL+  RI +R+ T+V+E     +     
Sbjct: 303 VPANCSVGAVGSACTISLVYKPYGVSLSFTPVVLAENRISIRVATDVTELDTQNSFSYNL 362

Query: 345 ---AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNS 401
                 +P+ R R ++TTVEL SG T++ AGL++   +    G+P L  +PILGALFR+ 
Sbjct: 363 NGRVVPVPATRRRNSETTVELASGATMMTAGLIQQQNKGTINGLPGLMNLPILGALFRSR 422

Query: 402 RFNREETEIFIAATP 416
            F R+E E+ I  TP
Sbjct: 423 DFQRDENELMILVTP 437


>gi|323700359|ref|ZP_08112271.1| type II and III secretion system protein [Desulfovibrio sp. ND132]
 gi|323460291|gb|EGB16156.1| type II and III secretion system protein [Desulfovibrio
           desulfuricans ND132]
          Length = 476

 Score =  298 bits (762), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 114/427 (26%), Positives = 199/427 (46%), Gaps = 25/427 (5%)

Query: 34  AAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKN 93
           A V     V+  K   IS+ + +  ++    +V  + +   T   +VV SP  +YL    
Sbjct: 23  ATVAWARVVKSDKPDMISMIIGESTVITTDQNVSRITLGSDTVCSIVVISPTQIYLTANE 82

Query: 94  VGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSN-IRVEMVSDTVVLHGMVR 152
           +G   + L   D +     DI ++ D   L+  +   +   N +RV    +++ L G V 
Sbjct: 83  IGSTTLTLWTGD-RVSEIYDIAVDPDTTRLKRMIYELLPQENNVRVLTSGNSITLSGQVS 141

Query: 153 TIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQ 212
                   + L+E              +  +V+NLL++ G  QV L+V +AE+ R + K+
Sbjct: 142 NATSLSSVLSLAEAA------------APGRVVNLLSVDGIQQVMLEVRVAEMSRSVTKR 189

Query: 213 IGFQHSITGSSSGPSKSFAADFGGKF------VSEGGDFSVKGVLDRFSFETVLHALERA 266
           +G   +  GS+                     +++  + +   V    +   ++ AL+  
Sbjct: 190 LGLNFAAIGSNFSIYSIINNLTSYNNEDNVFELTDNINLAGSYVSGNTTIHGMVDALKSN 249

Query: 267 TAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPG 326
             +R LAEP LT +SG++A F  GG+       S+ G   +    +G+ L FT TV+S G
Sbjct: 250 GLVRMLAEPNLTCVSGEAAEFLVGGEVPIPM-PSALGTVGIDYKPFGIALKFTATVMSSG 308

Query: 327 RIGLRIQTEVSEPV----IGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLK 382
           RI L++  EVSE      + V+  ++P+   R+A+T VEL  G + V+AGL+ D +++  
Sbjct: 309 RINLQVNPEVSELDYSKALSVSGYEIPTISTRRANTVVELGDGQSFVIAGLISDSLKENA 368

Query: 383 EGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKA 442
              P L ++P+LG+LF +  FN  +TE+ +  T  L KPV M   + P D +   DD + 
Sbjct: 369 HKFPGLGEVPVLGSLFSSKDFNSNKTELVVLVTAHLAKPVDMATQTLPTDGFREPDDREF 428

Query: 443 FFFNRVN 449
           + F  + 
Sbjct: 429 YLFGLLE 435


>gi|254293214|ref|YP_003059237.1| type II and III secretion system protein [Hirschia baltica ATCC
           49814]
 gi|254041745|gb|ACT58540.1| type II and III secretion system protein [Hirschia baltica ATCC
           49814]
          Length = 535

 Score =  298 bits (762), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 151/537 (28%), Positives = 256/537 (47%), Gaps = 78/537 (14%)

Query: 4   LQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIG---KGKKISIGLNKVIIL 60
           +++   +     +   + S      +    +  I +   E G     + +++  NK  +L
Sbjct: 9   IKKILLSACVAAIGFGSESAFAQNSLAGGVSETIRVRVTEPGQSATSRTLNLSQNKTAVL 68

Query: 61  QVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDI-LIERD 119
           +   DV D+LV++P  ADV+  S R + +  K  G++++I     GK++L+LD+ +  + 
Sbjct: 69  EFEEDVDDILVANPEIADVLARSKRRIAVLAKGKGESSIIFTNAQGKEILSLDVIVAGQG 128

Query: 120 IAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANS 179
           ++ L+  + +++  S I+ E V+  +VL G   ++ D+  A++L++ F+           
Sbjct: 129 VSELQALIEQYVPRSAIKAEFVNGAIVLAGKSPSLSDADMAIQLAQQFVVDD-------- 180

Query: 180 SSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGS----------------- 222
               V+N+++I G+DQV LKV I E++R ++KQ+G   S + +                 
Sbjct: 181 --SPVINMISIEGKDQVLLKVRIVEMQRSVIKQLGVNLSGSMNIGELANKSVQTAYDAVT 238

Query: 223 ---------------------------SSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFS 255
                                       +  S   + +  G         +  G   + S
Sbjct: 239 GEVLLDAAGEALQVLAPAAPWDQSVSFGTSNSLGISGESLGGMSLSPSYNNYVGDKLQSS 298

Query: 256 FETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVV 315
               +  LER   +RTLAEP LTA+SG+SA F +GG+    +   S G   +    +GV 
Sbjct: 299 AGFSVDMLERIGLVRTLAEPNLTALSGESAKFLAGGEFPVPSEVDSDGEVVLEFKPFGVG 358

Query: 316 LHFTPTVLSPGRIGLRIQTEVSEPVIGVN-------------------AGDMPSYRVRKA 356
           L FTP VLS  RI +RI TEVSE                         A  +P+ +VR+A
Sbjct: 359 LGFTPVVLSESRISMRISTEVSELTSTGGYQIGGTTYVDGAGNTVSTPAVVIPALKVRRA 418

Query: 357 DTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATP 416
           DTTVE+PSGG++V+AGL+++   Q  + +P +  +P++G+LFR+  F   ETE+ +  TP
Sbjct: 419 DTTVEMPSGGSLVIAGLIQEQTSQAMDKVPGVGNLPVIGSLFRSREFQNNETELVVIVTP 478

Query: 417 FLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIY 473
           +LV P   + L  PDD Y    DAKA FF ++N++Y  + A   E     G  GFI+
Sbjct: 479 YLVDPTDPKKLRSPDDGYVAAKDAKAIFFGKMNEVYAVEGADVEETAGING-AGFIF 534


>gi|260778162|ref|ZP_05887055.1| type II/IV secretion system secretin RcpA/CpaC associated with Flp
           pilus assembly [Vibrio coralliilyticus ATCC BAA-450]
 gi|260606175|gb|EEX32460.1| type II/IV secretion system secretin RcpA/CpaC associated with Flp
           pilus assembly [Vibrio coralliilyticus ATCC BAA-450]
          Length = 469

 Score =  297 bits (761), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 107/454 (23%), Positives = 199/454 (43%), Gaps = 35/454 (7%)

Query: 47  GKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDG 106
              + + +N+  ++++    + + +S+   AD    +   + +FG   G A + ++    
Sbjct: 24  ANALEVNINEAKMIRLSEKAKSIFISNTHIADYQPMTNTKIMVFGMQAGTATITVLNEQE 83

Query: 107 KQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSET 166
           + + +  I +  D   L+  ++    D+++  E +   + L G V T   +   V +++ 
Sbjct: 84  RVIYSNKIRVVHDTQELDELIKAQFPDASVNSESLGGKLWLKGSVPTPVMAHSIVNVAKG 143

Query: 167 FLSQSGRNQYANSS--------------------SKKVMNLLNIAGEDQVTLKVTIAEVR 206
           +LS     Q +N++                      +++N L +    QV +++ IAEV 
Sbjct: 144 YLSPIVAPQESNNNDSSKSSNSSESNSENQQNSNGDELINQLVVTMPTQVNIRIRIAEVS 203

Query: 207 RDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERA 266
           R++  ++G +     ++    ++    F      +   +       + +   ++ AL   
Sbjct: 204 RNVSNKLGIKWGSLVTNGSTVENTVGSFLYNKPWDVSSW------GKPNLSALVDALAST 257

Query: 267 TAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPG 326
             +  LAEP LTA+SG+ A+F  GG+     +   T    V    +GV L+F P VL P 
Sbjct: 258 GDMSILAEPNLTAMSGEEANFLVGGEVPIPLIQGDTAT--VEYKPFGVNLNFKPVVLGPD 315

Query: 327 RIGLRIQTEVSEPVIGV----NAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLK 382
           RI L+++ EVS   +      N   +PS+  R+A TT+EL SG +  L GLL+    +  
Sbjct: 316 RISLKVEPEVSSVSVDNQAVLNGNVLPSFTSRRASTTIELASGQSFALGGLLQSSEIEQL 375

Query: 383 EGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKA 442
           + +P +  IPILG LFR++ + R ETE+ I AT +LV+P    +L  P D    + D + 
Sbjct: 376 QKLPGMGDIPILGGLFRSNEYQRRETELIIIATAYLVEPTRSDNLPIPTDALIPQSDLER 435

Query: 443 FFFNRVNKIYGPKEASEVE---GQNYKGAIGFIY 473
                     G    +           G  GF Y
Sbjct: 436 LLALPDEDFVGTSGKATYTDNRKPRLLGDNGFYY 469


>gi|327189767|gb|EGE56911.1| cpaC pilus assembly Q protein [Rhizobium etli CNPAF512]
          Length = 495

 Score =  297 bits (761), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 127/490 (25%), Positives = 219/490 (44%), Gaps = 34/490 (6%)

Query: 5   QRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPV 64
           +R+  T     L ++  +   L P     A+    S       + +++  N+ + L    
Sbjct: 6   RRSARTKSLAALAATFSACVILGPGFAGYASAQEKSVTLGKSVQHVTLPPNETLTLNTGQ 65

Query: 65  DVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLE 124
              D+++      DVV  S +++++ GK  G  N+ + G D   +  +DI +  D + + 
Sbjct: 66  PFGDLVIGSADMIDVVPLSDKSLFVRGKKTGATNISVYGDDKSLLGVIDIRVASDFSEVS 125

Query: 125 MTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKV 184
             +R     + +RV   +D + L G+VR   + QR +E+++++            S + V
Sbjct: 126 AAIRSAAPTARVRVFNSNDRIRLVGVVRDSIELQRVLEIAQSY------------SEQPV 173

Query: 185 MNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAA------------ 232
           +N L ++   QV L+V I E  R   + +G   S  G+++   K+  +            
Sbjct: 174 LNQLRVSDSQQVMLEVRIIEASRQTGRDLGIGWSGYGNNNRIGKATTSQGITVDDGNLAR 233

Query: 233 ------DFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSAS 286
                       +  G   +    +     + V++ALE+   +R LA+P L A+SG +AS
Sbjct: 234 TLLDPKGAATGMLPFGQLIAKVLEISGGHIDVVINALEQKGLVRRLAQPNLIAMSGSTAS 293

Query: 287 FTSGGQHL--YKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVN 344
           F +GG+      T + +T AT      +GV L F P VL  G I L I+ EVSE    +N
Sbjct: 294 FHAGGEVPILKTTNNGTTVATETDYRPFGVRLTFKPVVLDDGVINLEIEPEVSELDPSIN 353

Query: 345 AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFN 404
               P +  R A TTV L  G +  LAGLL+    +  + +P L +IP+LGALFR++ F 
Sbjct: 354 VNGNPGFISRAASTTVALRDGQSFALAGLLQSINAKDIQQMPGLGQIPVLGALFRSTSFQ 413

Query: 405 REETEIFIAATPFLVKPVAM-RDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQ 463
           ++E+++ I  TP +V+P     DL  P D     +D + F    V ++          G+
Sbjct: 414 KKESDLVIVVTPHIVRPARPGEDLYSPLDQTRSSNDVELFALG-VMEVDKDMLRRFRNGE 472

Query: 464 NYKGAIGFIY 473
              G  G   
Sbjct: 473 GVTGPYGHRL 482


>gi|94497254|ref|ZP_01303826.1| type II and III secretion system protein [Sphingomonas sp. SKA58]
 gi|94423359|gb|EAT08388.1| type II and III secretion system protein [Sphingomonas sp. SKA58]
          Length = 486

 Score =  297 bits (761), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 125/464 (26%), Positives = 210/464 (45%), Gaps = 28/464 (6%)

Query: 16  LFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPT 75
           L     ++           + +N +   +     + + +    ++ +P  + DV+++DP 
Sbjct: 4   LAGPAIAIGLAVACAAVPTSALNAATSSMQDNAIL-LSVGGSRVINLPAKMSDVVIADPE 62

Query: 76  KADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSN 135
             DV V S   +YL  K  G+  V     +GK + +  + +  +I  ++  LR  +  +N
Sbjct: 63  VVDVHVRSQNQLYLIAKKAGETTVFATAPNGKVLFSGTVRVGNNITSIDDMLRIAMPGAN 122

Query: 136 IRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQ 195
           I V  ++  V+L G ++  +D+     L++ F+ +             V++ L +A   Q
Sbjct: 123 IAVNTMNGMVLLTGTIQAPEDAAEVERLTQAFVGKDVT----------VVSRLRMATPLQ 172

Query: 196 VTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFG---------------GKFVS 240
           V L+V IAEV +D+  +IG   +    S G                            + 
Sbjct: 173 VMLQVKIAEVAKDVGHKIGTNFASVDRSGGKVAGNVGGGLRDFAQYNADTNSWDFTNPID 232

Query: 241 EGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSS 300
            G        +        L   E +    TLA+P LTA+SG++ASF +GG++ Y   + 
Sbjct: 233 GGYSLGGVARILGMDIAGALDLAESSGLASTLAQPNLTALSGETASFLAGGEYPYTVSNG 292

Query: 301 STGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGDMPSYRVRKADTTV 360
             G  S+    YGV L FTPTVL+ GRI LR++  VS     +NA ++P+ + R A+TTV
Sbjct: 293 LQG-NSIEFKQYGVQLAFTPTVLADGRISLRVRPTVSSLDFSINA-NVPALKSRTAETTV 350

Query: 361 ELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVK 420
           EL SG   ++AGLL ++       +P L  +PILG+LF++ +F R ETE+ I  TP+LVK
Sbjct: 351 ELGSGQAFMIAGLLNNEASNNVNKVPGLGNLPILGSLFKSRQFQRNETELVIVVTPYLVK 410

Query: 421 PVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQN 464
           P+   D+  P D +   D  +  F  R +               
Sbjct: 411 PMNASDVRLPTDGFRNADLGEGLFLQRSHSGTSGARRPMPSRAP 454


>gi|13471032|ref|NP_102601.1| secretory protein [Mesorhizobium loti MAFF303099]
 gi|14021776|dbj|BAB48387.1| probable secretory protein [Mesorhizobium loti MAFF303099]
          Length = 461

 Score =  297 bits (761), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 124/462 (26%), Positives = 214/462 (46%), Gaps = 23/462 (4%)

Query: 12  MSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLV 71
           M+  L +    +  LP + +A+  ++ +S  +      I +   K   +        +++
Sbjct: 1   MAAALVAGA--MLALPGVAKADNDIVYVSATKNA---SIKVAKGKPKTIVTNAAFYQIVI 55

Query: 72  SDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFI 131
            DP  A+V   + ++ Y+ G N+G   + L     + +  +DI +  D   L  T+R  +
Sbjct: 56  GDPEIANVNPLTDKSFYVLGNNLGTTGIALFDEKKQLVGTVDIEVTLDTDQLASTIRASV 115

Query: 132 ADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIA 191
            D+ I+V   +  VVL G       +++A +++  F             +++V+N +NI+
Sbjct: 116 PDAKIKVGSANGRVVLSGEADDAVAAEKANKIATRFSG-----------TEEVINSVNIS 164

Query: 192 GEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVL 251
              QV L V   E+ R   + +G ++S   +     +  + D G    +  G+   + + 
Sbjct: 165 SSQQVQLNVRFVEINRQAGQDLGAKYSANFAYGFGGRDVSLDPGTVPAAGTGEIIGRLLS 224

Query: 252 DRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHD 311
           +  S +  + ALE     R LAEP L A SG++ASF +GG+     VS   G  SV+   
Sbjct: 225 NGVSIDIAIKALEERGLARRLAEPNLIARSGETASFLAGGEFPIP-VSEDNGKISVSYKK 283

Query: 312 YGVVLHFTPTVLSPGRIGLRIQTEVSEPVIG----VNAGDMPSYRVRKADTTVELPSGGT 367
           YGV L FTPTVL  G + L I  EVS         +    +P + VR+A T+V+L +G +
Sbjct: 284 YGVSLDFTPTVLKDGLVSLDIAPEVSSIDASSSYNIGTISVPGFIVRRAKTSVDLKNGQS 343

Query: 368 IVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAM-RD 426
            ++AGLL+         IP L K+P+LGALF +  + R ET++ I  TP+LVKPV   + 
Sbjct: 344 FMIAGLLQSQNDITTSRIPGLGKMPVLGALFSSKSYQRRETDLVIIVTPYLVKPVDPSKK 403

Query: 427 LSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGA 468
           +  P D      +   +F N   ++        +   +   A
Sbjct: 404 MVEPTDGTRPASNVD-YFLNNTEEVKASDAGRALALADGSAA 444


>gi|167899813|ref|ZP_02487214.1| Putative phospholipid-binding domain family protein [Burkholderia
           pseudomallei 7894]
          Length = 473

 Score =  297 bits (760), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 123/432 (28%), Positives = 219/432 (50%), Gaps = 20/432 (4%)

Query: 42  VEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVIL 101
            E+ +   +S+ L K +++ +   V++  + +P  A   + SPRT+YL G +VG  N+I+
Sbjct: 36  GEMRESTSVSVPLGKSLLVPLDEPVRNRTIGNPAVAQATMVSPRTLYLVGMSVGTTNMIV 95

Query: 102 IGHDGKQMLNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRA 160
            G  G     +D+ +  D   L+ +LR+ +    +IRV   +DT+VL G V + Q +Q+A
Sbjct: 96  QGKSGACR-IIDVAVGADAGGLQASLRQLMPRERDIRVSTAADTIVLAGNVSSAQAAQQA 154

Query: 161 VELSETFLSQSGRNQYANSSSKK--VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHS 218
           V +++ + +++      +    +  V+N+L +    QV L+V +AEV + ++ Q+G   +
Sbjct: 155 VAIAKAYSNRTNAGAAGSGGGARADVLNMLTVTSPQQVMLEVKVAEVSKTLINQMGSAVN 214

Query: 219 ITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLT 278
           I G     + +         ++  G        ++      + A      ++ LAEP L 
Sbjct: 215 IQGGFGSWTGALVTSL----LTGVGSGIAASKSNKLPLNGSIDAQNTDQPVKILAEPRLV 270

Query: 279 AISGQSASFTSGGQHLYKTVSSS---TGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTE 335
            ISGQ A+F +GG+       SS   T   ++   ++GV L FTPTVLS GRI L++  E
Sbjct: 271 TISGQEATFLAGGKIFIPVPQSSGIGTNTITLQEEEFGVGLKFTPTVLSNGRISLKVAPE 330

Query: 336 VSEPVIG---------VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIP 386
           VSE              N   +P    R+A TTV++  G T  + GL+KD+ Q   + +P
Sbjct: 331 VSELSPTGVTLSAANVGNVSILPLITTRRASTTVQMGDGETFAIGGLIKDNAQGTLKALP 390

Query: 387 LLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFN 446
            + ++P+LGALFR++ F ++ TE+    TP LV+P+   D+  P D ++  ++A  +   
Sbjct: 391 GIGELPVLGALFRSTSFQQDRTELVFIITPHLVQPLETADVPLPTDSFTKPNEADVYATG 450

Query: 447 RVNKIYGPKEAS 458
            +    G ++  
Sbjct: 451 NMEGRGGLRQHG 462


>gi|145219384|ref|YP_001130093.1| type II and III secretion system protein [Prosthecochloris
           vibrioformis DSM 265]
 gi|145205548|gb|ABP36591.1| type II and III secretion system protein [Chlorobium
           phaeovibrioides DSM 265]
          Length = 472

 Score =  297 bits (760), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 124/496 (25%), Positives = 208/496 (41%), Gaps = 69/496 (13%)

Query: 1   MRYLQRTFFTM--MSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVI 58
           M YL R+   M   +  L S  P      P                       + + +  
Sbjct: 5   MSYLMRSGCRMSAFAALLSSIAPVAGLAAPSTYF-------------------VPVGESR 45

Query: 59  ILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIER 118
           + ++   ++ V V +P  AD ++ +   +YL GK  G  N+IL    GK   +  + + R
Sbjct: 46  VYRLEQPIKRVAVGNPEVADYIMLNSSELYLLGKKTGATNLILWNQQGK-FTSTLLQVSR 104

Query: 119 DIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRN--- 174
           +   ++  LR  + +   I++    + +VL G V     ++ A  L + +L     +   
Sbjct: 105 NSYPIKQLLRTALPEESEIQIFSSGEALVLAGSVSNRLAAETAYRLVKAYLGGKVPDVNP 164

Query: 175 -------------------------------QYANSSSKKVMNLLNIAGEDQVTLKVTIA 203
                                             +++   V+NLL +    QV L+V IA
Sbjct: 165 ESSLAKTTSASAASASIAGTTNGSSAVPVQASTQSTAPAGVVNLLTVRDTQQVRLEVRIA 224

Query: 204 EVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHAL 263
           EV +  L+ +G            + +        FVS      +         E  + A 
Sbjct: 225 EVSKTYLQTLGIGWQQ------GTGNTQGSLMTGFVSNATLNVLLQTKSNPGNELSMDAE 278

Query: 264 ERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVL 323
            +   I+ LAEPTL A+SG+   F  GG+    TV+S+     V    YGV L FTPTVL
Sbjct: 279 RKEGVIKILAEPTLVAMSGEEGYFLVGGKVFTPTVTSNGAIDYVERT-YGVGLRFTPTVL 337

Query: 324 SPGRIGLRIQTEVSEP----VIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQ 379
             GRI L++  EVSEP    V    +  +P ++   A +TV++  G  +V+ GLL+D++ 
Sbjct: 338 DSGRISLKVAPEVSEPLKEAVTAGTSTPLPGFKTSFASSTVQMNEGENLVIGGLLRDNLT 397

Query: 380 QLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDD 439
           ++   +PLLS IPILG+LFR++  + E TE+ +   P L+K  +      P D ++    
Sbjct: 398 EVVRAVPLLSDIPILGSLFRHTEKSSETTELMVIIRPTLIKA-STTAQELPTDKFAPPSS 456

Query: 440 AKAFFFNRVNKIYGPK 455
           ++ F   ++    G K
Sbjct: 457 SELFLEGKLQGSRGSK 472


>gi|299067807|emb|CBJ39018.1| pilus assembly secretion protein [Ralstonia solanacearum CMR15]
          Length = 635

 Score =  297 bits (760), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 117/498 (23%), Positives = 223/498 (44%), Gaps = 55/498 (11%)

Query: 17  FSSNPSVAKLPPIKEANAAVINIS-----DVEIGKGKKISIGLNKVIILQVPVDVQDVLV 71
            ++N  +        A+ A  N          +    ++++ + K  ++Q+   V+   V
Sbjct: 60  MAANGPIQLTIGSARADTARENTVKGPNCTGPMRDHSEVTVPVGKSTMVQLSEPVRSRTV 119

Query: 72  SDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFI 131
            +P     ++ SP+T+YL G++VG  N+I+ G  G     +D+ +  D   L+ TL   +
Sbjct: 120 GNPNIVQAMLVSPQTLYLLGQDVGTTNMIVQGRSGSC-SVIDVSVGADPGGLQATLHALM 178

Query: 132 ADS-NIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSK-------- 182
            ++  +RV   +D++VL G V     +Q+ ++++  F+ +  R    +  +         
Sbjct: 179 PEASRVRVSAAADSLVLGGTVSDSVQAQKIMDIANAFVMRETRGPAQSGQAGTMGMQGMT 238

Query: 183 -----------------------KVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSI 219
                                  +++N++++    QV L+V +AEV + ++ Q+G   ++
Sbjct: 239 AMSTGNAATASSGSGSGEAVRNPRIINMMSVEAPQQVMLEVKVAEVSKTLINQMGAALNL 298

Query: 220 TGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTA 279
               +G   S+       F+S   D       ++  F+  L A +    ++ LAEP L A
Sbjct: 299 ----NGSFGSWTFGALANFLSGAPDIFSVDKANKLPFQLKLDAQKGDGLVKVLAEPNLMA 354

Query: 280 ISGQSASFTSGGQHLYKTVSS---STGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEV 336
           ISGQ ASF +GG+       S    T +  +    +GV L FTPTVL  GRI L++  EV
Sbjct: 355 ISGQEASFLAGGKVYIPVPQSFGSGTTSILLQEETFGVGLRFTPTVLENGRINLKVAPEV 414

Query: 337 SEPVIG---------VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPL 387
           SE                  +P    R+A TT+++  G +  + GL+K +I    + IP 
Sbjct: 415 SELSPTGVAVTAPNVSGTSILPLITTRRASTTLQVHDGQSFAIGGLIKSNITGSLKAIPG 474

Query: 388 LSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNR 447
           + ++P++GAL R++ F +++TE+    TP LVKP+   +   P D +   +  + +    
Sbjct: 475 VGELPVIGALARSTSFQQDQTELLFVVTPHLVKPL-PANYPMPTDSFGPVNQGEVYLNGN 533

Query: 448 VNKIYGPKEASEVEGQNY 465
           +      + A      ++
Sbjct: 534 MEGHPAQRPAPASTQGSF 551


>gi|83716099|ref|YP_440456.1| type II and III secretion system protein [Burkholderia
           thailandensis E264]
 gi|83649924|gb|ABC33988.1| Bacterial type II and III secretion system protein domain protein
           [Burkholderia thailandensis E264]
          Length = 679

 Score =  297 bits (760), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 124/433 (28%), Positives = 216/433 (49%), Gaps = 21/433 (4%)

Query: 42  VEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVIL 101
             +G+   +S+ L K +++ +   V++  + +P  A   + SPRT+YL G +VG  N+I+
Sbjct: 94  GAMGESTSVSVPLGKSLLVPLDEPVRNRTIGNPAVAQATMVSPRTLYLVGMSVGTTNMIV 153

Query: 102 IGHDGKQMLNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRA 160
            G  G     +D+ +  D   L+ +LR+ +    +IRV   +DT+VL G V + Q +Q+A
Sbjct: 154 QGKSGACR-IIDVAVGADAGGLQASLRQLMPRERDIRVSTAADTIVLAGNVSSAQAAQQA 212

Query: 161 VELSETFLSQSGRNQYANSSSKK---VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQH 217
           V +++ +  ++               V+N+L +    QV L+V +AEV + ++ Q+G   
Sbjct: 213 VAIAKAYSDRTNAGALGGGGGGTRAGVLNMLTVTSPQQVMLEVKVAEVSKTLINQMGSAV 272

Query: 218 SITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTL 277
           ++ G     + +         ++  G+       ++      + A      ++ LAEP L
Sbjct: 273 NLQGGFGSWTGALVTSL----LTGVGNGIAVSKSNKLPLNGSIDAQNTDQPVKILAEPRL 328

Query: 278 TAISGQSASFTSGGQHLYKTVSSSTGATSV---TTHDYGVVLHFTPTVLSPGRIGLRIQT 334
             ISGQ A+F +GG+       SS   TS       ++GV L FTPTVLS GRI L++  
Sbjct: 329 VTISGQEATFLAGGKIFIPVPQSSGVGTSTITLQQEEFGVGLKFTPTVLSNGRINLKVAP 388

Query: 335 EVSEPVIGV---------NAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGI 385
           EVSE                  +P    R+A TTV++  G T  + GL+KD+ Q   + +
Sbjct: 389 EVSELSPTGVTLSAANVGGVSILPLITTRRASTTVQMNDGETFAIGGLIKDNAQGTLKAL 448

Query: 386 PLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFF 445
           P + ++P+LGALFR++ F ++ TE+    TP LVKP+A  D+  P D ++  ++A  +  
Sbjct: 449 PGIGELPVLGALFRSTSFQQDRTELVFIITPHLVKPLAAADVPLPTDSFTQPNEADVYAT 508

Query: 446 NRVNKIYGPKEAS 458
             +    G ++  
Sbjct: 509 GNMEGRGGLRQHG 521


>gi|103486617|ref|YP_616178.1| type II and III secretion system protein [Sphingopyxis alaskensis
           RB2256]
 gi|98976694|gb|ABF52845.1| type II and III secretion system protein [Sphingopyxis alaskensis
           RB2256]
          Length = 493

 Score =  297 bits (759), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 127/481 (26%), Positives = 217/481 (45%), Gaps = 34/481 (7%)

Query: 12  MSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLV 71
                 +   ++  +     A  +    +         I + + +  ++ +P  + DV V
Sbjct: 7   FKAAALARTLAIGLVAATLIAAPSRPVAAQAVQNASSSIDLSVGRGRLISLPAAMSDVFV 66

Query: 72  SDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFI 131
           +D   ADV V S R +Y+F K  G+ ++      G+ + +    +  +I  ++  L   +
Sbjct: 67  ADDKVADVQVRSSRQLYVFAKAPGETSIYATDASGRVVFSTVARVGNNIETIDQMLSLAM 126

Query: 132 ADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIA 191
            +++I    ++  V+L G VR+  D+  A  L + F+              KV++ L  A
Sbjct: 127 PEASIAANTMNGFVLLTGTVRSPDDAAEAERLVQAFVGDQT----------KVLSRLRTA 176

Query: 192 GEDQVTLKVTIAEVRRDILKQI---------------GFQHSITGSSSGPSKSFAADFGG 236
              QV L+V IAEV R ++K++               GF   + G     + +  A+   
Sbjct: 177 TPLQVNLQVRIAEVNRSLVKELSGNLLTRDTDGPLGNGFLGGVFGGRQAGTITTDANGNT 236

Query: 237 ----KFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQ 292
                        +  G L        L   ER+  + TLA+P LTAISG++A F +GG+
Sbjct: 237 IYSITTPPGTRSLAGAGRLFGLDLIASLDIGERSGLVATLAQPNLTAISGETADFLAGGE 296

Query: 293 HLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGV----NAGDM 348
                +  +   T++    YGV L +TPTVLS GRI LR++ EVSE             +
Sbjct: 297 FPVP-IPGNFAGTTIEYRKYGVSLAYTPTVLSNGRISLRVRPEVSELSTEGAIEMQGFQI 355

Query: 349 PSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREET 408
           P+  +R+A+TTVEL SG + ++AGLL +      + +P L  +P+LG LF++  F R ET
Sbjct: 356 PALTIRRAETTVELGSGESFMIAGLLNNRSIGAIDKMPGLGDVPLLGTLFKSDSFRRGET 415

Query: 409 EIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGA 468
           E+ I  TP+LV+PV+  D+  P D +   DD +    N+ +      +  +    +  G 
Sbjct: 416 ELVIVVTPYLVEPVSANDIKLPTDAFRDADDLQRLLLNQTSDGVTGGDRPKPRLDSNVGD 475

Query: 469 I 469
            
Sbjct: 476 A 476


>gi|241662165|ref|YP_002980525.1| type II and III secretion system protein [Ralstonia pickettii 12D]
 gi|240864192|gb|ACS61853.1| type II and III secretion system protein [Ralstonia pickettii 12D]
          Length = 603

 Score =  297 bits (759), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 114/488 (23%), Positives = 214/488 (43%), Gaps = 40/488 (8%)

Query: 11  MMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVL 70
           M +                   +A         +    ++++ + K  ++Q+P  V+   
Sbjct: 59  MAASGPIQLTIGSPATAEANRDSAGKGPNCTGPMRSHSEVTVPVGKSTMVQLPEPVRSRT 118

Query: 71  VSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRF 130
           V +P     ++ SP+T+Y+ G  VG  N+I+ G  G     +D+ +  D   L+ TLR+ 
Sbjct: 119 VGNPNVVQAMLVSPQTLYVLGLEVGSTNMIVQGRSGSC-SVVDVAVGADPGGLQSTLRKL 177

Query: 131 IADS-NIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQS------------------ 171
           + ++ N++V   +D++VL G V     +Q+ V+++  F+ +                   
Sbjct: 178 MPEARNVQVSAAADSLVLGGSVSDSVQAQKVVDIANAFVMRRTRGPNEGEQNATGQGGQQ 237

Query: 172 --GRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKS 229
                  A   S +++N++ +    QV L+V +AEV + ++ Q+G   +  G+    S  
Sbjct: 238 LHTAGPGAPLRSPRIINMMTVEAPQQVMLEVKVAEVSKTLIDQMGAAFNANGAFGSWSFG 297

Query: 230 FAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTS 289
             A+    F+S   D       +    +  L A +    ++ LAEP+L AISGQ ASF +
Sbjct: 298 AIAN----FLSGSSDIVNFSKANHLPLKFALDAQKGDGLVKVLAEPSLMAISGQEASFLA 353

Query: 290 GGQHLYKTVSSSTGA----TSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIG--- 342
           GG+        +         +    +GV L FTPTV+  GRI L++  EVSE       
Sbjct: 354 GGKVFIPVAQGAAANGVATIVLQEETFGVGLRFTPTVMENGRINLKVSPEVSELSPTGVA 413

Query: 343 ------VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGA 396
                  N   +P    R+A TT+++  G +  + GL+K++I    + +P + ++PI+G+
Sbjct: 414 VTAPNSNNTSILPLITTRRASTTLQVHDGQSFAIGGLIKNNITGSLKALPGIGELPIIGS 473

Query: 397 LFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKE 456
           L R++ F +++TE+    TP LVKP+       P D +   +  + +    +        
Sbjct: 474 LARSTSFQQDQTELLFVVTPRLVKPL-PAQYPLPTDSFGTINRGELYLNGNMEGHVQAPA 532

Query: 457 ASEVEGQN 464
           +       
Sbjct: 533 SQPTAVAA 540


>gi|329847253|ref|ZP_08262281.1| bacterial type II and III secretion system family protein
           [Asticcacaulis biprosthecum C19]
 gi|328842316|gb|EGF91885.1| bacterial type II and III secretion system family protein
           [Asticcacaulis biprosthecum C19]
          Length = 535

 Score =  297 bits (759), Expect = 4e-78,   Method: Composition-based stats.
 Identities = 147/538 (27%), Positives = 239/538 (44%), Gaps = 77/538 (14%)

Query: 4   LQRTFFTMMSIFLFSSNPSVAKLPPIKEA--------NAAVINISDVEIGKGKKISIGLN 55
            +          L +   + A      +            +   +     + + + +   
Sbjct: 8   SRALLPATALAGLMTLLATGAHATGEPKPYNSLKSGGGGGMAVQTQTSQARVQVLRLPKG 67

Query: 56  KVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDIL 115
           +  ++ +P D  DV VS+P  AD V+ +PR +++ G   GQ++ I     G+Q+LNL I 
Sbjct: 68  RSAVVDLPTDAADVFVSNPAVADAVLRTPRRIFVLGVEGGQSDAIFFDAQGRQILNLSIR 127

Query: 116 IERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQ 175
           +E     L  T+ R    S + V+ ++  VVL G+ +    + +   L+ +++++     
Sbjct: 128 VEAATDELTDTVHRLFPTSKVEVQSLNGRVVLSGLAQNNAQADQIARLAASYVTK----- 182

Query: 176 YANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFG 235
                 + V+NL++IAG+DQVTLKV + EV+R  +KQ+G    I  ++   S S+     
Sbjct: 183 -----PEDVINLMSIAGKDQVTLKVRVIEVQRSAIKQLGLSSDIVYNNGSQSYSYGRGNT 237

Query: 236 GKFVS------------------------------------------------EGGDFSV 247
                                                                     + 
Sbjct: 238 YGTNGTSYGGRGLCYGQNNVVTNNFTDSNSVTDQTAVTLEDTPVVNRTLTATIGSAVNTT 297

Query: 248 KGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSV 307
              L   S  T L A ER   IRTLAEP LTA+SG++A F +GG+          G  +V
Sbjct: 298 WRTLTGSSNATCLQAFERVGLIRTLAEPNLTAVSGEAAKFLAGGEFPVPVAEDDAGRITV 357

Query: 308 TTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVI------GVNAGDMPSYRVRKADTTVE 361
               +GV L FTP VLS GRI ++I TEVSE           +   +P   VR+A+TTVE
Sbjct: 358 EFKPFGVGLGFTPVVLSEGRISMKISTEVSEITNVGAFTSNGSNLTIPGLSVRRAETTVE 417

Query: 362 LPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKP 421
           + SGG++++AGLL+   +Q  + +P ++ +PILG+LFR+  F  E+TE+ +  TP++V P
Sbjct: 418 MQSGGSLMIAGLLQSKYKQSIDSLPGMTSLPILGSLFRSRDFLNEDTELVVMVTPYIVDP 477

Query: 422 VAMRDLSRPDDHYSVEDDAKAFFFNRVNK-IYGPKEASEVEGQNYKGAI----GFIYK 474
           V    L  P D+    DD    F  R+NK + G   A+ V      G      G++ +
Sbjct: 478 VHPDQLQTPADNLEFADDMSTVFMGRLNKVVDGDAVAAGVPASGPTGPYVAPIGYVIE 535


>gi|87199534|ref|YP_496791.1| type II and III secretion system protein [Novosphingobium
           aromaticivorans DSM 12444]
 gi|87135215|gb|ABD25957.1| type II and III secretion system protein [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 517

 Score =  296 bits (758), Expect = 4e-78,   Method: Composition-based stats.
 Identities = 133/476 (27%), Positives = 209/476 (43%), Gaps = 54/476 (11%)

Query: 33  NAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGK 92
           NA        E      + + +NK  ++     +   LV +   ADV+  + R++Y+ GK
Sbjct: 24  NATRAQGITAENLHAGTLEVPVNKSQVVSTDRTIAKALVGNDDIADVLPVTTRSIYVLGK 83

Query: 93  NVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVR 152
            +G  ++ L    G+ +  +D+ +  D+  L   L+ F+ +  I   + +D +VL G+V 
Sbjct: 84  KMGTTSLTLYDATGRVLSIMDVAVGPDVEGLRSQLKTFVPNDKIDARLSNDAIVLSGLVN 143

Query: 153 TIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQ 212
                 RAV+L+ T+               KV+NL+++    QV L+V  AEV R     
Sbjct: 144 DPGAIDRAVQLARTYAG------------DKVVNLISLGSSQQVMLEVKFAEVNRTAGFD 191

Query: 213 IGFQHSITGSSS------------GPSKSFAADFGGKFVSEG----------------GD 244
           +G     +  +             G   + + + GG   S                  G 
Sbjct: 192 VGVSGFASKGTFESAIGKGAQLVPGADVTVSGNSGGVSTSTTIPGASILKLSSITGSFGI 251

Query: 245 FSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGA 304
           F     +D    + VL+ALE     +TLA+PTL A+SG+ ASF +GG+     V S T  
Sbjct: 252 FRKSFSIDGLGIDAVLNALETKGMAKTLAQPTLLALSGERASFLAGGEFPVPVVQSGTTG 311

Query: 305 T--------SVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIG----VNAGDMPSYR 352
           T        +V    +GV L FTPTVL    I L ++ EVS         V +  +P  R
Sbjct: 312 TGNGNGGAITVEFKPFGVSLGFTPTVLGDKTINLLVEPEVSAIDPTASLTVGSITIPGLR 371

Query: 353 VRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFI 412
            R+A TT+EL  G +  +AGLL+ D +   + +PLL  +PI+G+LFR+S F++ ETE+ I
Sbjct: 372 TRRASTTLELRDGESFAIAGLLQKDFKTSVQQLPLLGSLPIIGSLFRSSAFSKGETELLI 431

Query: 413 AATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGA 468
             TP LV P+    +  P D  +    A   F       +G K A           
Sbjct: 432 VVTPRLVSPIKPEQVRLPTDAVTDPSAASTIFLG--EPSFGKKLAPTKPQDGSAAP 485


>gi|153006805|ref|YP_001381130.1| type II and III secretion system protein [Anaeromyxobacter sp.
           Fw109-5]
 gi|152030378|gb|ABS28146.1| type II and III secretion system protein [Anaeromyxobacter sp.
           Fw109-5]
          Length = 490

 Score =  296 bits (758), Expect = 5e-78,   Method: Composition-based stats.
 Identities = 128/503 (25%), Positives = 215/503 (42%), Gaps = 55/503 (10%)

Query: 8   FFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQ 67
                   L +   +       ++A A      D E+G  +++S+   +  +L +   + 
Sbjct: 2   IPHRARALLVTLLVAAGPAVAQEQAQATPALRIDREMGAAREMSLEAGQNRLLIISEQIA 61

Query: 68  DVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTL 127
            + V++P  AD+ V +P  + L  K VG  ++ L   D + +  + + + R++  L   +
Sbjct: 62  RIAVANPDVADLKVVTPTQVLLTAKGVGTTDLTLWNRDNQPL-VIALQVGRNLEALRTQV 120

Query: 128 RRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNL 187
           ++     N+++    D VVL G V  ++  +R  E++                ++KV NL
Sbjct: 121 KQLFPGENVKITASGDLVVLSGEVTDVRLPERVAEVAR-------------LHAEKVANL 167

Query: 188 LNIAGEDQVTLKVTIAEVRRDILKQIGFQH----------SITGSSSGPSKSFAADFGGK 237
           + ++G  QV L+V  AEV R  L+++G                 S+      F       
Sbjct: 168 IQVSGVQQVQLQVRFAEVARGGLRELGVNLFHKSDDFRTVGGLFSNRTLPGEFLNTNQNP 227

Query: 238 FVSEGGDFSVKGVL---------------------DRFSFETVLHALERATAIRTLAEPT 276
            +   G   + G                       D F F  +L  LE+    ++LAEPT
Sbjct: 228 SIPGTGPRGLAGNGFPPDVPAPAFQNAFSVFLSRMDDFPFSVMLSLLEQNNLAKSLAEPT 287

Query: 277 LTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEV 336
           L A+SGQ A F +GG+       SS G TSV    +G+ L FTPTV+    I L ++TEV
Sbjct: 288 LVALSGQGARFLAGGELPIPLA-SSFGQTSVEWKRFGIQLEFTPTVIGD-AIHLTMKTEV 345

Query: 337 SEPVI----GVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIP 392
           S+        +    +P    R+++T++ L  G +  +AGL+ D I+     +P +  IP
Sbjct: 346 SDIDPSLAVTIAGTSVPGLTSRQSETSIRLADGQSFAIAGLVSDRIRSQVAKVPFIGSIP 405

Query: 393 ILGALFRNSRFNREETEIFIAATPFLVKPVAMRDL-SRPDD-HYSVEDDAKAFFFNRVNK 450
           ILGALFR+  F R+E+E+ +  T  LVKPVA  +L   P +   +   D   +      K
Sbjct: 406 ILGALFRSQAFQRDESELIVVVTAHLVKPVAPHELPPLPTEYEMNDPGDLPFYLLGSQGK 465

Query: 451 IY--GPKEASEVEGQNYKGAIGF 471
                 K       +   G  GF
Sbjct: 466 SAQIAEKRQPASPERGPSGQSGF 488


>gi|167566934|ref|ZP_02359850.1| outer membrane protein [Burkholderia oklahomensis EO147]
          Length = 550

 Score =  296 bits (757), Expect = 7e-78,   Method: Composition-based stats.
 Identities = 124/429 (28%), Positives = 216/429 (50%), Gaps = 22/429 (5%)

Query: 42  VEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVIL 101
            E+ +   +S+ L K +++ +   V++  + +P  A   + SPRT+YL G +VG  N+I+
Sbjct: 92  GEMREATSVSVPLGKSLLVPLDEPVRNRTIGNPAVAQATMVSPRTLYLVGLSVGTTNMIV 151

Query: 102 IGHDGKQMLNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRA 160
            G  G     +D+ +  D   L+ +LR+ +    +IRV   +DT+VL G V   Q +Q+A
Sbjct: 152 QGRSGAC-QIIDVAVGADAGGLQTSLRQLMPAERDIRVSTAADTIVLAGNVSDAQAAQQA 210

Query: 161 VELSETFLSQSGRNQYANSSSKK----VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQ 216
           V +++ +  ++     A + +      V+N+L +    QV L+V +AEV + ++ Q+G  
Sbjct: 211 VAIAKAYSDRTNVGPGAGAGAGGPRGGVLNMLTVTSPQQVLLEVKVAEVSKTLINQMGSA 270

Query: 217 HSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPT 276
            +I G     +    +          G+       ++  F+  L A      ++ LAEP 
Sbjct: 271 INIQGGFGSWTGMLVSSLLAGV----GNGIAASKSNKLPFKAALDAQNTDQPVKILAEPR 326

Query: 277 LTAISGQSASFTSGGQ---HLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQ 333
           L  ISGQ A+F +GG+    + ++  + T   ++   ++GV L FTPTVLS GRI L++ 
Sbjct: 327 LVTISGQEATFLAGGKIFIPVPQSSGTGTTTITLQEEEFGVGLKFTPTVLSNGRISLKVA 386

Query: 334 TEVSEPVIG---------VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEG 384
            EVSE                  +P    R+A TTV++  G T  + GL+KD+ Q     
Sbjct: 387 PEVSELSPTGVTLSATNVSGVSILPLITTRRASTTVQMGDGETFAIGGLIKDNAQGTLRA 446

Query: 385 IPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFF 444
           +P + +IP+LGALFR++ F ++ TE+    TP LVKP+   D+  P D ++  ++   + 
Sbjct: 447 LPGIGEIPVLGALFRSTSFQQDRTELVFIITPHLVKPLETADVPLPTDSFTKPNEVDVYA 506

Query: 445 FNRVNKIYG 453
              +    G
Sbjct: 507 TGNMEGRGG 515


>gi|17545374|ref|NP_518776.1| outer membrane channel protein [Ralstonia solanacearum GMI1000]
 gi|17427666|emb|CAD14185.1| probable pilus assembly protein, secretin cpac [Ralstonia
           solanacearum GMI1000]
          Length = 634

 Score =  296 bits (757), Expect = 7e-78,   Method: Composition-based stats.
 Identities = 115/496 (23%), Positives = 222/496 (44%), Gaps = 53/496 (10%)

Query: 17  FSSNPSVAKLPPIKEANAAVINIS-----DVEIGKGKKISIGLNKVIILQVPVDVQDVLV 71
            ++N  +        A+ A  N          +    ++++ + K  ++Q+   V+   V
Sbjct: 60  MAANGPIQLTIGSARADTARENTVKGPNCTGPMRDHSEVTVPVGKSTMVQLTEPVRSRTV 119

Query: 72  SDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFI 131
            +P     ++ SP+T+YL G++VG  N+I+ G  G     +D+ +  D   L+ TL   +
Sbjct: 120 GNPNIVQAMLVSPQTLYLLGQDVGTTNMIVQGRSGSC-SVIDVSVGADPGGLQATLHALM 178

Query: 132 ADS-NIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSK-------- 182
            ++  +RV   +D++VL G V     +Q+ ++++  F+ +  R    +  +         
Sbjct: 179 PEASRVRVSAAADSLVLGGTVSDSVQAQKIIDIANAFVMRETRGPAQSGQTGTMGMQGMT 238

Query: 183 ---------------------KVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITG 221
                                +++N++++    QV L+V +AEV + ++ Q+G   ++  
Sbjct: 239 AMSTGNAATASSGSGEAVRNPRIINMMSVEAPQQVMLEVKVAEVSKTLINQMGAALNL-- 296

Query: 222 SSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAIS 281
             +G   S+       F+S   D       ++  F+  + A +    ++ LAEP L AIS
Sbjct: 297 --NGSFGSWTFGALANFLSGAPDIFSADKANKLPFQLRVDAQKGDGLVKVLAEPNLMAIS 354

Query: 282 GQSASFTSGGQHLYKTVSS---STGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE 338
           GQ ASF +GG+       S    T    +    +GV L FTPTVL  GRI L++  EVSE
Sbjct: 355 GQEASFLAGGKVYIPVPQSFGTGTTTILLQEETFGVGLRFTPTVLENGRINLKVAPEVSE 414

Query: 339 PVIG---------VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLS 389
                             +P    R+A TT+++  G +  + GL+K ++    + IP + 
Sbjct: 415 LSPTGVAVTAPNVSGTSILPLITTRRASTTLQVHDGQSFAIGGLIKSNVTGSLKAIPGVG 474

Query: 390 KIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVN 449
           ++P++GAL R++ F +++TE+    TP LVKP+   +   P D +   +  + +    + 
Sbjct: 475 ELPVIGALARSTSFQQDQTELLFVVTPHLVKPL-PANYPMPTDSFGPVNQGEVYLNGNME 533

Query: 450 KIYGPKEASEVEGQNY 465
                + A      ++
Sbjct: 534 GHPASRPAPAPTQGSF 549


>gi|309780760|ref|ZP_07675501.1| type II and III secretion system protein:Transport-associated
           [Ralstonia sp. 5_7_47FAA]
 gi|308920442|gb|EFP66098.1| type II and III secretion system protein:Transport-associated
           [Ralstonia sp. 5_7_47FAA]
          Length = 603

 Score =  295 bits (756), Expect = 7e-78,   Method: Composition-based stats.
 Identities = 113/480 (23%), Positives = 212/480 (44%), Gaps = 40/480 (8%)

Query: 19  SNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKAD 78
                         +A         +    ++++ + K  ++Q+P  V+   V +P    
Sbjct: 67  LTIGSPASAEANRDSAGKGPNCTGPMRSHSEVTVPVGKSTMVQLPEPVRSRTVGNPNVVQ 126

Query: 79  VVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADS-NIR 137
            ++ SP+T+Y+ G  VG  N+I+ G  G     +D+ +  D   L+ TLR+ + ++ N++
Sbjct: 127 AMLVSPQTLYVLGLEVGSTNMIVQGRSGSC-SVVDVAVGADPGGLQSTLRKLMPEARNVQ 185

Query: 138 VEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQS--------------------GRNQYA 177
           V   +D++VL G V     +Q+ V+++  F+ +                          A
Sbjct: 186 VSAAADSLVLGGSVSDSVQAQKVVDIANAFVMRRTRGPNEGDQNATGQGGQQLHTAGPGA 245

Query: 178 NSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGK 237
              S +++N++ +    QV L+V +AEV + ++ Q+G   +  G+    S    A+    
Sbjct: 246 PLRSPRIINMMTVEAPQQVMLEVKVAEVSKTLIDQMGAAFNANGAFGSWSFGAIAN---- 301

Query: 238 FVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKT 297
           F+S   D       +    +  L A +    ++ LAEP+L AISGQ ASF +GG+     
Sbjct: 302 FLSGSSDIVNFSKANHLPLKFALDAQKGDGLVKVLAEPSLMAISGQEASFLAGGKVFIPV 361

Query: 298 VSSSTGA----TSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIG---------VN 344
              +         +    +GV L FTPTV+  GRI L++  EVSE              N
Sbjct: 362 AQGAAANGVATIVLQEETFGVGLRFTPTVMENGRINLKVSPEVSELSPTGVAVTAPNSNN 421

Query: 345 AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFN 404
              +P    R+A TT+++  G +  + GL+K++I    + +P + ++PI+G+L R++ F 
Sbjct: 422 TSILPLITTRRASTTLQVHDGQSFAIGGLIKNNITGSLKALPGIGELPIIGSLARSTSFQ 481

Query: 405 REETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQN 464
           +++TE+    TP LVKP+       P D +   +  + +    +        +       
Sbjct: 482 QDQTELLFVVTPRLVKPL-PAQYPLPTDSFGTINRGELYLNGNMEGHVQAPASQPTAVAA 540


>gi|209546483|ref|YP_002278401.1| type II and III secretion system protein [Rhizobium leguminosarum
           bv. trifolii WSM2304]
 gi|209537727|gb|ACI57661.1| type II and III secretion system protein [Rhizobium leguminosarum
           bv. trifolii WSM2304]
          Length = 495

 Score =  295 bits (756), Expect = 8e-78,   Method: Composition-based stats.
 Identities = 127/495 (25%), Positives = 218/495 (44%), Gaps = 35/495 (7%)

Query: 1   MRYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKG-KKISIGLNKVII 59
           M   +R      S+   ++  S         A  A      V +GK  +++++  N  + 
Sbjct: 1   MANGKRRIARTKSLAALAAVFSACVCLGPGFAGCANAQEKSVTLGKSVQRVTLPPNATLT 60

Query: 60  LQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERD 119
           L       D+++      DVV  S +++++ GK +G  N+ + G D   +  +D+ +  D
Sbjct: 61  LNTGQAFGDLVIGSADMIDVVPLSDKSLFIRGKKIGATNISVYGDDKSLLGVIDVRVASD 120

Query: 120 IAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANS 179
            + +   +R     + + V   SD + L G+VR   + QR +++++++            
Sbjct: 121 FSEVAAAIRSAAPSARVIVANSSDRIRLTGIVRDGVELQRVMDIAQSY------------ 168

Query: 180 SSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFG---- 235
           S + V+N L ++   QV L+V + E  R   + +G   S  G++     + +   G    
Sbjct: 169 SDQPVLNQLRVSDSQQVMLEVRVIEASRQTGRDLGIGWSGRGNNGIGKATTSQGLGVDDN 228

Query: 236 --------------GKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAIS 281
                            +  G   +    +     + V++ALE+   +R LA+P L A+S
Sbjct: 229 GSLVRTLVDPKGAATGALPFGQLIAKVLEISGGHIDVVINALEQKGLVRRLAQPNLIAMS 288

Query: 282 GQSASFTSGGQHL--YKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEP 339
           G +ASF +GG+      T + +T AT      +GV L F P VL  G I L I+ EVSE 
Sbjct: 289 GSTASFHAGGEVPILKTTNNGTTVATETDYRPFGVRLTFKPVVLDDGLINLEIEPEVSEL 348

Query: 340 VIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFR 399
              +N    P +  R A TTV L  G +  LAGLL+    +  + +P L KIPILGALFR
Sbjct: 349 DPSINVNGNPGFISRAASTTVALRDGQSFALAGLLQSINAKDIQQLPGLGKIPILGALFR 408

Query: 400 NSRFNREETEIFIAATPFLVKPVAM-RDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEAS 458
           ++ F ++E+++ I  TP +V+P     DL  P D     +D + F    +  +       
Sbjct: 409 STSFQKKESDLVIVVTPHIVRPARPGEDLYSPLDQTRSSNDVELFALGVLE-VDKDMLRR 467

Query: 459 EVEGQNYKGAIGFIY 473
              G+   G  G   
Sbjct: 468 FRNGEGVTGPYGHRL 482


>gi|87312292|ref|ZP_01094390.1| putative outer membrane channel for pilus assembly CpaC
           [Blastopirellula marina DSM 3645]
 gi|87284996|gb|EAQ76932.1| putative outer membrane channel for pilus assembly CpaC
           [Blastopirellula marina DSM 3645]
          Length = 534

 Score =  295 bits (756), Expect = 8e-78,   Method: Composition-based stats.
 Identities = 123/471 (26%), Positives = 205/471 (43%), Gaps = 27/471 (5%)

Query: 11  MMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVL 70
           M S  +     ++A      +   AV N++       +++ + +N   I  +   +    
Sbjct: 1   MYSYGVACLLIAIATPAANAQDMGAVPNVNFKVDAPNQRLEMMVNSSRIFTLDEKIPKAQ 60

Query: 71  VSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRF 130
           V++P    +   SP  + +     G   V L   DG  +  +DI++  D   L++ L   
Sbjct: 61  VNNPDLLRLTPLSPNKIQVSALKPGVTQVNLWNEDG-TIHTIDIIVIGDGRELQLLLETE 119

Query: 131 IADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNI 190
             +S+I+V  ++ +VVL G V   +   R V ++E +               KV+N + +
Sbjct: 120 FPNSSIKVRPLASSVVLSGYVDRPEAVSRIVAMAEDYYP-------------KVINNITV 166

Query: 191 AGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKS----------FAADFGGKFVS 240
            G  QV LKV + EV R  L+++G   +  GS    S +            +       +
Sbjct: 167 GGVQQVMLKVKVYEVSRTKLRRLGIDWAAIGSDYFISSTAANVLTPAGVLTSGARDALGA 226

Query: 241 EGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSS 300
            G       +     F   L AL +    +  AEPTLT ISG+ ASF SGG+   + V+S
Sbjct: 227 TGQTVQFGVLGSSTQFFGFLDALRQNNVAKLSAEPTLTTISGRPASFLSGGEVPIQ-VAS 285

Query: 301 STGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGDMPSYRVRKADTTV 360
             G TS+    YG  + F P VL  G + L ++ EVSEP   V     P +R+R  DT V
Sbjct: 286 GLGTTSIEYKQYGTRVDFVPIVLGNGNLKLEVRPEVSEPDYSVAINGTPGFRLRWVDTAV 345

Query: 361 ELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVK 420
           E+ +G +  LAGL+++ I+    G+P L+ +P +GA FR +  +R E E+ I  TP LV 
Sbjct: 346 EMKAGQSFALAGLIQEKIETETRGLPYLADLPWVGAAFRRNTDSRNEVELLIIVTPELVG 405

Query: 421 PVAMRDLS--RPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAI 469
            +   ++    P  +  +  D + +    V     P   + +      G  
Sbjct: 406 ALNPEEVPCEYPGSNTGITTDCELYGRGYVEVPACPPGGACISEPGMIGPY 456


>gi|329890996|ref|ZP_08269339.1| bacterial type II and III secretion system family protein
           [Brevundimonas diminuta ATCC 11568]
 gi|328846297|gb|EGF95861.1| bacterial type II and III secretion system family protein
           [Brevundimonas diminuta ATCC 11568]
          Length = 522

 Score =  295 bits (755), Expect = 9e-78,   Method: Composition-based stats.
 Identities = 136/507 (26%), Positives = 248/507 (48%), Gaps = 70/507 (13%)

Query: 28  PIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTM 87
              +   A    +       + +++       + +P D +DV++S+P  A+ ++HSPR +
Sbjct: 26  AASDGARAQTRAAITAGSAPQMVNLPRGTSFAVDLPADARDVIISNPAVAEAMLHSPRRI 85

Query: 88  YLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVL 147
            + G   G+ + + +   G+ +L L + ++  ++ L+ TL R    SN+R E V+D+++L
Sbjct: 86  TMIGLAGGETDAVFLDASGRTILALRVRVDAGVSALQDTLARVAPGSNVRAEAVNDSIIL 145

Query: 148 HGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRR 207
            G+  +  +++RA +++  F+          S+ +KVMN++ +AG DQVTLKV + EV+R
Sbjct: 146 TGVAASPLEAERAAQVARAFV----------SAPEKVMNMIAVAGSDQVTLKVRVVEVQR 195

Query: 208 DILKQIGFQHSI-------------TGSSSGPSKSFAADFGGKFVSEGG----------- 243
           + +KQ+GF                   ++ G + SF     G    +             
Sbjct: 196 NAIKQLGFDTQAVIGRVGDTQWLLGNSATWGVNGSFLGGLAGGIARDTTKNFQMQVPCVG 255

Query: 244 ---------------------------DFSVKGVLDRFSFETVLHALERATAIRTLAEPT 276
                                        +  G       E +L A ER   +RTLAEP 
Sbjct: 256 PGWPEGAMCPVTVDGSPGDPSNWDTAKPGTGPGSDGLNKGEAMLKAFERVGLVRTLAEPN 315

Query: 277 LTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEV 336
           LT+++G++ASF +GG+          G  +V    YGV L F P VLS GRI L+++ EV
Sbjct: 316 LTSVNGEAASFLAGGEFPVPAGRDREGQITVEYKPYGVGLSFRPVVLSEGRISLQVKVEV 375

Query: 337 SEPVI---------GVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPL 387
           SE              ++  +P   VR+++ T+ELPSGG++++AGLL++  +Q  + +P 
Sbjct: 376 SELTPNGGLTIGAGTPSSITLPGLTVRRSENTIELPSGGSMMIAGLLQESTRQAIDALPG 435

Query: 388 LSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNR 447
           ++ +P+LG LFR+  +   ETE+ +   P++V P +   +  P D   +  DA+  FF +
Sbjct: 436 MTNLPVLGQLFRSRDYVMGETELVVIVEPYIVNPTSPDRMQTPADGLRIAQDAQTIFFGQ 495

Query: 448 VNKIYGPKEASEVEGQNYKGAIGFIYK 474
           +N++YG    +   G  ++G +G++ +
Sbjct: 496 LNQVYGSPAPAAQPGAGWRGPVGYVIE 522


>gi|319782173|ref|YP_004141649.1| type II and III secretion system protein [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317168061|gb|ADV11599.1| type II and III secretion system protein [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 481

 Score =  295 bits (755), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 116/457 (25%), Positives = 195/457 (42%), Gaps = 32/457 (7%)

Query: 34  AAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKN 93
            A     DV      +I + +++ + +QV  ++ D++V D   AD    + RT+Y+ GK 
Sbjct: 27  DAADRFIDVSTPAVHRIFLPMSQSVTIQVSANLGDIVVGDEKIADAQPMTDRTLYVIGKG 86

Query: 94  VGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRT 153
            G   V L   D + +  L I +  D++ +   +R+    S I V  V+  V L G V+ 
Sbjct: 87  AGTTTVNLFSTDKRSLGALQIEVGVDVSDMAQAIRQVAPKSRIEVGSVNGRVRLGGHVKD 146

Query: 154 IQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQI 213
                  + +++ +                V+N + +    QV L+V + E +R+  + +
Sbjct: 147 GATLAAIMAVAQQY------------GPDAVINSVIVDDSQQVNLEVRVLEAKRNTGRDL 194

Query: 214 GFQHSITGSSSGPSKSFAADF----------------GGKFVSEGGDFSVKGVLDRFSFE 257
           G                                         +  G    + +      +
Sbjct: 195 GVSIKSRNGDGTTRTGTGVAAVDEDGVVLGPGGLLSGLLSNSAPFGALITRVIDSNIKVD 254

Query: 258 TVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLH 317
            ++ ALE   A+RTLA P LT +SG+ ASF +GG+          G  S+    +GV L 
Sbjct: 255 LIIEALESKGAVRTLANPNLTTLSGEQASFNAGGEVP-IRTLDKDGEISIVYKQFGVNLL 313

Query: 318 FTPTVLSPGRIGLRIQTEVSEPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDD 377
           FTP VL  G+I + +  EVS+      AGD P +  RK  T VEL  G +  + GLL   
Sbjct: 314 FTPVVLDDGKIHMNLAPEVSDLTGFTTAGD-PIFTNRKLATVVELRDGQSFAVGGLLSSK 372

Query: 378 IQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAM-RDLSRPDDHYSV 436
             +L++ +P L ++P++G LFR+S   +EETE+ +  TP +V+PV     L+ P D    
Sbjct: 373 TTKLQDQVPWLGQVPVIGTLFRSSSNQKEETELVVIVTPHIVRPVKPGEQLATPFDKTRP 432

Query: 437 EDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIY 473
            +D + F   ++          E  G+   G  G + 
Sbjct: 433 ANDPEFFVLGQLEVTKDMVRKYET-GEGVTGPYGHML 468


>gi|217978832|ref|YP_002362979.1| type II and III secretion system protein [Methylocella silvestris
           BL2]
 gi|217504208|gb|ACK51617.1| type II and III secretion system protein [Methylocella silvestris
           BL2]
          Length = 530

 Score =  295 bits (754), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 133/486 (27%), Positives = 213/486 (43%), Gaps = 38/486 (7%)

Query: 24  AKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHS 83
             L   + A +   +    E  + +++++   K    ++       +V     ADV+  S
Sbjct: 42  MGLAETQPAKSQAGSTIQYEPAQVRRVAVTRYKSRTFRMETPFSSAVVGSADIADVLPMS 101

Query: 84  PRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSD 143
            R +Y+ GK VG  NV +   D K +  +D+ +  DI ++   +R       IRV   +D
Sbjct: 102 DRVIYIQGKRVGTTNVSIFDKDKKLIGVIDLEVTLDIQNIAAKVRSGTDSRGIRVSSNND 161

Query: 144 TVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIA 203
            +VL G  R   D+ RAV ++++ +  +   +  +   K V+N +++A   QV L+V   
Sbjct: 162 QIVLSGEARNAVDADRAVSIAKSMV-TTADGKPPDDPGKFVINAMSVAAAQQVLLRVRFV 220

Query: 204 EVRRDILKQIGFQHSITGSSSGPSKSFAAD---------------------------FGG 236
           EV R   + IG       + +  +     +                            GG
Sbjct: 221 EVNRIAERDIGVNWFGAANKTQTAGVNTGNGIASQVGQSLTPTPGGIPLFQTLATLVPGG 280

Query: 237 KFVSEGGDFSVKGV-LDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLY 295
              +    F V  + L   + + ++ ALE+    R LAEP L A+SG +ASF +GG++  
Sbjct: 281 LASTGSLPFGVGLIKLAGGNVDLLISALEKKGQARRLAEPDLIALSGDTASFLAGGEYPV 340

Query: 296 KTVSSSTGATSV---TTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGDM 348
            +V SS+G T V     + YGV L F PTVL+ G I LR+   VSE     V+      +
Sbjct: 341 PSVQSSSGTTPVITTQYYPYGVQLTFIPTVLANGIINLRLNPSVSELDYKNVVVTAGFAI 400

Query: 349 PSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREET 408
           PS   R+A TT+EL  G +  +AGLL+ D       IP L  +P+LGALF +  + + ET
Sbjct: 401 PSITKREARTTIELRDGQSFAIAGLLQSDSTHDVNQIPWLGSVPVLGALFSSKSYQQNET 460

Query: 409 EIFIAATPFLVKPVAMRD-LSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKG 467
           ++ +  TP LV P A    ++ P D     +D   F   R        +     G    G
Sbjct: 461 DLVVIVTPHLVAPAAPGQVVATPFDKTLPANDVDFFVMGRPEVRKQYTD-YVTSGGGLTG 519

Query: 468 AIGFIY 473
             G I 
Sbjct: 520 PYGDIM 525


>gi|295690798|ref|YP_003594491.1| type II and III secretion system protein [Caulobacter segnis ATCC
           21756]
 gi|295432701|gb|ADG11873.1| type II and III secretion system protein [Caulobacter segnis ATCC
           21756]
          Length = 564

 Score =  294 bits (753), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 150/521 (28%), Positives = 231/521 (44%), Gaps = 90/521 (17%)

Query: 33  NAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGK 92
           N  V  +          + +   K  I+++P DV+D+LV+ PT AD V+   R +Y+ G 
Sbjct: 55  NGQVARVVLTADQTAATLELAKGKSAIVELPADVRDLLVTSPTVADAVLRDRRRVYIVGL 114

Query: 93  NVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVR 152
             G  +       G+++L+L I + + +  L  TL R + D+ I V  + D+VVL G VR
Sbjct: 115 AEGVTDAAFFDDAGRRILSLSIKVSQPVDQLADTLSRVLPDAKIEVRPIRDSVVLSGTVR 174

Query: 153 TIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILK- 211
           +   S  A  ++  ++              KV+N+L+IAG+DQV L+V I EVRR+++K 
Sbjct: 175 SPAQSDAAARIAAQYVGG----------PDKVLNMLSIAGKDQVMLQVRIVEVRRNVIKQ 224

Query: 212 ----------QIGFQHSITGSSSGPSKSFAADFGG------------------------- 236
                     Q+G      G S   S +     G                          
Sbjct: 225 LGVDLNAVLGQLGQSQYSFGLSPTYSVNGNLLGGVTGGYKLDTTKQPTLQIPCGNGVGDA 284

Query: 237 --------------------------KFVSEGGDFSVKGVLDRFSFETVLHALERATAIR 270
                                                 G       + ++ A ER   +R
Sbjct: 285 KCLAVVHGKVYHTGVIDPTTGREIVVGNGDTATISDTAGSTGVNQAKGMIQAFERVGLVR 344

Query: 271 TLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGL 330
           TLAEP LTA+SG++  F  GG+    T S +TG  ++    YGV L +TP V+S GRI L
Sbjct: 345 TLAEPNLTAVSGEAGHFLVGGEFPVPTGSDATGKIAIEFKPYGVGLGYTPVVMSGGRISL 404

Query: 331 RIQTEVSEPVI-----------------GVNAGDMPSYRVRKADTTVELPSGGTIVLAGL 373
           +I TEVSE                          +P   VR+A+TTVELPSGG+ ++AGL
Sbjct: 405 KISTEVSELSSLGAFTISNSTTSGNTTTTSAPLTVPGLSVRRAETTVELPSGGSFMIAGL 464

Query: 374 LKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDH 433
           L+   +Q  + +P ++ +PILG+LFR+  F   ETE+ I  TP++V P   RDL  P D 
Sbjct: 465 LQQTTKQAIDALPGMTNMPILGSLFRSRDFLNGETELVIIVTPYIVDPAKPRDLQTPADG 524

Query: 434 YSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
             +  D       R+N++          G+ Y+G +G++ +
Sbjct: 525 LRMAGDMSTVLLGRLNQVVKAPP-GANAGRAYQGPVGYVIE 564


>gi|13475294|ref|NP_106858.1| type II secretion system protein [Mesorhizobium loti MAFF303099]
 gi|14026045|dbj|BAB52644.1| type II secretion system protein [Mesorhizobium loti MAFF303099]
          Length = 432

 Score =  294 bits (753), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 129/451 (28%), Positives = 205/451 (45%), Gaps = 26/451 (5%)

Query: 31  EANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLF 90
             +      +   I     +S  L K   + +P     + V+DPT AD    S  T+++F
Sbjct: 1   MQDQGAPRAASNSIDGTLNLSSSLGK--TVHLPAPATTIFVADPTIADYQAASNTTIFVF 58

Query: 91  GKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGM 150
           GK  G+ ++  +   G+ +  L I++ + I  L   L   + DS+I+V       +L G 
Sbjct: 59  GKKSGRTSLFALDDKGEALAALRIVVTQPIEELRAMLMDQVGDSSIQVSYTPRGAILSGT 118

Query: 151 VRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDIL 210
               + +  A  ++E +L              +V+N + +AG  QV L V +AEV R  +
Sbjct: 119 APNAEVADTAKRVTEQYLGDGA----------QVVNNIKVAGSLQVNLSVRVAEVSRSAM 168

Query: 211 KQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRF--SFETVLHALERATA 268
           K +G   S  G          +  G    +  G  +     +    +   VL AL +   
Sbjct: 169 KALGVNLSAFGQIDNFRVGLLSGGGTGSGAAQGGGTAGIGFNNGAVNIGAVLDALAKEHI 228

Query: 269 IRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRI 328
              LAEP LTA+SG++ASF +GG+     V       SV    +GV L F PTVL+  RI
Sbjct: 229 ASVLAEPNLTAMSGETASFLAGGEFPIP-VLQENKQVSVEFRHFGVSLEFVPTVLNNNRI 287

Query: 329 GLRIQTEVSEPV----IGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEG 384
            + ++ EVSE      + +N   +P+   R+ADT VEL SG +  + GL++ ++      
Sbjct: 288 NIHVKPEVSELSSQGAVQINGISVPAVSTRRADTVVELASGQSFAIGGLIRRNVNNNVSA 347

Query: 385 IPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKP-VAMRDLSRPDDHYSVEDDAKAF 443
            P L ++PILGALFR+S F +EE+E+ I  TP++VKP  +   +S P D  +   D    
Sbjct: 348 FPWLGEMPILGALFRSSSFQKEESELIILVTPYIVKPGSSPNQMSAPTDRMAPALDDP-- 405

Query: 444 FFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
                +   G   A        +G  GFI +
Sbjct: 406 ---PADPPRGRAAARTGAPGAKRGR-GFIIQ 432


>gi|167924333|ref|ZP_02511424.1| Putative phospholipid-binding domain family protein [Burkholderia
           pseudomallei BCC215]
          Length = 438

 Score =  294 bits (753), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 122/428 (28%), Positives = 218/428 (50%), Gaps = 20/428 (4%)

Query: 44  IGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIG 103
           + +   +S+ L K +++ +   V++  + +P  A   + SPRT+YL G +VG  N+I+ G
Sbjct: 1   MRESTSVSVPLGKSLLVPLDEPVRNRTIGNPAVAQATMVSPRTLYLVGMSVGTTNMIVQG 60

Query: 104 HDGKQMLNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRAVE 162
             G     +D+ +  D   L+ +LR+ +    +IRV   +DT+VL G V + Q +Q+AV 
Sbjct: 61  KSGACR-IIDVAVGADAGGLQASLRQLMPRERDIRVSTAADTIVLAGNVSSAQAAQQAVA 119

Query: 163 LSETFLSQSGRNQYANSSSKK--VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSIT 220
           +++ + +++      +    +  V+N+L +    QV L+V +AEV + ++ Q+G   +I 
Sbjct: 120 IAKAYSNRTNAGAAGSGGGARADVLNMLTVTSPQQVMLEVKVAEVSKTLINQMGSAVNIQ 179

Query: 221 GSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAI 280
           G     + +         ++  G        ++      + A      ++ LAEP L  I
Sbjct: 180 GGFGSWTGALVTSL----LTGVGSGIAASKSNKLPLNGSIDAQNTDQPVKILAEPRLVTI 235

Query: 281 SGQSASFTSGGQHLYKTVSSS---TGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS 337
           SGQ A+F +GG+       SS   T   ++   ++GV L FTPTVLS GRI L++  EVS
Sbjct: 236 SGQEATFLAGGKIFIPVPQSSGIGTNTITLQEEEFGVGLKFTPTVLSNGRISLKVAPEVS 295

Query: 338 EPVIGV---------NAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLL 388
           E              N   +P    R+A TTV++  G T  + GL+KD+ Q   + +P +
Sbjct: 296 ELSPTGVTLSAANVGNVSILPLITTRRASTTVQMGDGETFAIGGLIKDNAQGTLKALPGI 355

Query: 389 SKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRV 448
            ++P+LGALFR++ F ++ TE+    TP LV+P+   D+  P D ++  ++A  +    +
Sbjct: 356 GELPVLGALFRSTSFQQDRTELVFIITPHLVQPLETADVPLPTDSFTKPNEADVYATGNM 415

Query: 449 NKIYGPKE 456
               G ++
Sbjct: 416 EGRGGLRQ 423


>gi|307726375|ref|YP_003909588.1| type II and III secretion system protein [Burkholderia sp.
           CCGE1003]
 gi|307586900|gb|ADN60297.1| type II and III secretion system protein [Burkholderia sp.
           CCGE1003]
          Length = 616

 Score =  294 bits (753), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 117/466 (25%), Positives = 209/466 (44%), Gaps = 27/466 (5%)

Query: 15  FLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDP 74
              S N +  +     ++ AA            + + + + K  ++     V++  + +P
Sbjct: 56  MTISMNAAPPQPASAMQSAAARGPACTRTQSDQRTVVVPVGKSTLMPTAEPVRNRTLGNP 115

Query: 75  TKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADS 134
             A   + SP+T+Y+ G  VG  N+I+ G  G     +++++  D   L+ +L + + D 
Sbjct: 116 LVAQATMVSPQTLYVVGMAVGTTNMIVQGKSGAC-EVINVVVNADSGGLQTSLSQLMPDE 174

Query: 135 -NIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQS--------GRNQYANSSSKKVM 185
            NIRV  V+  +VL G V + Q + +A E+++ +   +          N  A   +  V+
Sbjct: 175 PNIRVSTVAGDLVLAGRVSSAQAAAQAQEIAKAYARSTLPGASGGANGNGTAAGKTATVL 234

Query: 186 NLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDF 245
           N++++    QV L+V +AEV + +L Q+G   +I G     S +  +       S     
Sbjct: 235 NMMSVDSPQQVMLEVKVAEVSKTVLNQLGAAMNIQGGFGSWSGALISSLLAGVSS----I 290

Query: 246 SVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGAT 305
                 +   F   +        ++ LAEP L  +SGQ A+F +GG+       S+    
Sbjct: 291 VDVNKANNRPFNVAIDGQHGDNLVKILAEPNLVTLSGQEATFLAGGKVFIPIPQSNLNGV 350

Query: 306 SV---TTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGD---------MPSYRV 353
           S       ++GV L FTPTVL+ GRI L++  EVSE                  +P    
Sbjct: 351 STIILQEEEFGVGLKFTPTVLAGGRINLKVAPEVSELSSTGVTVGATNTNNLTVLPLITT 410

Query: 354 RKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIA 413
           R+A TTV++  G T  + GL+K++     + IP + ++P+LGALFR++ + ++ TE+   
Sbjct: 411 RRASTTVQMNDGETFAIGGLIKNNAAGTLKAIPGVGEVPVLGALFRSTSYQQDRTELVFI 470

Query: 414 ATPFLVKPVA-MRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEAS 458
            TP LVKP+    +L  P D     ++A  +    +          
Sbjct: 471 ITPHLVKPLQTAANLPLPTDRLKTPNEADVYLMGNMEGRDPAGSTK 516


>gi|167584957|ref|ZP_02377345.1| type II and III secretion system protein [Burkholderia ubonensis
           Bu]
          Length = 536

 Score =  294 bits (753), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 119/435 (27%), Positives = 212/435 (48%), Gaps = 19/435 (4%)

Query: 42  VEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVIL 101
             + +   +S+ L K +++ +P  V++  + +P  A   + SP+T+Y+ G +VG  N+I+
Sbjct: 81  GAVRESTSVSVPLGKSMLVPMPEPVRNRTIGNPAVAQATMVSPQTLYILGLSVGTTNMIV 140

Query: 102 IGHDGKQMLNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRA 160
            G  G     +D+ +  D   L+ +L + +    +I V   +DT+VL G V + Q +Q+A
Sbjct: 141 QGKSGACR-IIDVAVGADAGGLQASLGQLMPGERDIHVSTAADTIVLAGNVSSAQAAQQA 199

Query: 161 VELSETFLSQSGRNQYANSSSKK-VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSI 219
             +++ + +  G     ++     V+N+L +    QV L+V +AEV + ++ Q+G   +I
Sbjct: 200 AAIAKAYANAGGGGANGDNKGGGTVLNMLTVTAPQQVMLEVKVAEVSKTLINQLGSAFNI 259

Query: 220 TGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTA 279
            G     S +  ++      S      V    +   F   + A      ++ LAEP L  
Sbjct: 260 QGGFGSWSGALVSNLLAGVASG----IVANKANNRPFSVAVDAQNTDNLVKILAEPNLVT 315

Query: 280 ISGQSASFTSGGQHLYKTVSSSTG---ATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEV 336
           ISGQ A+F +GG+       S+TG     ++   ++GV L F PTVLS GRI L++  EV
Sbjct: 316 ISGQEATFLAGGKIFIPVPQSNTGGGTTITLQEEEFGVALRFLPTVLSNGRISLKVAPEV 375

Query: 337 SEPVIGVNAGD---------MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPL 387
           SE                  +P    R+A TTV++  G +  + GL+KD+     + +P 
Sbjct: 376 SELSQTGVTLTATNVAGASILPLITTRRASTTVQMADGESFAIGGLIKDNATGSLKAVPG 435

Query: 388 LSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNR 447
           + +IP+LGAL R++ F ++ TE+    TP LVKP+   D+  P D ++  ++   F    
Sbjct: 436 IGEIPVLGALARSTSFQQDRTELIFIITPHLVKPLQTADVPLPTDSFTRTNEVDVFATGN 495

Query: 448 VNKIYGPKEASEVEG 462
           +    G ++      
Sbjct: 496 MEGRGGLRKHGRAPA 510


>gi|294139870|ref|YP_003555848.1| Flp pilus assembly protein CpaC [Shewanella violacea DSS12]
 gi|293326339|dbj|BAJ01070.1| Flp pilus assembly protein CpaC [Shewanella violacea DSS12]
          Length = 442

 Score =  293 bits (751), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 129/461 (27%), Positives = 201/461 (43%), Gaps = 56/461 (12%)

Query: 49  KISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQ 108
            +++ LNK  ++Q+P   + + +S  T AD    +   + +FGK  G  ++ ++  D   
Sbjct: 2   TLAVTLNKAELVQLPKTAKSIFISSNTIADYQALTNTKIMVFGKRAGTTSLYVLDADENV 61

Query: 109 MLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFL 168
           + +  + +  ++  L   +R    D+ +  E ++  + L G V T   +++ V LSE ++
Sbjct: 62  IYSASVKVSHNVTELNGLIRSEFPDALVSAESIAGKLFLKGRVPTPTMAEKIVRLSEGYV 121

Query: 169 SQSGRNQY----------------------------ANSSSKKVMNLLNIAGEDQVTLKV 200
           SQ   ++                                S  +++N L I    QV L+V
Sbjct: 122 SQPQSSKGKQQGGKSSGQAKGSKQQGQNGGGQESQSGTGSKGELINQLEITMSTQVNLRV 181

Query: 201 TIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVL 260
            IAEV R++  ++G +    G                     G F+    L       ++
Sbjct: 182 RIAEVSRNVSNKLGIKWGSQGF------------------GTGKFAFSDGLGFSKLSVMV 223

Query: 261 HALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTP 320
            AL     I  LAEP LTAISG+ ASF  GG+     +   T   S+    +GV L F P
Sbjct: 224 DALATNGMITVLAEPNLTAISGEKASFLVGGEVPIPLIYGDT--VSIEYKPFGVRLDFKP 281

Query: 321 TVLSPGRIGLRIQTEVSEPVIGVNA----GDMPSYRVRKADTTVELPSGGTIVLAGLLKD 376
           TVLSP RI L+I+ EVS      N        P +  RKA TT+EL SG +  L GLL+ 
Sbjct: 282 TVLSPNRISLQIEPEVSTISQSTNVVMGDSSFPVFMTRKASTTIELASGQSFALGGLLQS 341

Query: 377 DIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSV 436
              +  + +P +  IPILGALFR++ F REETE+ I AT +LV+P     L  P D    
Sbjct: 342 TDIEQMQKMPWIGDIPILGALFRSNEFKREETELIIIATVYLVEPTRGDSLPLPTDGLIP 401

Query: 437 EDDAKAFFFNRVNKIYGPKEASEVEGQNYK----GAIGFIY 473
             D +       + +    +       N +    G  GF Y
Sbjct: 402 MSDVERLLAWPRSGVNPSTDTQVNPNDNRQLRLLGDNGFYY 442


>gi|295700370|ref|YP_003608263.1| type II and III secretion system protein [Burkholderia sp.
           CCGE1002]
 gi|295439583|gb|ADG18752.1| type II and III secretion system protein [Burkholderia sp.
           CCGE1002]
          Length = 634

 Score =  293 bits (749), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 113/473 (23%), Positives = 210/473 (44%), Gaps = 36/473 (7%)

Query: 20  NPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADV 79
            P+ A    +             EI     +S+ + K I++ +    ++  + +P  A  
Sbjct: 74  MPTGATSGRMVAPAQLTGPNCTGEIRDESNVSVAVGKSILVPLVEPARNRTLGNPVVAQA 133

Query: 80  VVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSN-IRV 138
            + S RT+Y+ G +VG  N+I+ G  G     +D+ +  D   L+ TL + + +   IRV
Sbjct: 134 TLVSQRTLYVVGMSVGTTNMIVQGRSGAC-QIIDVSVGVDAEGLQRTLAQLLPNERGIRV 192

Query: 139 EMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSK---------------- 182
              +  +VL G V + Q +Q+A+ ++  +       Q  +S++                 
Sbjct: 193 SSAAGNLVLAGRVSSGQAAQQAMSIAGAYAGAQPTQQDQSSTASFGNGGSISQQSSSVSK 252

Query: 183 --KVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVS 240
             +V+N++ +    QV L+V +AEV + +L Q+G   +I G     + +  +       S
Sbjct: 253 GSEVINMMTVDSPQQVMLEVKVAEVSKTLLNQLGAAVNIQGGFGSWTGALVSSLLAGVSS 312

Query: 241 EGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSS 300
                      +   F   + A +  +  + LAEP L  +SGQ ASF +GG+       S
Sbjct: 313 G----VAVSKANNRPFNIAVDAQKSDSLGKILAEPNLVTLSGQEASFLAGGRVFIPVPQS 368

Query: 301 STG---ATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIG---------VNAGDM 348
           +       ++   ++GV L FTPTVL+  R+ L++  EVSE              +   +
Sbjct: 369 NGTGGSTITLQEEEFGVGLKFTPTVLAGSRVNLKVAPEVSELSPTGVTVQATGTSSTAIL 428

Query: 349 PSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREET 408
           P    R+A TTV++  G +  + GL++++I    + +P + ++P+LGALFR++ F ++ T
Sbjct: 429 PLITTRRASTTVQMNDGESFAIGGLIQNNITGALKALPGIGEVPVLGALFRSTSFQQDRT 488

Query: 409 EIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVE 461
           E+    T  LVKP+   D   P D ++   D   +    +         +  +
Sbjct: 489 ELIFIVTVHLVKPLPPGDYPLPTDSFTGVSDGTVYATGNMEGRRPTASPNAPQ 541


>gi|332188377|ref|ZP_08390102.1| bacterial type II and III secretion system family protein
           [Sphingomonas sp. S17]
 gi|332011606|gb|EGI53686.1| bacterial type II and III secretion system family protein
           [Sphingomonas sp. S17]
          Length = 511

 Score =  292 bits (748), Expect = 7e-77,   Method: Composition-based stats.
 Identities = 131/496 (26%), Positives = 212/496 (42%), Gaps = 39/496 (7%)

Query: 1   MRYLQRTFFTMMS--IFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVI 58
           M    R+  T       +      +   P       A    S         + I   +  
Sbjct: 1   MTMTMRSILTGAGRGSVVALMLAPLLLAPAPAHGAPAGPGDSADAGSGAGVLEINTGRAR 60

Query: 59  ILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIER 118
           ++ +P  + D+ V+D T ADV V SP  +Y+FGK  G+  +      G  +    + I  
Sbjct: 61  LITLPRPMTDLFVADDTIADVQVRSPTQLYIFGKKPGETTISATARGGAVVYATTVRIGN 120

Query: 119 DIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYAN 178
           ++  +   LR  + ++ I    ++  ++L G V    D   A  L + ++ +        
Sbjct: 121 NLDSIGRMLRLAMPEAQIASTPMNGLILLTGTVAAPDDVAEAERLVQAYVGKDT------ 174

Query: 179 SSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQH-----SITGSSSGPSKSFAAD 233
               KV++ L  A   QV L+V IAEV R+ +K IG        + +G   G        
Sbjct: 175 ----KVISRLKTATPLQVNLQVRIAEVNRNFVKSIGVNLLNRDRNSSGFVFGIGSGRNPG 230

Query: 234 FGGKFVSEGG----------------DFSVKGVLDRFSFETVLHALERATAIRTLAEPTL 277
                 +  G                   + G +        +   E    + TLA P L
Sbjct: 231 TITDLTNAAGTTIGTQYGFNQGPLRTTLGLGGRVLGMDLLGAMDLGETLGQVSTLANPNL 290

Query: 278 TAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS 337
           TA+SG++A+F +GG+       +  GA SV    YGV L +TPTVLS GRI LR++ EVS
Sbjct: 291 TALSGETATFLAGGEIPIPLS-TGLGAVSVEYKQYGVSLSYTPTVLSDGRISLRVRPEVS 349

Query: 338 EPV----IGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPI 393
           +      + ++   +P+   R+A+TT+EL SG ++++ GLL +      E  P L  +P+
Sbjct: 350 QITSVGAVTISGTTIPALTTRRAETTLELGSGQSMMIGGLLSNSRDNSIEKTPWLGDLPL 409

Query: 394 LGALFRNSRFNREETEIFIAATPFLVKPV-AMRDLSRPDDHYSVEDDAKAFFFNRVNKIY 452
           +GALFR++ F R ETE+ I  TP+LVKPV +  D++ P D     +DA+     R+    
Sbjct: 410 IGALFRSNAFKRNETELVIIITPYLVKPVNSPSDIALPTDGQRSPNDAERVLLGRMAAGS 469

Query: 453 GPKEASEVEGQNYKGA 468
                        +G 
Sbjct: 470 SEPRPVPTMATPVQGR 485


>gi|78186537|ref|YP_374580.1| type II secretion system protein [Chlorobium luteolum DSM 273]
 gi|78166439|gb|ABB23537.1| type II secretion system protein [Chlorobium luteolum DSM 273]
          Length = 461

 Score =  292 bits (747), Expect = 9e-77,   Method: Composition-based stats.
 Identities = 109/457 (23%), Positives = 191/457 (41%), Gaps = 51/457 (11%)

Query: 41  DVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVI 100
              +       + + +  + ++   ++ V V +P  AD ++ +   +YL GK  G  N+I
Sbjct: 14  FSGLAAPSTYLVPVGESRVYRLEQPIKRVAVGNPEVADYIMLNSSELYLLGKKTGATNLI 73

Query: 101 LIGHDGKQMLNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQR 159
           L    G     L + + R++  ++  L+  +    +I++      +VL G       ++ 
Sbjct: 74  LWDQKGNCTSTL-LQVSRNVYPIKKLLKTALPKETDIQIFASGPALVLAGSASNSLAAES 132

Query: 160 AVELSETFLSQ-------------------------------------SGRNQYANSSSK 182
           A  L + +L                                       +     A +   
Sbjct: 133 AYRLVKAYLGGTVPGVNPESSLSNSGSGSAAPASMSGTQNSSYAAPVIATSASTAPAGMS 192

Query: 183 KVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEG 242
            ++NLL +    QV L+V IAEV +  ++ +G   +          +        FVS  
Sbjct: 193 GLVNLLTVRDTQQVRLEVRIAEVSKSYIETLGLGWTQ------GVGNTQGSLMTGFVSNA 246

Query: 243 GDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSST 302
               +            + A  +   I+ LAEPT+ A+SGQ   F  GG+       S+ 
Sbjct: 247 TLNLLLQTKSNPGNRLDMDAERKEGLIKILAEPTMVAMSGQEGYFLVGGKVYTP-TLSTN 305

Query: 303 GATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEP----VIGVNAGDMPSYRVRKADT 358
           GA       YGV L FTP VL  GRI L++  EVSEP    V    +G +P ++   A +
Sbjct: 306 GAVDYVERTYGVGLRFTPVVLDSGRISLKVAPEVSEPLKEAVTAGTSGPLPGFKTSFASS 365

Query: 359 TVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFL 418
           TV++  G  +V+ GLL+D++ ++   +PLL+ IPILG+LFR++  + E TE+ +   P L
Sbjct: 366 TVQMREGENLVIGGLLRDNLTEVVRAVPLLADIPILGSLFRHTEKSSETTELMVIIRPTL 425

Query: 419 VKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPK 455
           +K    +    P D +     ++ F   ++    G K
Sbjct: 426 IKASD-KAPELPTDRFVPPSSSELFIEGKLQSSRGSK 461


>gi|254418362|ref|ZP_05032086.1| Putative phospholipid-binding domain family [Brevundimonas sp.
           BAL3]
 gi|196184539|gb|EDX79515.1| Putative phospholipid-binding domain family [Brevundimonas sp.
           BAL3]
          Length = 517

 Score =  292 bits (747), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 141/533 (26%), Positives = 257/533 (48%), Gaps = 75/533 (14%)

Query: 1   MRYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIIL 60
           MR       T+    +  +    A +  + +  AAV   +  ++     I++       +
Sbjct: 1   MRKT-PVRKTVALACVLLAGLGAAPVAGLAQTRAAVSMGAAPQL-----INLPRGTSFAV 54

Query: 61  QVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDI 120
            +P D +DV+V++P  A+ ++HSPR + + G   G+ + + +   G+ +L+L + ++   
Sbjct: 55  DLPADARDVIVANPQVAEAMLHSPRRITVIGIAPGETDAVFLDAAGRTILSLRVRVDAGT 114

Query: 121 AHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSS 180
           + L+ TL R +  S IR E V+D+V+L G+  +   + +A +++  F+          S+
Sbjct: 115 SALQDTLSRLVPGSQIRAEAVNDSVILSGVADSPAQAVQAAQVARAFV----------SA 164

Query: 181 SKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVS 240
            +KV+N+++IAG DQVTLKV + EV+R  +KQ+GF  S      G ++    +     V+
Sbjct: 165 PEKVLNMISIAGSDQVTLKVRVVEVQRSAIKQLGFDTSAVVGQLGSTQWLLGNSATWGVN 224

Query: 241 EGGDFSVKGVLDRFSF-------------------------------------------- 256
            G    +   L R +                                             
Sbjct: 225 GGLIGGISAGLSRDTTKNYQMQRPCVGPGWTPGALCPVTVRGPDDASNWDTAQPGTGPGS 284

Query: 257 ------ETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTH 310
                    + A ER   +RTLAEP LT+++G++ASF +GG+    +     G  +V   
Sbjct: 285 NDLNKGSATVKAFERVGLLRTLAEPNLTSVNGEAASFLAGGEFPIPSGRDRDGNITVVYK 344

Query: 311 DYGVVLHFTPTVLSPGRIGLRIQTEVSEPVI---------GVNAGDMPSYRVRKADTTVE 361
            YGV L F P VL  GRI L+++ EVSE              ++  +P   VR+++ TVE
Sbjct: 345 PYGVALSFRPVVLDAGRISLQVKVEVSELTSQGGLTIGAGTTSSVSLPGLSVRRSENTVE 404

Query: 362 LPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKP 421
           L SGG++++AGLL+++ +Q  + +P ++ +P+LG LFR+  +   ETE+ +   P++V P
Sbjct: 405 LSSGGSMMIAGLLQENTRQAIDALPGMTNLPVLGQLFRSRDYLNGETELVVIVEPYIVSP 464

Query: 422 VAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
            +   +  P D   +  D++   F ++N+IYG    +   G  ++GA G++ +
Sbjct: 465 TSPDRMQTPADGLRIASDSQTILFGQLNQIYGSPSPTAQSGAVWQGAAGYVIE 517


>gi|319783874|ref|YP_004143350.1| type II and III secretion system protein [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317169762|gb|ADV13300.1| type II and III secretion system protein [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 482

 Score =  291 bits (745), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 122/434 (28%), Positives = 203/434 (46%), Gaps = 18/434 (4%)

Query: 38  NISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQA 97
           ++  V   K   I +   K   +        +++ DP  A+V   + ++ Y+ G N+G  
Sbjct: 43  DVVYVSSTKNASIKVAKGKPKTIITSAAFYQIVIGDPEIANVNPLTDKSFYVLGNNLGTT 102

Query: 98  NVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDS 157
            + L     + +  +DI +  D   L  T+R  + D+ I+V   +  VVL G       +
Sbjct: 103 GIALFDEKKQLVGTVDIEVTLDTDQLASTIRASVPDARIKVGSANGRVVLSGEADDAVAA 162

Query: 158 QRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQH 217
           ++A +++  F             +++V+N +NI+   QV L V   E+ R   + +G ++
Sbjct: 163 EKANKIATRFSG-----------AEEVINSVNISSSQQVQLNVRFVEINRQAGQDLGAKY 211

Query: 218 SITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTL 277
           +   +     +  + D G    +  G+   + + +  S +  + ALE     R LAEP L
Sbjct: 212 AANFAYGLGGRDVSIDPGTVPTAGTGEIIGRLLSNGVSIDIAIKALEERGLARRLAEPNL 271

Query: 278 TAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS 337
            A SGQ+ASF +GG+     VS   G  SV+   YGV L FTPTVL  G + L I  EVS
Sbjct: 272 IARSGQTASFLAGGEFPIP-VSEDNGKISVSYKKYGVSLDFTPTVLKDGLVSLDIAPEVS 330

Query: 338 EPVIG----VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPI 393
                    +    +P + VR+A T+V+L +G + ++AGLL+         IP L K+P+
Sbjct: 331 SIDASASYNIGTISVPGFIVRRARTSVDLKNGQSFMIAGLLQSQNDITTSRIPGLGKMPV 390

Query: 394 LGALFRNSRFNREETEIFIAATPFLVKPVAM-RDLSRPDDHYSVEDDAKAFFFNRVNKIY 452
           LGALF +  + R ET++ I  TP+LVKPV   + L  P D      +A  +F N   ++ 
Sbjct: 391 LGALFSSKSYQRRETDLVIIVTPYLVKPVDPSKKLVEPTDGTQPASNAD-YFLNNTEEVK 449

Query: 453 GPKEASEVEGQNYK 466
                  V   + +
Sbjct: 450 DSDAGRTVALADGR 463


>gi|288956969|ref|YP_003447310.1| pilus assembly protein [Azospirillum sp. B510]
 gi|288909277|dbj|BAI70766.1| pilus assembly protein [Azospirillum sp. B510]
          Length = 491

 Score =  291 bits (744), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 117/441 (26%), Positives = 201/441 (45%), Gaps = 32/441 (7%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           +++ +    ++++     +V V+DP  ADV   S   +++ G+  G+  V  +    + +
Sbjct: 66  MTLDVGTSEMVRLSAPATNVYVADPEIADVQAASGTVIFVLGRKPGRTTVYALTEGDRVV 125

Query: 110 LNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLS 169
           L+ DI +   +A L   +        + V    + +++ G V T   ++  +EL   F  
Sbjct: 126 LHRDIRVIHSLAPLREQITARFPGMPVTVTSAPNRLIVTGEVPTPAIAESVMELVNGFAR 185

Query: 170 QSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQH-------SITGS 222
                        KV+N + + G  QVTL+V +AEV R + +++GF             +
Sbjct: 186 ----------PDDKVVNQMAVTGPVQVTLRVQVAEVARSVTQELGFNWEGAVKIGDFAIA 235

Query: 223 SSGPSKSFAADFGGKFVSEGGDFSVKGVL----DRFSFETVLHALERATAIRTLAEPTLT 278
                    A  G    S  G  S+ G+L     + +   ++ A++    +  LA+P L 
Sbjct: 236 PGFGRDFLNATSGAIQRSATGASSLAGILKSSNGKANIAGIVDAMQDQGLVTLLAQPNLV 295

Query: 279 AISGQSASFTSGGQHLYK--TVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEV 336
           A+SG+ A F +GG+         S +    V    YGV L+F PTVL+P RI L ++ EV
Sbjct: 296 AMSGKPAMFLAGGEFPIPVSAGDSGSNKIQVEFKQYGVALNFVPTVLAPDRIALTVRPEV 355

Query: 337 SEPV----IGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIP 392
           SE      + VN   +P+  VR+ +T+VEL SG +  + GLL++  +   +  P L  +P
Sbjct: 356 SELTDVGAVTVNGLTIPALTVRRVETSVELGSGESFAIGGLLQNSNRSSLKKFPGLGDLP 415

Query: 393 ILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIY 452
           +LG LFR+ RF   ETE+ +  TP++V P+       P        + +     R   + 
Sbjct: 416 VLGELFRSRRFINNETELVVIVTPYVVNPIQRGPGVIPQRGTKPNREVEELLRRRQQALG 475

Query: 453 GPKEASEVEGQNYKGAIGFIY 473
            P+ A      +Y G  GFIY
Sbjct: 476 LPEPAG-----SYYGPAGFIY 491


>gi|209515951|ref|ZP_03264812.1| type II and III secretion system protein [Burkholderia sp. H160]
 gi|209503609|gb|EEA03604.1| type II and III secretion system protein [Burkholderia sp. H160]
          Length = 431

 Score =  291 bits (744), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 112/443 (25%), Positives = 193/443 (43%), Gaps = 23/443 (5%)

Query: 40  SDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANV 99
             +       ++I      +L +P     V V+DP  ADV V +P T+++ GK  G   +
Sbjct: 3   GALAASGDPSLAIAAGGGEMLHLPEAAVAVFVADPDVADVHVPTPETVFVLGKKAGTTTL 62

Query: 100 ILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQR 159
             +G   + +L   +++  D   ++  L        + +     ++++ G V     +  
Sbjct: 63  FALGAHNRTILRETVVVSADTPSIQRMLDARFPQFQLTLTAAPGSLMVAGRVPDAAAADA 122

Query: 160 AVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSI 219
            ++    +L             + ++N L +    QV L+V I EV R++ +Q+G   + 
Sbjct: 123 VMQSLTPYLHDK----------ETLVNRLTLTRPIQVHLRVRITEVDRNVTQQLGINWNA 172

Query: 220 TGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFS-----FETVLHALERATAIRTLAE 274
            G S            G   +         +L  F       + VL AL++   I  LAE
Sbjct: 173 LGQSGNFIGGLFNGRAGSATTTLSSTGAFSILGAFQAGKWAIDGVLDALDQEGLITMLAE 232

Query: 275 PTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQT 334
           P LTA+SG++ASF +GG+         T + ++    YGV L FTPTVL+  RI L+++ 
Sbjct: 233 PNLTAMSGETASFLAGGEFPIPVPQGQTNSITIEFKPYGVSLDFTPTVLADNRISLKVRP 292

Query: 335 EVSEPVIGVN----AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSK 390
           EVSE          +  +P+  VR+ +TTVEL SG +  + GLL+ +   +   +P L K
Sbjct: 293 EVSELDTTNGVTIDSIKVPALTVRRVETTVELSSGQSFAIGGLLQSNTSDVLAELPGLGK 352

Query: 391 IPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNK 450
           +P+LG LF +  +   ++E+ +  TP++V+P     L +P D          +       
Sbjct: 353 LPVLGKLFSSKSYLNNKSEVVVIVTPYIVQPAEPGRLRQPIDTIVHPSSDIEYVLQSRLG 412

Query: 451 IYGPKEASEVEGQNYKGAIGFIY 473
           I               GA GF+Y
Sbjct: 413 IDPLSG----SVPRLVGAAGFVY 431


>gi|170692564|ref|ZP_02883726.1| type II and III secretion system protein [Burkholderia graminis
           C4D1M]
 gi|170142220|gb|EDT10386.1| type II and III secretion system protein [Burkholderia graminis
           C4D1M]
          Length = 614

 Score =  290 bits (743), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 122/461 (26%), Positives = 211/461 (45%), Gaps = 25/461 (5%)

Query: 15  FLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDP 74
              S N + A+     +  AA          +   + + + K  ++Q    V++  + +P
Sbjct: 56  MTISMNAAPAQPSSAMQNAAARGPACTRTQSEQSTVVVPVGKSTLMQTAEPVRNRTLGNP 115

Query: 75  TKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADS 134
             A   + SP+T+Y+ G  VG  N+I+ G  G     +++++  D   L+ +L + + D 
Sbjct: 116 LIAQATMVSPKTLYVVGMAVGTTNMIVQGKSGAC-EVINVVVNADAGGLQTSLSQLMPDE 174

Query: 135 -NIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQS------GRNQYANSSSKKVMNL 187
            NIRV  V+  +VL G V + Q + +A E+++ +   +        N   N  S  V+N+
Sbjct: 175 PNIRVSTVAGDLVLAGRVSSAQAAAQAQEIAKAYARTTLPNPNGAANGNGNGKSATVLNM 234

Query: 188 LNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSV 247
           +++    QV L+V +AEV + +L Q+G   +I G     S +  +       S       
Sbjct: 235 MSVDSPQQVMLEVKVAEVSKTVLNQLGAAMNIQGGFGSWSGALISSLLAGVSS----IVD 290

Query: 248 KGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSV 307
               +   F   + A      ++ LAEP L  +SGQ A+F +GG+       S+    S 
Sbjct: 291 VNKANNRPFNVAIDAQHGDNLVKILAEPNLVTLSGQEATFLAGGKVFIPIPQSNLNGVST 350

Query: 308 ---TTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGD---------MPSYRVRK 355
                 ++GV L FTPTVL+ GRI L++  EVSE                  +P    R+
Sbjct: 351 IILQEEEFGVGLKFTPTVLAGGRINLKVAPEVSELSSTGVTVGATNTNNLTVLPLITTRR 410

Query: 356 ADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAAT 415
           A TTV++  G T  + GL+K +     + IP + ++P+LGALFR++ + ++ TE+    T
Sbjct: 411 ASTTVQMNDGETFAIGGLIKSNAAGTLKAIPGVGEVPVLGALFRSTSYQQDRTELVFIIT 470

Query: 416 PFLVKPVA-MRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPK 455
           P LVKP+    +L  P DH    ++A  +    +       
Sbjct: 471 PHLVKPLQTASNLPLPTDHLKTPNEADVYLMGNMEGRDPAG 511


>gi|323529413|ref|YP_004231565.1| type II and III secretion system protein [Burkholderia sp.
           CCGE1001]
 gi|323386415|gb|ADX58505.1| type II and III secretion system protein [Burkholderia sp.
           CCGE1001]
          Length = 616

 Score =  290 bits (743), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 120/466 (25%), Positives = 213/466 (45%), Gaps = 27/466 (5%)

Query: 15  FLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDP 74
              S NP+ A+     ++ AA          +   + + + K  ++Q    V++  + +P
Sbjct: 56  MTISMNPAPAQPANTMQSAAARGPACTRTQSEQSTVVVPVGKSTLMQTAEPVRNRTLGNP 115

Query: 75  TKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADS 134
             A   + SP+T+Y+ G  VG  N+I+ G  G     +++++  D   L+ +L + + D 
Sbjct: 116 LVAQATMVSPQTLYVVGMAVGTTNMIVQGKSGAC-EVINVVVNADSGGLQTSLSQLMPDE 174

Query: 135 -NIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQS--------GRNQYANSSSKKVM 185
            NIRV  V+  +VL G V + Q + +A E+++ +   +          N  A + +  V+
Sbjct: 175 PNIRVSTVAGDLVLAGRVSSAQAAAQAQEIAKAYARSTLPAANGGTNGNGGAPAKAATVL 234

Query: 186 NLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDF 245
           N++++    QV L+V +AEV + +L Q+G   +I G     S +  +       S     
Sbjct: 235 NMMSVDSPQQVMLEVKVAEVSKTVLNQLGSAMNIQGGFGSWSGALISSLLSGVQS----I 290

Query: 246 SVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGAT 305
           +     +   F   +        ++ LAEP L  +SGQ A+F +GG+       S+    
Sbjct: 291 AAVSKANNRPFNVAVDGQHGDDLVKILAEPNLVTLSGQEATFLAGGKVFIPIPQSNLNGV 350

Query: 306 SV---TTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGD---------MPSYRV 353
           S       ++GV L FTPTVL+ GRI L++  EVSE                  +P    
Sbjct: 351 STIILQEEEFGVGLKFTPTVLAGGRINLKVAPEVSELSSTGVTVGATNTNNLTVLPLITT 410

Query: 354 RKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIA 413
           R+A TTV++  G T  + GL+K +     + IP + ++P+LGALFR++ + ++ TE+   
Sbjct: 411 RRASTTVQMNDGETFAIGGLIKSNAAGTLKAIPGVGEVPVLGALFRSTSYQQDRTELIFI 470

Query: 414 ATPFLVKPVAM-RDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEAS 458
            TP LVKP+    +L  P D     ++A  +    +          
Sbjct: 471 ITPHLVKPLQAVANLPLPTDRLKTPNEADVYLLGNMEGRDPAGSRK 516


>gi|300692331|ref|YP_003753326.1| pilus assembly secretion protein [Ralstonia solanacearum PSI07]
 gi|299079391|emb|CBJ52062.1| pilus assembly secretion protein [Ralstonia solanacearum PSI07]
          Length = 644

 Score =  290 bits (743), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 113/446 (25%), Positives = 207/446 (46%), Gaps = 41/446 (9%)

Query: 42  VEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVIL 101
             +    ++++ + K  ++Q+P  V++  V +P     ++ SP+T+YL G+ VG  N+I+
Sbjct: 119 GAMRAHSEVTVPVGKSTMVQLPEPVRNRTVGNPNVVQAMLVSPQTLYLLGQEVGTTNMIV 178

Query: 102 IGHDGKQMLNLDILIERDIAHLEMTLRRFIADSN-IRVEMVSDTVVLHGMVRTIQDSQRA 160
            G  G     +D+ +  D   L  TL   + D+  +RV   +D++VL G V     +Q+ 
Sbjct: 179 QGRSGSC-SVIDVAVGADPGGLLATLHELVPDAKGVRVSAAADSLVLSGSVSDSVQAQKV 237

Query: 161 VELSETFLSQSG----------------------RNQYANSSSKKVMNLLNIAGEDQVTL 198
           V+++  F+++                            A   S +++N++ +    QV L
Sbjct: 238 VDIANAFVTRQTRGPSQHDQGGGQGANSATQGAITAPGAQPRSPRIINMMAVEAPQQVML 297

Query: 199 KVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFET 258
           +V +AEV + ++ Q+G   ++  +    S    A+    F+S   D       +    + 
Sbjct: 298 EVKVAEVSKTLIDQMGAAFNLNSAFGSWSFGAIAN----FLSSSQDLVSFSKANNLPLKF 353

Query: 259 VLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSV---TTHDYGVV 315
            L A      ++ LAEP+L AISGQ ASF +GG+       S TG  +        +GV 
Sbjct: 354 ALDAQRGDGLVKVLAEPSLMAISGQEASFLAGGKVFIPVPQSFTGGVTTIVLQEETFGVG 413

Query: 316 LHFTPTVLSPGRIGLRIQTEVSEPVI---------GVNAGDMPSYRVRKADTTVELPSGG 366
           L FTPTV+  GRI L++  EVSE                  +P    R+A TT+++  G 
Sbjct: 414 LRFTPTVMENGRINLKVAPEVSELSPTGVAVTAANTNGTTILPLITTRRASTTLQVRDGQ 473

Query: 367 TIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRD 426
           +  + GL+K ++    + +P + ++P++G+L R++ F R++TE+    TP LVKP+    
Sbjct: 474 SFAIGGLIKSNVTGSLKALPGIGELPVIGSLARSTSFQRDQTELLFVVTPRLVKPL-PAQ 532

Query: 427 LSRPDDHYSVEDDAKAFFFNRVNKIY 452
              P D +   +  + +    +    
Sbjct: 533 YPMPTDSFGPINRGELYLNGNMEGRR 558


>gi|152994347|ref|YP_001339182.1| type II and III secretion system protein [Marinomonas sp. MWYL1]
 gi|150835271|gb|ABR69247.1| type II and III secretion system protein [Marinomonas sp. MWYL1]
          Length = 463

 Score =  290 bits (742), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 119/441 (26%), Positives = 210/441 (47%), Gaps = 14/441 (3%)

Query: 7   TFFTMMSIFLFSSNPSVAKLPP---IKEANAAVINISDVEIGKGKKISIGLNKVIILQVP 63
               +  +FL S     A L P     E+ + +   +  ++     +++ +N+  +L +P
Sbjct: 9   VVPLLFGVFLLSGVSRAAYLEPMNNTSESQSVIGTSAYQQVEVSGNVNLVVNRGKLLTLP 68

Query: 64  VDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHL 123
            +   VL+++P  A   + SP  +++F K  G  ++  +  + + +L L +    D+  L
Sbjct: 69  QNAAKVLIANPDIASFQMPSPDNVFVFAKKSGSTSLYALDDENQVILALTLNAGYDLNSL 128

Query: 124 EMTLRRFIADSNIRVEMVS-DTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSK 182
              + + +  SN++V   + + +++ G V+T Q ++R ++  E F+           S  
Sbjct: 129 TKQVAQEVPGSNVQVGPATENGLIVRGSVQTPQQAKRVIDSVEAFVGGDATGSAGAGSQT 188

Query: 183 -KVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSI---TGSSSGPSKSFAADFGGKF 238
            +++N L +    Q+ + V I EV R++   +GF        G     + +   D     
Sbjct: 189 LRIVNQLKVELSSQINISVRIVEVSRNLSSSLGFSWDALFDNGKYFARNSASLFDATTGA 248

Query: 239 VSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTV 298
            +  G  +        +   VL AL        LAEP LTA+SG++A F  GG+     +
Sbjct: 249 FTGSGVTNAVFGGASGNLGGVLSALSNDGLASILAEPNLTAMSGETAGFAVGGEVPIVII 308

Query: 299 SSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPV----IGVNAGDMPSYRVR 354
             +    ++    YGV++  TPT+LSP RI L I  EVS+      + +    +P+++VR
Sbjct: 309 --TNNNVTIEYKQYGVIMRMTPTLLSPNRISLHIAPEVSDLTEEGAVELQGLTVPAFKVR 366

Query: 355 KADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAA 414
           +ADTTVEL SG +  LAG+L+  + Q   G+P L  IP LG LF +    +EETE+ I A
Sbjct: 367 RADTTVELASGQSFALAGMLRSSVSQTVTGVPGLRSIPGLGRLFESETNQKEETELVIIA 426

Query: 415 TPFLVKPVAMRDLSRPDDHYS 435
           T ++V P +  DL  P    S
Sbjct: 427 TAYVVAPTSSGDLQTPAKGIS 447


>gi|78186671|ref|YP_374714.1| type II secretion system protein [Chlorobium luteolum DSM 273]
 gi|78166573|gb|ABB23671.1| type II secretion system protein [Chlorobium luteolum DSM 273]
          Length = 486

 Score =  290 bits (742), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 114/454 (25%), Positives = 194/454 (42%), Gaps = 54/454 (11%)

Query: 51  SIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQML 110
            + + +  + ++P  V  V V DP  AD ++ +P  +YL GK  G  N+ +    GK + 
Sbjct: 38  RVPVGESRVYRLPQPVTRVAVGDPEVADYIMLNPSEIYLLGKKTGSTNLTVWDRKGK-VS 96

Query: 111 NLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLS 169
           +  + + R++A ++  LR  +     I++      +VL G       +  A  L   +  
Sbjct: 97  SRSLRVSRNVAPIQELLRVVLPGETGIQLYASGHALVLSGSASDAMAADTAYRLVIAYSG 156

Query: 170 QSGRNQYANSS--------------------------------------------SKKVM 185
            +       S+                                            + +V+
Sbjct: 157 GTVPALNPESALLAGSAGASGSVGAPGISGIHDSAPAAPSALPGAAASRSPAARDTPRVV 216

Query: 186 NLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDF 245
           NLL I    QV L+V IAEV R  ++ +G   +    S+  S                  
Sbjct: 217 NLLKIRDPQQVRLEVRIAEVSRSHIESLGIGWTQGRGSTQGSLMTGFVSNATLDLLLKTG 276

Query: 246 SVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGAT 305
            + G  +       + A ++   ++ LAEPT+ A+SG+   F  GG+        + G+ 
Sbjct: 277 GMPGSTEGNRLT--VDAEQKKGLVKILAEPTIVAMSGEEGYFLVGGKVYTP-TLGTNGSV 333

Query: 306 SVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEP----VIGVNAGDMPSYRVRKADTTVE 361
                 YGV L  TPTVL  GRI L++  EVSEP    V    +  +P++++  A TTV+
Sbjct: 334 DYVERTYGVGLRCTPTVLDSGRISLKVAPEVSEPLKEAVTAGTSTSLPAFKLSYASTTVQ 393

Query: 362 LPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKP 421
           +  G  +V+ GLL+D++ ++K  +PLLS IP+LG+LFR++  N+E TE+ +   P LVK 
Sbjct: 394 MQEGENLVIGGLLRDNLTEVKRSVPLLSSIPVLGSLFRHTEMNKETTELMVIVRPTLVKA 453

Query: 422 VAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPK 455
                   P D +      + F   +++   G K
Sbjct: 454 GNP-APELPTDRFVPPAPLELFIEGKLDGSGGAK 486


>gi|294012433|ref|YP_003545893.1| Flp pilus assembly protein secretin CpaC [Sphingobium japonicum
           UT26S]
 gi|292675763|dbj|BAI97281.1| Flp pilus assembly protein secretin CpaC [Sphingobium japonicum
           UT26S]
          Length = 499

 Score =  289 bits (740), Expect = 6e-76,   Method: Composition-based stats.
 Identities = 126/470 (26%), Positives = 219/470 (46%), Gaps = 27/470 (5%)

Query: 7   TFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDV 66
           T  T  +  L     ++     +  A  + +N +   +     + + +    ++ +P  +
Sbjct: 5   TVHTAAAKPLLGPAIALGLAVAVAAAPTSALNAAPASMQDNAIL-LSVGGSKVINLPAKM 63

Query: 67  QDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMT 126
            DV++ DP   DV V S   +YL  K  G+  V     +GK + +  + +  ++  ++  
Sbjct: 64  SDVVIGDPDVVDVHVRSQNQLYLIAKKAGETTVFATATNGKVLFSGTVRVGNNLTSIDDM 123

Query: 127 LRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMN 186
           L+  + +++I V  ++  V+L G +   +D+  A  L++ F+ +             V++
Sbjct: 124 LKLAMPNADIAVNKMNGMVLLTGTIAAPEDAAEAERLTQAFVGKEVT----------VVS 173

Query: 187 LLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITG-------------SSSGPSKSFAAD 233
            L  A   QV L+V IAEV RD+  +IG                    +    + +    
Sbjct: 174 RLRTATPLQVNLQVKIAEVSRDVGHKIGMNWKSQDLTGGKWAGGIGGGTRDAITFNSGGG 233

Query: 234 FGGKFVSEGG-DFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQ 292
               F ++GG        +       VL   E +    TLA+P LT++SG++ASF +GG+
Sbjct: 234 GTFNFTADGGYSLGGVARVLGLDIGAVLDLAESSGLATTLAQPNLTSLSGETASFLAGGE 293

Query: 293 HLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGDMPSYR 352
           + Y   + + G  S+    YGV L FTPTVL+ GRI LR++  VS     V++  +P+ R
Sbjct: 294 YPYTVSNGTQG-NSIEFKQYGVQLAFTPTVLADGRISLRVRPTVSSLDFSVDS-SVPALR 351

Query: 353 VRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFI 412
            R A+TTVEL SG   ++AGLL +D       +P +  +PILG+LF++  F R ETE+ I
Sbjct: 352 SRTAETTVELGSGQAFMIAGLLNNDTANSISKVPGIGNLPILGSLFKSRNFQRHETELVI 411

Query: 413 AATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEG 462
             TP+LVKP+   D+  P D +   ++ +  F  + +       A     
Sbjct: 412 VVTPYLVKPMNASDVRLPTDGFRNANEGQGLFLQQGHDGISGAHAPMPSR 461


>gi|27378611|ref|NP_770140.1| hypothetical protein blr3500 [Bradyrhizobium japonicum USDA 110]
 gi|27351759|dbj|BAC48765.1| blr3500 [Bradyrhizobium japonicum USDA 110]
          Length = 550

 Score =  289 bits (739), Expect = 7e-76,   Method: Composition-based stats.
 Identities = 132/534 (24%), Positives = 216/534 (40%), Gaps = 73/534 (13%)

Query: 2   RYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKG-----KKISIGLNK 56
           R   +T   +++  +     +VA   P   A AA    S   +        +++ + +NK
Sbjct: 5   RVSGKTVARLLAFGVMGLGAAVALCGPADRAEAADRRGSSGGVFVSEMNDVQRVRVVVNK 64

Query: 57  VIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILI 116
               +V      ++   P   DV   S   +Y+ GK  G  NVIL     KQ+  LD+ +
Sbjct: 65  SRTFKVDTAFATIIAGSPDIVDVKSLSDHMIYVQGKQTGTTNVILFDSAMKQIGVLDVEV 124

Query: 117 ERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQY 176
             D  +L+  +R       +RV      VVL G       ++RA+ ++ + +++ G    
Sbjct: 125 VIDTGNLQQNIRTGTGMQGVRVSASEGQVVLSGTAVDAVAAERAMAIATSTVAKGGT--- 181

Query: 177 ANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSI----------------- 219
                  V+N +++A   QV L+V   EV R+  + +G   S                  
Sbjct: 182 -------VVNAMSVAAPQQVMLEVRFLEVSREAGRNLGVNLSAANANGTNIGNSGLGRVT 234

Query: 220 ------TGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLD--------------------- 252
                  G  +  +    A  G    +  G   V G L                      
Sbjct: 235 AAGRTPIGGINTANGPLGAGGGPVGSAPTGSLPVLGTLGTLAGTAGGIAPAPFGTLLTSL 294

Query: 253 -----RFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSST---GA 304
                  S + ++ ALE     R LAEP LT +SG +A F +GG+      + +T     
Sbjct: 295 IRTSNGGSVDMLISALETKGLARRLAEPNLTTLSGDAARFLAGGEFPVPIPTQTTNGFPT 354

Query: 305 TSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPV----IGVNAGDMPSYRVRKADTTV 360
            ++    +GV L F PTVLS G I LR++  VSE      + +    +P+   R A TTV
Sbjct: 355 ITIEYKKFGVELAFVPTVLSRGVINLRVEPSVSELDFANAVTIQGTTVPALTRRDARTTV 414

Query: 361 ELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVK 420
           EL  G +  +AGLL+   +Q    +P +  +P++G LF +  + +EET++ I  TP LV 
Sbjct: 415 ELRDGQSFAIAGLLQTRNRQDVSQLPWIGSVPVIGTLFSSKSYQQEETDLVIIVTPRLVA 474

Query: 421 PVAM-RDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIY 473
           P A  + L+ P D     +D   F   ++  +    +     G + KG  G I 
Sbjct: 475 PAAPGQQLASPLDSRLPANDVDFFLNGQME-VRKRYDDYVNSGGDVKGPYGHII 527


>gi|148557761|ref|YP_001265343.1| type II and III secretion system protein [Sphingomonas wittichii
           RW1]
 gi|148502951|gb|ABQ71205.1| type II and III secretion system protein [Sphingomonas wittichii
           RW1]
          Length = 526

 Score =  288 bits (738), Expect = 9e-76,   Method: Composition-based stats.
 Identities = 134/502 (26%), Positives = 208/502 (41%), Gaps = 67/502 (13%)

Query: 1   MRYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIIL 60
           MR   +       I   +  P  A         AA +  + +     +  ++ +    ++
Sbjct: 1   MRASMKFLAGGALITAIALAPVAASAAVRPSRGAAAVRTATIG-KPSETTTLSIGSGQMI 59

Query: 61  QVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDI 120
            +   + D+ V+D   ADV V S   +YLFGK  G+  V      G  + +  + +  +I
Sbjct: 60  ALSAPISDLFVADDKIADVQVRSTTQLYLFGKGAGETAVYATDKAGNVVWSSIVRVGSNI 119

Query: 121 AHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSS 180
             ++  L+  + ++ I    ++  V+L G V +  D + A +L E F+ +          
Sbjct: 120 TSVDTMLKLAMPEAAITATTMNGIVLLTGTVASPSDVEEAQKLVEQFVGKET-------- 171

Query: 181 SKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSG--------------- 225
             +V+N L  A   QV+L V IAEV R+  K IG       ++ G               
Sbjct: 172 --QVVNRLKSAVPLQVSLHVKIAEVSREFAKSIGINLLNRDTTGGFLFGVAQGRNFGSIG 229

Query: 226 ------------------------------------PSKSFAADFGGKFVSEGGDFSVKG 249
                                                  ++  D  GK    G  F + G
Sbjct: 230 NLDTSAFPKLDASSLYGLPAGSLSLPFNPATGQFIAGGTAYTFDKLGKGAGSGTSFGLAG 289

Query: 250 VLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTT 309
                     +   E    + TLA+P LTAISG++ASF +GG+          GA SV  
Sbjct: 290 KFLGMDLAAAIDLAEADGLVTTLAQPNLTAISGETASFLAGGEIPIPLA-QGLGAVSVEF 348

Query: 310 HDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGV----NAGDMPSYRVRKADTTVELPSG 365
             YGV L FTPTVL  GRI +R++ EVS+         N   +P    R+A+TTVEL SG
Sbjct: 349 KQYGVSLSFTPTVLGDGRISIRVRPEVSQLTDAGSVRLNGFTIPGITTRRAETTVELGSG 408

Query: 366 GTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMR 425
              ++ GLL +      +  P L  +PILGALFR++ F R ETE+ I  TP+LVKPV+ +
Sbjct: 409 QAFMIGGLLSNAQNSNVDKAPFLGDLPILGALFRSNGFKRNETELMIVVTPYLVKPVSPQ 468

Query: 426 DLSRPDDHYSVEDDAKAFFFNR 447
            ++ P        D +     +
Sbjct: 469 QIALPTAGLRAATDGERLIAGQ 490


>gi|193213115|ref|YP_001999068.1| type II and III secretion system protein [Chlorobaculum parvum NCIB
           8327]
 gi|193086592|gb|ACF11868.1| type II and III secretion system protein [Chlorobaculum parvum NCIB
           8327]
          Length = 472

 Score =  288 bits (736), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 116/451 (25%), Positives = 191/451 (42%), Gaps = 53/451 (11%)

Query: 44  IGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIG 103
           I       +   +  + ++   ++ V V +P  AD ++ +P  +YL GK  G  N+I+  
Sbjct: 30  IAAPSTYRVSEGESRVYRMGSPIKRVAVGNPEIADYIILNPTELYLLGKKTGATNLIVWD 89

Query: 104 HDGKQMLNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRAVE 162
            +G    +  + + R++  ++  +R  + +  +I +      +VL G V     ++ A  
Sbjct: 90  QNGNS-ASTPLQVSRNVEPIKDLIRTVLPNETDIHIYSSGPALVLAGTVSNSLAAETAYR 148

Query: 163 LSETFLSQS-------------------------------------GRNQYANSSSKKVM 185
           L + +L                                        G      S    V+
Sbjct: 149 LVKGYLGGDVPADNPEKTLTNTKPADSYAGTASLSGIVKSASLVAGGPTGAEGSGMSGVV 208

Query: 186 NLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDF 245
           NLL +    QV L+V IAEV +  ++ +GF+ +      G   + +      FVS     
Sbjct: 209 NLLKVRDAQQVRLEVHIAEVSKTFMQALGFEWA------GRIGNVSGGLMTGFVSNETIN 262

Query: 246 SVKGVLDRFSFETVLHALER--ATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTG 303
            +    D  S    + A        I+ LAEPT+ A+SGQ   F  GG+       ++ G
Sbjct: 263 LLLK--DNTSHSQRIKAENECDNGWIKILAEPTIVAMSGQEGYFLVGGKIYVP-TITANG 319

Query: 304 ATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIG--VNAGDMPSYRVRKADTTVE 361
           A       YGV L FTPTVL  GRI L++  EVSEP        G + +++   A TTV+
Sbjct: 320 AVDYQERTYGVGLRFTPTVLDAGRISLKVAPEVSEPPTSAADGTGTLLAFKTSYASTTVQ 379

Query: 362 LPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKP 421
           +  G  +V+ GLLKD I +  + +PLL  IP+LGALFR+++   E TE+ +   P LV+ 
Sbjct: 380 MNEGQNLVIGGLLKDKITETLKAVPLLGDIPLLGALFRHTKIESENTELLVVVRPTLVEA 439

Query: 422 VAMRDLSRPDDHYSVEDDAKAFFFNRVNKIY 452
                   P D +      + FF  ++    
Sbjct: 440 SDTPP-ELPTDRFIPPTQKELFFDGKLQGSR 469


>gi|297581608|ref|ZP_06943530.1| flp pilus assembly protein [Vibrio cholerae RC385]
 gi|297534015|gb|EFH72854.1| flp pilus assembly protein [Vibrio cholerae RC385]
          Length = 469

 Score =  287 bits (733), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 115/457 (25%), Positives = 202/457 (44%), Gaps = 37/457 (8%)

Query: 46  KGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHD 105
               + + +N+  I+ V  D+QDV VSDP    V   S R + + GK++G  +++++G +
Sbjct: 21  AESPLVLHVNQNQIITVDGDIQDVFVSDPKIVVVHAPSSRHVMVSGKDIGSTDLLIMGEN 80

Query: 106 GKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSE 165
            + + +  + +  D++ LE  ++    ++NIR       +V+ G V     +   + ++ 
Sbjct: 81  AQTLAHYKLNVNADLSELERAVQHAFPEANIRFAYSKGAIVVMGEVANPLQAHEVLSMAS 140

Query: 166 TFL-----------------------SQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTI 202
            F                        S + +        K V+N L   G  QV + + I
Sbjct: 141 GFARGLQKPEQQTLDMPANSASSGRDSGAAKPGGGIGDYKFVVNQLKTQGSAQVNISIRI 200

Query: 203 AEVRRDILKQIGFQHSITGSS-SGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLH 261
            E+ R   +Q+G + S  G+   G   +     G    ++    ++     +     ++ 
Sbjct: 201 VEMERATSEQLGLRWSSIGNMRWGTWDTLQTALGATPGNKFPTNTLPSGNGQHGLNVIID 260

Query: 262 ALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPT 321
           AL   + +  LAEP LTA SG++A+F SGG+  +   +   G  S+    +G+ L  TPT
Sbjct: 261 ALVENSLVNVLAEPNLTAKSGEAATFMSGGEFPFPVDNGDDG-VSIEFKKFGIALEVTPT 319

Query: 322 VLSPGRIGLRIQTEVS----EPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDD 377
           VLS  +I L +  EVS    E  + +   ++P    R+A TT+EL  G +  LAGL++  
Sbjct: 320 VLSNRQISLTVAPEVSTLSRENSVSIAGVEVPGIETRRATTTIELADGQSFALAGLVRTY 379

Query: 378 IQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKP-VAMRDLSRPDDHYSV 436
                E +P L +IPIL   F  + F   E+E+ I AT  LV+P     +L+ P D Y  
Sbjct: 380 QDHKVEALPFLGEIPILAPFFSTNSFKNSESELVIIATARLVEPSSDPAELTTPLDRYRP 439

Query: 437 EDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIY 473
               +  F +++         +  E     G  G+ Y
Sbjct: 440 ASRFERLFLHKM-------GETHDESTRLFGHYGYNY 469


>gi|227819321|ref|YP_002823292.1| CpaC pilus assembly protein [Sinorhizobium fredii NGR234]
 gi|227338320|gb|ACP22539.1| CpaC pilus assembly protein [Sinorhizobium fredii NGR234]
          Length = 496

 Score =  286 bits (732), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 113/451 (25%), Positives = 208/451 (46%), Gaps = 34/451 (7%)

Query: 44  IGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIG 103
            G  +++++  N  I ++      D+++      DVV  S +++++ GK  G  N+ +  
Sbjct: 46  TGSVQQVTLAPNDTITVRTGKPFGDLVIGSAEMIDVVPLSDQSLFIRGKQTGATNISVYD 105

Query: 104 HDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVEL 163
            +   +  +D+ +  D + +   +R     + +RV   +D + L G VR   + QR +E+
Sbjct: 106 DNKALVGVIDVRVAADFSEVASAIRSTAPSAQVRVFNSNDRIRLTGTVRDAVELQRVMEI 165

Query: 164 SETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITG-- 221
           ++++            S++ V+N L +A   QV L+V + E  R   + +G   S  G  
Sbjct: 166 AQSY------------SAEPVLNQLRVAESQQVMLEVRVIEASRQTGRDLGIGWSGQGRN 213

Query: 222 ----------------SSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALER 265
                            +   +   AA         G   +    +     + V++ALE+
Sbjct: 214 GIGKATTSQGITVDDDGNLARTLGDAAGAATGMQPFGQLIAKVLEISGGQIDIVINALEQ 273

Query: 266 ATAIRTLAEPTLTAISGQSASFTSGGQHLYKTV--SSSTGATSVTTHDYGVVLHFTPTVL 323
              +R LA+P L A+SG++ASF +GG+   ++   + +T AT      +GV L F+P VL
Sbjct: 274 KGLVRRLAQPNLIAMSGETASFHAGGEVPIQSTVANGATLATETDYRPFGVRLTFSPVVL 333

Query: 324 SPGRIGLRIQTEVSEPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKE 383
             G I L+I+ EVSE    ++    P +  R A TTV L  G +  +AGLL+    +  +
Sbjct: 334 DGGLISLKIEPEVSEIDPSISVNGNPGFISRAASTTVALRDGQSFAMAGLLQSVNAKDVQ 393

Query: 384 GIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAM-RDLSRPDDHYSVEDDAKA 442
            +P L ++P++GALFR++ F + E+++ I  TP +V+P     DL  P +     +D + 
Sbjct: 394 QLPWLGQVPVIGALFRSTSFLKRESDLVIVVTPHIVRPSKPGEDLYSPLEQTRSSNDVEL 453

Query: 443 FFFNRVNKIYGPKEASEVEGQNYKGAIGFIY 473
           F    + ++          G+  KG  G   
Sbjct: 454 FALG-ILEVDKDMLRRFRNGEGVKGPYGHRL 483


>gi|296284552|ref|ZP_06862550.1| type II and III secretion system protein [Citromicrobium
           bathyomarinum JL354]
          Length = 502

 Score =  286 bits (732), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 131/476 (27%), Positives = 210/476 (44%), Gaps = 40/476 (8%)

Query: 20  NPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADV 79
               A L     +    +  +   +   + I + + K  ++ VP  + DV +++ + AD+
Sbjct: 1   MLLGAALCAAPLSIVPTMADAQSVVRPTQDIVLSIGKGELINVPGSMADVFIANDSIADI 60

Query: 80  VVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVE 139
            V S R +YLFGK+ G+  V      G  +   ++ +  +I  L+  L   +  + I V 
Sbjct: 61  QVKSQRQLYLFGKSGGETTVYASNAAGDVIWAANVRVGSNIGSLDQMLALAMPQAKISVA 120

Query: 140 MVS-DTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTL 198
            +  +TV+L G V   +D+  A  L   FL               V+  L  A   QV L
Sbjct: 121 TMGSNTVLLTGTVANPEDAAEAERLVSAFLGDET----------NVIARLTTATPLQVNL 170

Query: 199 KVTIAEVRRDILKQIGFQHSITGSSSGPSKSFA----------------------ADFGG 236
           +V  AEV R +++ IG     + +++G                            +D   
Sbjct: 171 QVRFAEVSRSLVRAIGANLLSSDATNGFQFGVTRGRNFAPQYTPGGPVGVGVTGGSDGST 230

Query: 237 KFVSEGGDFSVKGVLD--RFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHL 294
                G   ++ G+           L   E    + TL++P LTA+SG++A F +GG+  
Sbjct: 231 VITGNGTGATIAGLGSLFGMDLAAALDLAETNGLVSTLSQPNLTALSGETADFLAGGEFP 290

Query: 295 YKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGV----NAGDMPS 350
                   GATSV   +YGV L +TPTVL+ GRI +R+  EVSE         +   +P+
Sbjct: 291 IPIS-QGLGATSVEYRNYGVKLTYTPTVLANGRISIRVSPEVSELSSQGAVSLDGVQIPA 349

Query: 351 YRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEI 410
              R+A TTVEL SG + ++AGL+ ++ Q   +  P L  +PILG LFR++ F + ETE+
Sbjct: 350 LITRRASTTVELGSGQSFMIAGLMTNNSQSTIDKAPGLGDVPILGNLFRSNSFRKGETEL 409

Query: 411 FIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYK 466
            I  TP+LVKPV   D+  P D Y+  D      F       G  +       + +
Sbjct: 410 VIVITPYLVKPVDGNDIRLPTDGYNSPDTLSQLGFKETVPQGGVPDRPGPTTSDRQ 465


>gi|149186255|ref|ZP_01864569.1| type II secretion system protein [Erythrobacter sp. SD-21]
 gi|148830286|gb|EDL48723.1| type II secretion system protein [Erythrobacter sp. SD-21]
          Length = 522

 Score =  286 bits (731), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 127/470 (27%), Positives = 208/470 (44%), Gaps = 51/470 (10%)

Query: 41  DVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVI 100
                  ++I + + +  ++ VP ++ DV +S+   ADV V S R +YLFGK+ G+  V 
Sbjct: 30  QSVTSPSQEIVLSIGRGELVNVPGNMADVFISNENVADVQVKSRRQLYLFGKSGGETTVY 89

Query: 101 LIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDT-VVLHGMVRTIQDSQR 159
                G  +   ++ +  +I  ++  L   + ++ I V  + +  V+L G V   +D+  
Sbjct: 90  ASNAAGDIIWAANVRVGSNIGSIDQMLSLAMPEAKINVATMGNNTVLLTGTVAAPEDAAD 149

Query: 160 AVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSI 219
           A  L + ++ +             V++ L +A   QV L+V IAEV R +++ IG   + 
Sbjct: 150 AQSLVQAYVGEGT----------NVISRLRMATPLQVNLQVRIAEVSRSVVRAIGVNLAT 199

Query: 220 TGSSSGPSKSFAADFGGKF-----------------------------------VSEGGD 244
             SSSG         G                                      ++ G  
Sbjct: 200 VDSSSGFQFGVGQGRGAVSQFQPSFVNPVTGERIQGPLAVGQEFEGEGATIIDQITPGST 259

Query: 245 FSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGA 304
               G L        L   E    + TL++P LTA+SG++A F +GG+          G 
Sbjct: 260 LGAFGNLLGLDIGAALDLAETQGLVTTLSQPNLTALSGETAEFLAGGEFPIPLS-QGLGT 318

Query: 305 TSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVI----GVNAGDMPSYRVRKADTTV 360
           T++   +YGV L +TPTVL+ GRI +R++ EVSE        +N   +P+   R+A+TTV
Sbjct: 319 TTIEYKNYGVSLAYTPTVLANGRISIRVRPEVSELSSQGSITLNGFQVPALITRRAETTV 378

Query: 361 ELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVK 420
           EL SG + ++AGLL ++ Q   E  P L  +P++G LFR++ + + ETE+ I  TP+LVK
Sbjct: 379 ELGSGQSFMIAGLLSNNSQNSIEKAPGLGDVPVIGNLFRSTTYRKGETELVIVVTPYLVK 438

Query: 421 PVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIG 470
           PV   D+  P D Y    + +     R                      G
Sbjct: 439 PVNANDIRLPTDGYLKPTEMQRLIALREGDSEAGLVRPMPSANGTGANPG 488


>gi|37680194|ref|NP_934803.1| Flp pilus assembly protein, secretin CpaC [Vibrio vulnificus YJ016]
 gi|37198941|dbj|BAC94774.1| Flp pilus assembly protein, secretin CpaC [Vibrio vulnificus YJ016]
          Length = 462

 Score =  284 bits (726), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 108/457 (23%), Positives = 198/457 (43%), Gaps = 41/457 (8%)

Query: 44  IGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIG 103
               K+I + + +  ++ +  +++ V + D T ADV   S R+  +FG  VG+ +++++G
Sbjct: 20  AHAAKQIDLEVGQSRLIPLSKEMRSVYIVDSTVADVKTPSARSALVFGAKVGKTDLVIVG 79

Query: 104 HDGKQMLNLDILIERD-IAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVE 162
            +G+ + +  + ++   ++ LE  L        I ++ V D++ + G V + + +   + 
Sbjct: 80  KEGEAIAHYRLNVKNSGLSQLEHHLETLYPSHRITLQSVGDSIAVAGTVASPEMAADILS 139

Query: 163 LSETFLSQSGRNQ---------------------YANSSSKKVMNLLNIAGEDQVTLKVT 201
           L   F      ++                        S    V+N L I    QV + + 
Sbjct: 140 LVNNFAVGQVADKERLKEINADASRKSANPPEGPGGQSVLPLVINQLKITAAPQVNISIR 199

Query: 202 IAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLH 261
           + E+ +   +++G +      +           G +F +         ++   +F  ++ 
Sbjct: 200 MVEMAKSTSEELGIRWQSVNPNW----MLGVSPGNQFATGIDLTDPDNLIKESAFMGIID 255

Query: 262 ALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPT 321
           AL   + +  LAEP LTA SG+ A F  GG+  + ++   +    V    +GV L  TPT
Sbjct: 256 ALASKSLVNVLAEPNLTAKSGEKAEFLVGGEFPFPSIDGES--VGVEFKSFGVGLSVTPT 313

Query: 322 VLSPGRIGLRIQTEVS----EPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDD 377
           VLS  RI L +   VS    +  I +N  D+P    R A TT+EL  G +  LAGLL+  
Sbjct: 314 VLSENRISLTVTPVVSALSRQNSIKINGVDVPGLDKRTATTTIELADGQSFALAGLLRTS 373

Query: 378 IQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPV-AMRDLSRPDDHYSV 436
            +   + IP L ++P +GALFR ++  + E E+ I AT  LV+P   +  +  P DH+  
Sbjct: 374 EENSVDAIPFLGELPGVGALFRTNKNQQIERELVIIATASLVQPTGDIESIPTPLDHFRA 433

Query: 437 EDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIY 473
               +   F  +            +     G  G+ Y
Sbjct: 434 PTRLERLLFGELE--------GHTDTPKLIGDYGYRY 462


>gi|320156053|ref|YP_004188432.1| flp pilus assembly protein, secretin CpaC [Vibrio vulnificus
           MO6-24/O]
 gi|319931365|gb|ADV86229.1| flp pilus assembly protein, secretin CpaC [Vibrio vulnificus
           MO6-24/O]
          Length = 462

 Score =  284 bits (726), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 108/457 (23%), Positives = 198/457 (43%), Gaps = 41/457 (8%)

Query: 44  IGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIG 103
               K+I + + +  ++ +  +++ V + D T ADV   S R+  +FG  VG+ +++++G
Sbjct: 20  AHAAKQIDLEVGQSRLIPLSQEMRSVYIVDSTIADVKTPSARSALVFGAKVGKTDLVIVG 79

Query: 104 HDGKQMLNLDILIERD-IAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVE 162
            +G+ + +  + ++   ++ LE  L        I ++ V D++ + G V + + +   + 
Sbjct: 80  KEGEAIAHYRLNVKNSGLSQLERHLETLYPSHRIALQSVGDSIAVAGTVASPEMAADILS 139

Query: 163 LSETFLSQSGRNQ---------------------YANSSSKKVMNLLNIAGEDQVTLKVT 201
           L   F      ++                        S    V+N L I    QV + + 
Sbjct: 140 LVNNFAVGQVADKERLKEINADASRKSANPPEGPGGQSVLPLVINQLKITAAPQVNISIR 199

Query: 202 IAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLH 261
           + E+ +   +++G +      +           G +F +         ++   +F  ++ 
Sbjct: 200 MVEMAKSTSEELGIRWQSVNPNW----MLGVSPGNQFATGIDLTDPDNLIKESAFMGIID 255

Query: 262 ALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPT 321
           AL   + +  LAEP LTA SG+ A F  GG+  + ++   +    V    +GV L  TPT
Sbjct: 256 ALASKSLVNVLAEPNLTAKSGEKAEFLVGGEFPFPSIDGES--VGVEFKSFGVGLSVTPT 313

Query: 322 VLSPGRIGLRIQTEVS----EPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDD 377
           VLS  RI L +   VS    +  I +N  D+P    R A TT+EL  G +  LAGLL+  
Sbjct: 314 VLSENRISLTVTPVVSALSRQNSIKINGVDVPGLDKRTATTTIELADGQSFALAGLLRTS 373

Query: 378 IQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPV-AMRDLSRPDDHYSV 436
            +   + IP L ++P +GALFR ++  + E E+ I AT  LV+P   +  +  P DH+  
Sbjct: 374 EENSVDAIPFLGELPGVGALFRTNKNQQIERELVIIATASLVQPTGDIESIPTPLDHFRA 433

Query: 437 EDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIY 473
               +   F  +            +     G  G+ Y
Sbjct: 434 PTRLERLLFGELE--------GHTDTPKLIGDYGYRY 462


>gi|27365651|ref|NP_761179.1| Flp pilus assembly protein, secretin CpaC [Vibrio vulnificus CMCP6]
 gi|27361799|gb|AAO10706.1| Flp pilus assembly protein, secretin CpaC [Vibrio vulnificus CMCP6]
          Length = 462

 Score =  283 bits (725), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 108/457 (23%), Positives = 198/457 (43%), Gaps = 41/457 (8%)

Query: 44  IGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIG 103
               K+I + + +  ++ +  +++ V + D T ADV   S R+  +FG  VG+ +++++G
Sbjct: 20  AHAAKQIDLEVGQSRLIPLSKEMRSVYIVDSTVADVKTPSARSALVFGAKVGKTDLVIVG 79

Query: 104 HDGKQMLNLDILIERD-IAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVE 162
            +G+ + +  + ++   ++ LE  L        I ++ V D++ + G V + + +   + 
Sbjct: 80  KEGEAIAHYRLNVKNSGLSQLERHLETLYPSHRITLQSVGDSIAVAGTVASPEMAADILS 139

Query: 163 LSETFLSQSGRNQ---------------------YANSSSKKVMNLLNIAGEDQVTLKVT 201
           L   F      ++                        S    V+N L I    QV + + 
Sbjct: 140 LVNNFAVGQVADKERLKEINADASRKSANPPEGPGGQSVLPLVINQLKITAAPQVNISIR 199

Query: 202 IAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLH 261
           + E+ +   +++G +      +           G +F +         ++   +F  ++ 
Sbjct: 200 MVEMAKSTSEELGIRWQSVNPNW----MLGVSPGNQFATGIDLTDPDNLIKESAFMGIID 255

Query: 262 ALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPT 321
           AL   + +  LAEP LTA SG+ A F  GG+  + ++   +    V    +GV L  TPT
Sbjct: 256 ALASKSLVNVLAEPNLTAKSGEKAEFLVGGEFPFPSIDGES--VGVEFKSFGVGLSVTPT 313

Query: 322 VLSPGRIGLRIQTEVS----EPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDD 377
           VLS  RI L +   VS    +  I +N  D+P    R A TT+EL  G +  LAGLL+  
Sbjct: 314 VLSENRISLTVTPVVSALSRQNSIKINGVDVPGLDKRTATTTIELADGQSFALAGLLRTS 373

Query: 378 IQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPV-AMRDLSRPDDHYSV 436
            +   + IP L ++P +GALFR ++  + E E+ I AT  LV+P   +  +  P DH+  
Sbjct: 374 EENSVDAIPFLGELPGVGALFRTNKNQQIERELVIIATASLVQPTGDIESIPTPLDHFRA 433

Query: 437 EDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIY 473
               +   F  +            +     G  G+ Y
Sbjct: 434 PTRLERLLFGELE--------GHTDTPKLIGDYGYRY 462


>gi|162147491|ref|YP_001601952.1| type II and III secretion system protein [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209545598|ref|YP_002277827.1| type II and III secretion system protein [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161786068|emb|CAP55650.1| type II and III secretion system protein [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209533275|gb|ACI53212.1| type II and III secretion system protein [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 473

 Score =  283 bits (724), Expect = 4e-74,   Method: Composition-based stats.
 Identities = 127/489 (25%), Positives = 212/489 (43%), Gaps = 36/489 (7%)

Query: 4   LQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVP 63
           + R    M +    S   + A       A +  +      +     + I      ++++ 
Sbjct: 3   ISRRVLPMAAFAGMSLCLAGADARSTHPAASGSVAHGAHAV-----LGIEEGAGKLVKLD 57

Query: 64  VDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDIL---IERDI 120
               ++ V+DP   +V   SP +M++FG   GQ  VI     G  +    ++        
Sbjct: 58  GIATNIFVADPKVVEVRAASPDSMFVFGVGAGQTTVIATSRSGGVVARYTVVVLPSSYRA 117

Query: 121 AHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSS 180
           + L   + +      I       ++ + G   + + +++A+E +   + + GR     S 
Sbjct: 118 SALRRDVGQQNPRVRIG-TGADGSIGIEGTETSSESAEQALEGATALVGKGGRVGDYAS- 175

Query: 181 SKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITG--SSSGPSKSFAADFGGKF 238
                    + G  QV LKV I E+ R +++++G +        ++       ++     
Sbjct: 176 ---------VPGSIQVNLKVRIVEMSRSLVRELGVEWQSVNALGTAAAIGISTSNPLAAL 226

Query: 239 VSEGGDFSVKGVLDRFS----FETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHL 294
            +E   F+              ETV+ AL +   I +LAEP LT +SGQ+ASF  GG++ 
Sbjct: 227 TTEQSAFNFLSRFSAAGRPVTVETVIDALSQDGLIHSLAEPNLTTVSGQAASFIVGGEYP 286

Query: 295 YKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIG--------VNAG 346
               S +     V    YG+ L F PTVL+ GRI L ++ EVS                 
Sbjct: 287 IPVSSYNNNIN-VQYKQYGISLAFVPTVLADGRISLHVRPEVSALSTQGAVTLSEANGNL 345

Query: 347 DMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNRE 406
            +P+  VR+ADTTVEL SG +  +AGL++D       G+P L  IP+LGALF++S F + 
Sbjct: 346 QIPALTVRRADTTVELGSGQSFAIAGLMQDSTNMQGLGLPFLGDIPVLGALFKSSSFQKN 405

Query: 407 ETEIFIAATPFLVKPVAMRD-LSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNY 465
           E+E+ I  TP+LV+PV     L  PDD+++   D    F  R N IY       V  ++ 
Sbjct: 406 ESELVIVVTPYLVRPVDNESMLHSPDDNWAPPGDLDRIFLMRQN-IYKYAGKKNVARRDV 464

Query: 466 KGAIGFIYK 474
               GF+ +
Sbjct: 465 NSDAGFMVE 473


>gi|85373131|ref|YP_457193.1| type II secretion system protein [Erythrobacter litoralis HTCC2594]
 gi|84786214|gb|ABC62396.1| type II secretion system protein [Erythrobacter litoralis HTCC2594]
          Length = 574

 Score =  281 bits (719), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 128/520 (24%), Positives = 225/520 (43%), Gaps = 72/520 (13%)

Query: 2   RYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQ 61
           + ++R       +   ++ P  A    +  A +         +   + + + + +  ++ 
Sbjct: 25  KTMKRRLIAKALVASLAALPVAAGPAQVAHAQSI--------VKPSQDVVLSIGRGELIS 76

Query: 62  VPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIA 121
           VP  + DV +++   ADV + S R +Y+FGK+ G+  +      G  +   ++ +  +I 
Sbjct: 77  VPGAMADVFIANDAVADVQIKSQRQLYVFGKSGGETTIYASNSAGDVIWAANVRVANNID 136

Query: 122 HLEMTLRRFIADSNIRVEMVS-DTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSS 180
            L+  L   + ++ I    +  +TV+L G V   +D+  A  L   FL            
Sbjct: 137 SLDQMLALAMPEAKIATATMGTNTVLLTGTVAAPEDAAEAERLVTAFLGDGA-------- 188

Query: 181 SKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGP--SKSFAADFGGKF 238
              V++ L +A   QV L+V IAEV R ++++IG   +   ++ G     +   +FG   
Sbjct: 189 --NVISRLKMATPLQVNLQVRIAEVSRSLVREIGSNLTTRDTTDGFLFGVNRGRNFGSIT 246

Query: 239 VSEGGDF----------------------------------------------SVKGVLD 252
             +   F                                              +  G L 
Sbjct: 247 DIDTSGFPQLDASAQFGLPPGSLSLPFNPATGQFVVGGANFPVASNNPGQTALNFAGRLF 306

Query: 253 RFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDY 312
                +     ER   I TL+ P LTA+SG++A+F +GG+          G TS+   ++
Sbjct: 307 GLDIASAFDVGERLGLITTLSNPNLTALSGETATFLAGGEFPIPIS-QGLGTTSIEYRNF 365

Query: 313 GVVLHFTPTVLSPGRIGLRIQTEVSEPVI----GVNAGDMPSYRVRKADTTVELPSGGTI 368
           GV L ++PTVL+ GRI +R++ EVSE        +N   +P+   R+A+TTVEL SG + 
Sbjct: 366 GVSLAYSPTVLANGRISIRVRPEVSELSSQGAITLNGFQIPALTTRRAETTVELGSGQSF 425

Query: 369 VLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLS 428
           ++AGL+ +  Q   +  P L  +PI+G LFR++ F + ETE+ I  TP+LVKPV   D+ 
Sbjct: 426 MIAGLMSNSSQNTVDKAPGLGDVPIIGNLFRSTSFRKGETELVIVVTPYLVKPVDGTDIK 485

Query: 429 RPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGA 468
            P D Y   ++ +       N      +  +   Q+  G 
Sbjct: 486 LPTDGYQTPNELQRTLGFLENDGKTGGDRPKPTAQDRDGP 525


>gi|19749313|gb|AAL98683.1| Y4xJ [Sinorhizobium fredii]
          Length = 411

 Score =  280 bits (717), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 128/458 (27%), Positives = 196/458 (42%), Gaps = 54/458 (11%)

Query: 24  AKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHS 83
                    + AV   +   I     +S  L K   + +P     + V+DP  AD    S
Sbjct: 1   MSAAAENNGDEAVPRAAPNSINATLNLSSSLGK--TVHLPAPAATIFVADPPIADYQAPS 58

Query: 84  PRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSD 143
            RT+++FGK  G+ ++  +  +G+ +  L +++ + I  L   LR  + D  I V     
Sbjct: 59  NRTIFVFGKKFGRTSLFALDENGEALAELHVVVTQPIGDLRAMLRDQVGDYPIHVSYTPR 118

Query: 144 TVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIA 203
             +L G     +    A  ++E FL               ++N + +AG  QV L V +A
Sbjct: 119 GAILSGTAPNAEVVDIAKRVTEQFLGDGA----------PIVNNIKVAGSLQVNLSVRVA 168

Query: 204 EVRRDILKQIGFQHSITGSSSGPSKSFA--ADFGGKFVSEGGDFSVKGVLDRFSFETVLH 261
           EV R  LK +G   S  G                G     GG   +    D  S   VL 
Sbjct: 169 EVSRSSLKALGINLSAFGQFGNFKVGVLNRGAGLGSATGSGGTAEIGFDNDAVSVGAVLD 228

Query: 262 ALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPT 321
           AL +      LAEP LTA+SG++ASF +GG+                         F PT
Sbjct: 229 ALAKEHIASVLAEPNLTAMSGETASFLAGGE-------------------------FVPT 263

Query: 322 VLSPGRIGLRIQTEVSEPV----IGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDD 377
           VL    I + ++ EVSE      + VN   +P+   R+ADT VEL SG + V+ GL++ +
Sbjct: 264 VLDNNLINIHVKPEVSELSLQGAVQVNGIAVPAVSTRRADTVVELASGQSFVIGGLIRRN 323

Query: 378 IQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKP-VAMRDLSRPDDHYSV 436
           +       P L +IPILGALFR+S F +EE+E+ I  TP++V+P      +S P D  + 
Sbjct: 324 VNNDISAFPWLGRIPILGALFRSSSFQKEESELVILVTPYIVRPGSNPNQMSAPTDRMAP 383

Query: 437 EDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
                      +      + A   +  + KG +GFI +
Sbjct: 384 A----------LGTPPRARAAISTDAPSVKGDLGFIIE 411


>gi|237800794|ref|ZP_04589255.1| type III secretion component [Pseudomonas syringae pv. oryzae str.
           1_6]
 gi|331023652|gb|EGI03709.1| type III secretion component [Pseudomonas syringae pv. oryzae str.
           1_6]
          Length = 432

 Score =  278 bits (712), Expect = 9e-73,   Method: Composition-based stats.
 Identities = 124/436 (28%), Positives = 198/436 (45%), Gaps = 37/436 (8%)

Query: 45  GKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGH 104
           G    I + + +  +L     V  V+V++P  AD+ V SP  +Y+FGK  GQ ++I +  
Sbjct: 26  GAEGTIDLAIGEGRVLHFSAPVDSVMVAEPGIADLQVVSPGVIYVFGKTAGQTSLIALDS 85

Query: 105 DGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELS 164
           +G++   L + +    A +   L+     S  R+    + V+  G V+ + ++     L 
Sbjct: 86  EGRETAALSLAVSSGTAAVTRPLKALHPQSRARISASGNRVIASGSVQDVGEATDLNAL- 144

Query: 165 ETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSS 224
                          + +  +N    AG  QV ++V  AEV R  L + G   +   ++ 
Sbjct: 145 ---------LSSEGQNFQSSVNSATYAGAAQVNIRVRFAEVSRSELLRYGVNWNALFNNG 195

Query: 225 GPSKSFAADFGGKFVSEGGD---FSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAIS 281
             S            +  G     S        + + +L AL+    +  LAEP +TA++
Sbjct: 196 TFSFGLLTGGSLAADAASGASNVISAGLTSGNVNIDAMLEALQSNGVLEVLAEPNITAMT 255

Query: 282 GQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVI 341
           GQ+ASF +GG+ +   V  +     +    YGV L F+PT+L  GRI L+++ EVS  + 
Sbjct: 256 GQTASFLAGGE-VAVPVPVNREVVGIEYKPYGVSLLFSPTLLPNGRIALQVRPEVSSLMS 314

Query: 342 GV----NAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGAL 397
                 N   +PS+RVR+ADT VE+ SG T  +AGL + +  Q  + +P+L  +PILG L
Sbjct: 315 TTTLDVNGYQVPSFRVRRADTRVEVGSGQTFAIAGLFQRESSQDMDKVPMLGDMPILGNL 374

Query: 398 FRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEA 457
           FR+ RF R ETE+ I  TP+LV+PV  R  + P D                         
Sbjct: 375 FRSKRFQRNETELVILITPYLVEPVKERVAATPLDKQRATS------------------- 415

Query: 458 SEVEGQNYKGAIGFIY 473
           +   G    GA GF  
Sbjct: 416 TASAGPRSGGAFGFYM 431


>gi|269105132|ref|ZP_06157826.1| type II/IV secretion system secretin RcpA/CpaC associated with Flp
           pilus assembly [Photobacterium damselae subsp. damselae
           CIP 102761]
 gi|268160582|gb|EEZ39081.1| type II/IV secretion system secretin RcpA/CpaC associated with Flp
           pilus assembly [Photobacterium damselae subsp. damselae
           CIP 102761]
          Length = 442

 Score =  278 bits (711), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 115/426 (26%), Positives = 192/426 (45%), Gaps = 38/426 (8%)

Query: 36  VINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVG 95
           +I+I  V       +++       + V  ++  V +SDP  AD  V     + +FGK +G
Sbjct: 13  IISIYSVIASAESLLNLSEGDAATVPVDTEIDSVFISDPAIADYQVIDKNKVVIFGKKIG 72

Query: 96  QANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQ 155
             N+ +  ++G ++ N  +++ + +  ++  +     D+NI +    + VVL G V   Q
Sbjct: 73  HTNLFIFDNEGNELANRKVIVNKSLREIKQYISIKFPDANIDIFNFGEQVVLSGTVSNEQ 132

Query: 156 DSQRAVELSETFLSQSGRNQYANSSSK---------------KVMNLLNIAGEDQVTLKV 200
                  +  T LS+   +   N  +                 ++N + +    QV +K+
Sbjct: 133 VKDEINNIVGTLLSKKSNDFNFNLETDDQDYEVQFMKQKHFTGLVNNIEVLATRQVNVKL 192

Query: 201 TIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVL 260
           +IAEV    L+QIG Q++  G + G   +   +F                       +V+
Sbjct: 193 SIAEVSHSFLEQIGVQYNSIGHAPGVFVNPLTNFSAS-----------------DILSVI 235

Query: 261 HALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTP 320
            A+      + LAEP L+ ISG+SASF  GG+    T+  +   T+VT  ++GV L    
Sbjct: 236 TAIGNDGIGQVLAEPNLSVISGESASFLVGGELPVVTIVDNG--TNVTYKEFGVKLELLA 293

Query: 321 TVLSPGRIGLRIQTEVSEPVIGVNAG--DMPSYRVRKADTTVELPSGGTIVLAGLLKDDI 378
            V    +I L +  EVS      +    D+P+ + R+A TTVEL  G + VL GLL  + 
Sbjct: 294 KVRKDDKITLSLMPEVSSLDTQYSNDKYDLPALKTRRARTTVELGDGQSFVLGGLLSTED 353

Query: 379 QQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVED 438
           ++    +P +  IP+LGALFRNSR  R +TE+ I AT  LV+P+    +  P        
Sbjct: 354 KERLNKVPYIGDIPVLGALFRNSRTERNKTELIIVATVNLVQPIHPSQVQLPT--IRKTT 411

Query: 439 DAKAFF 444
               FF
Sbjct: 412 TLDRFF 417


>gi|326797327|ref|YP_004315147.1| type II and III secretion system protein [Marinomonas mediterranea
           MMB-1]
 gi|326548091|gb|ADZ93311.1| type II and III secretion system protein [Marinomonas mediterranea
           MMB-1]
          Length = 464

 Score =  278 bits (711), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 115/445 (25%), Positives = 208/445 (46%), Gaps = 18/445 (4%)

Query: 7   TFFTMMSIFLFSSNPSVAKLPPIKEAN--AAVINISDVEIGKGKKISIGLNKVIILQVPV 64
            F T+ ++    S  + A     + A+  + +      E+    ++ + +N+  +L +P 
Sbjct: 6   YFLTLFAVCSVQSTLAFATYDVDQPADNNSRIAESRFEEVAVSGQVKLHVNQGTLLNLPK 65

Query: 65  DVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLE 124
               VL+++P  A   + SP  +++F K  G   +  +  +   ++ + +    D+  L 
Sbjct: 66  AASKVLIANPEVASFQMPSPDNVFVFAKAPGDTTLYALDENNDVIIAVTLTSGYDLEGLT 125

Query: 125 MTLRRFIADSNIRVEMVSDT-VVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSK- 182
             + + +  + ++V   +D  +++ G V+T Q +++ +   E++L  S            
Sbjct: 126 RQVAKEVPGTEVQVGPATDKGLIVRGTVQTPQQAKQVISSVESYLGASTSANGRGGRGGQ 185

Query: 183 -----KVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADF--G 235
                +++N L +A   QV + V I EV R +   +GF       ++       +     
Sbjct: 186 SNQSLRIVNQLKVALSSQVNISVRIVEVSRSLTHALGFSWDTLFDNNTGFIRNGSSLFDA 245

Query: 236 GKFVSEGGDFSVKGVLDR-FSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHL 294
              V +G   S+  +         VL AL        LAEP LTA+SG++A F  GG+  
Sbjct: 246 STGVFDGSGISLGVLGGTIGDVGGVLSALSNDGMASILAEPNLTAMSGETAGFAVGGEVP 305

Query: 295 YKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGV----NAGDMPS 350
              V  +  + ++    YGV++  TPT+LSP RI L I  EVS+         N   +P+
Sbjct: 306 I--VIQTNNSVTIEYKQYGVIMRMTPTLLSPNRISLHIAPEVSDLSDDGSVVLNDTTIPA 363

Query: 351 YRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEI 410
           ++VR+A+TTVEL SG +  LAG+L+  + Q   G+P L  IP+LG +F      +EETE+
Sbjct: 364 FKVRRANTTVELASGQSFALAGMLRSSVSQTVSGVPGLRSIPVLGRMFETEINQKEETEL 423

Query: 411 FIAATPFLVKPVAMRDLSRPDDHYS 435
            I AT ++V+P +  +L  P    S
Sbjct: 424 VIIATAYIVEPTSANNLQSPAQGIS 448


>gi|312621080|ref|YP_003993808.1| type ii/iv secretion system secretin rcpa/cpac,associated with flp
           pilus assembly [Photobacterium damselae subsp. damselae]
 gi|311872801|emb|CBX86892.1| Type II/IV secretion system secretin RcpA/CpaC,associated with Flp
           pilus assembly [Photobacterium damselae subsp. damselae]
          Length = 438

 Score =  278 bits (711), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 115/426 (26%), Positives = 192/426 (45%), Gaps = 38/426 (8%)

Query: 36  VINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVG 95
           +I+I  V       +++       + V  ++  V +SDP  AD  V     + +FGK +G
Sbjct: 9   IISIYSVIASAESLLNLSEGDAATVPVDTEIDSVFISDPAIADYQVIDKNKVVIFGKKIG 68

Query: 96  QANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQ 155
             N+ +  ++G ++ N  +++ + +  ++  +     D+NI +    + VVL G V   Q
Sbjct: 69  HTNLFIFDNEGNELANRKVIVNKSLREIKQYISIKFPDANIDIFNFGEQVVLSGTVSNEQ 128

Query: 156 DSQRAVELSETFLSQSGRNQYANSSSK---------------KVMNLLNIAGEDQVTLKV 200
                  +  T LS+   +   N  +                 ++N + +    QV +K+
Sbjct: 129 VKDEINNIVGTLLSKKSNDFNFNLETDDQDYEVQFMKQKHFTGLVNNIEVLATRQVNVKL 188

Query: 201 TIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVL 260
           +IAEV    L+QIG Q++  G + G   +   +F                       +V+
Sbjct: 189 SIAEVSHSFLEQIGVQYNSIGHAPGVFVNPLTNFSAS-----------------DILSVI 231

Query: 261 HALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTP 320
            A+      + LAEP L+ ISG+SASF  GG+    T+  +   T+VT  ++GV L    
Sbjct: 232 TAIGNDGIGQVLAEPNLSVISGESASFLVGGELPVVTIVDNG--TNVTYKEFGVKLELLA 289

Query: 321 TVLSPGRIGLRIQTEVSEPVIGVNAG--DMPSYRVRKADTTVELPSGGTIVLAGLLKDDI 378
            V    +I L +  EVS      +    D+P+ + R+A TTVEL  G + VL GLL  + 
Sbjct: 290 KVRKDDKITLSLMPEVSSLDTQYSNDKYDLPALKTRRARTTVELGDGQSFVLGGLLSTED 349

Query: 379 QQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVED 438
           ++    +P +  IP+LGALFRNSR  R +TE+ I AT  LV+P+    +  P        
Sbjct: 350 KERLNKVPYIGDIPVLGALFRNSRTERNKTELIIVATVNLVQPIHPSQVQLPT--IRKTT 407

Query: 439 DAKAFF 444
               FF
Sbjct: 408 TLDRFF 413


>gi|56477528|ref|YP_159117.1| outer membrane channel protein [Aromatoleum aromaticum EbN1]
 gi|56313571|emb|CAI08216.1| probable outer membrane channel protein,probably involved in pilus
           assembly [Aromatoleum aromaticum EbN1]
          Length = 566

 Score =  278 bits (710), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 127/535 (23%), Positives = 217/535 (40%), Gaps = 91/535 (17%)

Query: 22  SVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKA---- 77
           + +  P +  A         VEI     ++I + K  +++  V V  +L+ +P  A    
Sbjct: 35  TSSATPRVAVATTNGSPCGRVEIAPM--VTIPVGKSSVIRPEVPVTRILLGNPDNAQAAR 92

Query: 78  ---------------------------DVVVHSPRTMYLFGKNVGQANVILIGHDGKQML 110
                                      DV++ SP  +YL GK+VG  NV+L+   G    
Sbjct: 93  PSAEPAKDDKGGQQAKQSDGRPGVAQVDVLLLSPNEIYLLGKSVGSTNVVLVDRSGGC-T 151

Query: 111 NLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLS 169
            LD+ +  D+  ++  L   + D   I+V    D++VL G V       RAVE++  ++ 
Sbjct: 152 ALDVTVAMDVTSVQGALTALLPDETGIKVSSAYDSLVLTGTVSDATKVDRAVEIASAYVR 211

Query: 170 QSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQH------------ 217
                +   ++  +V+N+L++    QV L+V +AEV + ++ + G               
Sbjct: 212 DGDGGENGRNA--RVLNMLSVGAPQQVMLEVKVAEVSKAVMDRFGIDFSRAYAAGDGTMI 269

Query: 218 ---SITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVL-------------- 260
              S       P     +   G  V  G   S+       +    +              
Sbjct: 270 RFLSGVFGGKSPVGGQVSGTVGARVGGGIVDSISNASGTSAITAPIGDATIGGDATKVPL 329

Query: 261 -----------HALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSV-- 307
                       A +    ++ LAEPT+ AISGQ  SF +GG+       +  G  +V  
Sbjct: 330 ISGSNSTLIGVDAQKSDGLVKILAEPTVMAISGQEGSFLAGGKIFIPVSQNDGGTRTVTL 389

Query: 308 TTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGD---------MPSYRVRKADT 358
              ++GV + FTPTVL  GRI L ++ EVSE                  +PS+  R+A T
Sbjct: 390 EEKEFGVSVKFTPTVLEGGRINLAVRPEVSELNREGVGLTAPGVNGLAILPSFTTRRAFT 449

Query: 359 TVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFL 418
           TV+L  G +  + GL+K++     +  P L ++P++GALFR++ F  + +E+    TP L
Sbjct: 450 TVQLRDGQSFAIGGLIKNNTTTNIKAFPFLGELPVIGALFRSTEFQTDRSELVFVITPRL 509

Query: 419 VKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKE--ASEVEGQNYKGAIGF 471
           VKP+   D + P D+Y     +   +  ++             + G+      GF
Sbjct: 510 VKPL-PEDYALPTDNYVEPSRSDVIWRGKLEGKGPAPADHPDLLPGEENSARGGF 563


>gi|167836689|ref|ZP_02463572.1| RhcC2 [Burkholderia thailandensis MSMB43]
          Length = 460

 Score =  278 bits (710), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 128/486 (26%), Positives = 223/486 (45%), Gaps = 43/486 (8%)

Query: 1   MRYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIIL 60
           +R    T  T+    L    P                         G  +++      +L
Sbjct: 5   LRADLHTCMTIACAALVGFVPGA----------------HVHADPVGPVLTVAAGGGEML 48

Query: 61  QVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDI 120
           ++P     V ++DP  ADV V +P+++++ GK  G   +  +G + + +L   I++  D 
Sbjct: 49  KLPEPAGAVFIADPDVADVHVPTPQSVFVLGKKAGTTTLFALGSNNRTILRETIVVNADT 108

Query: 121 AHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSS 180
             L+  L     + ++ +     ++++ G V +  D+   V+  + +L +          
Sbjct: 109 PTLQRILDARFPNLHLTLTSAPGSLMVAGHVPSPSDADAVVQTLKPYLHEK--------- 159

Query: 181 SKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKS-------FAAD 233
            + ++N + +A   QV L+V + E+ R+I +Q+G   S  G+S             F   
Sbjct: 160 -ETLVNRMTLARPIQVHLRVRVTEIDRNITQQLGINWSAIGASGNFVGGLFNGRTLFDPT 218

Query: 234 FGGKFVSEGGDFSVKGVL--DRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGG 291
                +S  G FSV G     R+S + VL AL++   I  LAEP LT +SG++ASF +GG
Sbjct: 219 SRLFNLSPTGAFSVLGGFHTSRYSVDGVLDALDQEGLITMLAEPNLTTMSGETASFLAGG 278

Query: 292 QHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEP----VIGVNAGD 347
           +        +TGA ++    +GV L FTPTVL+  RI L+++ EVSE      +  N   
Sbjct: 279 EFPIPVSQDTTGAITIEFKPFGVSLDFTPTVLADNRISLKVRPEVSEIDPVNSVTSNGIR 338

Query: 348 MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREE 407
           +P+  VR+ +TTVEL SG +  + GLL+     +   +P L+++P+LG LF +  +  ++
Sbjct: 339 VPALTVRRVETTVELSSGQSFAIGGLLQSKTSDVLAELPGLARLPVLGKLFSSKNYLNDK 398

Query: 408 TEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKG 467
           TE+ +  TP++V+PV   +L    D  +       +   R   I         +     G
Sbjct: 399 TEVVVIVTPYVVQPVGPGELRDALDSVTQPSSDIEYVLQRAIGIDPLSG----DLPRLVG 454

Query: 468 AIGFIY 473
           A GFIY
Sbjct: 455 AAGFIY 460


>gi|307293450|ref|ZP_07573296.1| type II and III secretion system protein [Sphingobium
           chlorophenolicum L-1]
 gi|306881516|gb|EFN12732.1| type II and III secretion system protein [Sphingobium
           chlorophenolicum L-1]
          Length = 499

 Score =  277 bits (707), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 118/428 (27%), Positives = 203/428 (47%), Gaps = 26/428 (6%)

Query: 49  KISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQ 108
            I + +    ++ +P  + DV++ DP   DV V S   +YL  K  G+  V     +GK 
Sbjct: 46  AILLSVGGSKVINLPAKMSDVVIGDPDVVDVHVRSQNQLYLIAKKAGETTVFATAINGKV 105

Query: 109 MLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFL 168
           + +  + +  ++  ++  L+  + ++ I V  ++  V+L G +   +D+  A  L++ F+
Sbjct: 106 LFSGTVRVGNNLTSIDDMLKLAMPNAEIAVNKMNGMVLLTGTIAAPEDAAEAERLTQAFV 165

Query: 169 SQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITG------- 221
            +             V++ L  A   QV L+V IAEV +D+  +IG              
Sbjct: 166 GKEVT----------VVSRLRTATPLQVNLQVKIAEVSKDVGHKIGMNWKSQDLTGGKWA 215

Query: 222 ------SSSGPSKSFAADFGGKFVSEGG-DFSVKGVLDRFSFETVLHALERATAIRTLAE 274
                 +    + +        F ++GG   +    +       VL   E +    TLA+
Sbjct: 216 GGIGGGTRDAITFNSGGGGTFNFTADGGYSLAGVARVLGLDLGAVLDLAESSGLATTLAQ 275

Query: 275 PTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQT 334
           P LT++SG++ASF +GG++ Y   + + G  S+    YGV L FTPTVL+ GRI LR++ 
Sbjct: 276 PNLTSLSGETASFLAGGEYPYTVSNGTQG-NSIEFKQYGVQLAFTPTVLADGRISLRVRP 334

Query: 335 EVSEPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPIL 394
            V   +    +  +P+ R R A+TTVEL SG   ++AGLL +D       +P +  +PIL
Sbjct: 335 TV-SSLDFSVSSSVPALRSRTAETTVELGSGQAFMIAGLLNNDTANNINKVPGIGNLPIL 393

Query: 395 GALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGP 454
           G+LF++  F R ETE+ I  TP+LVKP+   D+  P D +   ++ +  F  +       
Sbjct: 394 GSLFKSRNFQRHETELVIVVTPYLVKPMNASDVRLPTDGFRNANEGQGLFLQQGQDGVSG 453

Query: 455 KEASEVEG 462
             +     
Sbjct: 454 ARSPMPSR 461


>gi|123443821|ref|YP_001007792.1| putative tight adherance operon protein [Yersinia enterocolitica
           subsp. enterocolitica 8081]
 gi|122090782|emb|CAL13664.1| putative tight adherance operon protein [Yersinia enterocolitica
           subsp. enterocolitica 8081]
          Length = 453

 Score =  276 bits (706), Expect = 5e-72,   Method: Composition-based stats.
 Identities = 106/417 (25%), Positives = 192/417 (46%), Gaps = 33/417 (7%)

Query: 45  GKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGH 104
              + + +   +  +++   ++  V VS    AD  +    ++ ++ K  G A  IL   
Sbjct: 30  ANAEPVYLSTGESYMIKTQEEIDTVFVSAAAIADYELVGKNSIIVYAKQEGTAEFILFNQ 89

Query: 105 DGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELS 164
           +   +    IL++  I      +R    +S+I +  + D+ +L G V T +  +    + 
Sbjct: 90  NHHPIKKSAILVDNTITAAHKRIRLEYPESDIEINKIGDSYILTGTVETEEAKETIASII 149

Query: 165 ETFLSQSGRNQYANSSSK-------------KVMNLLNIAGEDQVTLKVTIAEVRRDILK 211
              +         +                 +V+N + + G +QV +K+TIAEV +D  +
Sbjct: 150 GEAIGSEKTIASNSKKDSDGNSQYFNSPEYSRVVNKIKLPGSNQVNVKLTIAEVSKDFSE 209

Query: 212 QIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRT 271
            IG   S  G+ SG  + F  +   KF ++G                ++HA+   +  R 
Sbjct: 210 NIGMDWSTIGNFSGSFQFFKPNGLNKFNAKG-------------ISALVHAINDDSIARV 256

Query: 272 LAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLR 331
           LAEP L+ +SG+SASF  GG+     V+++  +T +T   +G+ L+    V +  RI ++
Sbjct: 257 LAEPNLSVLSGESASFLVGGELPL--VNTTANSTVITYKQFGIKLNIGAKVNAKKRIRIK 314

Query: 332 IQTEVSEPV---IGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLL 388
           +  EVS              PS+R RKA TT+EL  G + +L GL+    ++  + IP +
Sbjct: 315 LDEEVSSVDKVFNIDGGDAYPSFRTRKAATTLELGDGESFILGGLISSSEREALKKIPFI 374

Query: 389 SKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFF 445
             IPILGA FRN+   + +TE+ + AT  LV+PV+ +++  P  ++      + FF 
Sbjct: 375 GDIPILGAFFRNAETRKNQTELVVVATVNLVRPVSEKEVELP--NFMHTSTLERFFN 429


>gi|194335913|ref|YP_002017707.1| type II and III secretion system protein [Pelodictyon
           phaeoclathratiforme BU-1]
 gi|194308390|gb|ACF43090.1| type II and III secretion system protein [Pelodictyon
           phaeoclathratiforme BU-1]
          Length = 510

 Score =  276 bits (706), Expect = 5e-72,   Method: Composition-based stats.
 Identities = 106/502 (21%), Positives = 197/502 (39%), Gaps = 66/502 (13%)

Query: 9   FTMMSIFLFSSNP--SVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDV 66
            + +   L  + P  ++A   P++  + + + +          + + L +  + +    +
Sbjct: 15  MSALVALLVGTVPMATMASPEPVRRRDDSYVTVVSEMTAPSIYL-VPLGESRVYRFAQPI 73

Query: 67  QDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMT 126
           + V + DP  AD ++ +   +YL GK +G  N+ +   +G  + +  + + R    L+  
Sbjct: 74  KRVAMGDPKVADYIMLNRFEVYLLGKKMGSTNLAVWDQNGN-LTSSPVQVSRGTTALQAL 132

Query: 127 LRRFIADSN-IRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSS----- 180
           L+      N I +  +   +VL G V     ++    L  ++   S  +    S+     
Sbjct: 133 LKVLFPKENDIHLLALGPALVLSGSVSDALVAESVARLVRSYFGGSVSSGTPESALVGTD 192

Query: 181 ------------------------------------SKKVMNLLNIAGEDQVTLKVTIAE 204
                                               ++ V+NLL +    QV L+V IA+
Sbjct: 193 SKPFTGIIEEMSKDVVFSKTESHSKETTTHGGESDSTRGVVNLLKVRDSQQVRLEVCIAQ 252

Query: 205 VRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALE 264
           V R  ++ +G                 +     FVS     ++       +    + A  
Sbjct: 253 VSRTFIESLGISFF-----KTSGDIQGSTLLSGFVSNATLNNLLLGRLGQANGIKMVADR 307

Query: 265 RATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHD----------YGV 314
           + +  + LAEPT+  +SG+   F  GG+             ++  +D          YGV
Sbjct: 308 KPSLFKVLAEPTIVTMSGKEGFFLVGGKIYVPVRVIDYSPINLQEYDKYYISYKEYLYGV 367

Query: 315 VLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGD----MPSYRVRKADTTVELPSGGTIVL 370
            L F P VL  GRI L++ +EVSEP            +P +++    T V++  G  +V+
Sbjct: 368 GLRFMPVVLDAGRISLKVVSEVSEPDTESATSGTKANLPLFKISTVSTNVQMNEGENLVI 427

Query: 371 AGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRP 430
            GL  D+     + +PLLS+IPILGALFR+++ N E+TE+ +   P LVK  +      P
Sbjct: 428 GGLKLDNFANAIDSVPLLSEIPILGALFRDTKKNAEKTELMVIIRPTLVK-GSATMPELP 486

Query: 431 DDHYSVEDDAKAFFFNRVNKIY 452
            D        + F   ++    
Sbjct: 487 TDRVIPPTRKELFLDGKLEGSP 508


>gi|330876206|gb|EGH10355.1| type III secretion component [Pseudomonas syringae pv. morsprunorum
           str. M302280PT]
          Length = 437

 Score =  276 bits (706), Expect = 5e-72,   Method: Composition-based stats.
 Identities = 124/436 (28%), Positives = 199/436 (45%), Gaps = 37/436 (8%)

Query: 45  GKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGH 104
           G    + + + +  +L     V  V+V++P  AD+ V SP  +Y+FGK  GQ ++I +  
Sbjct: 31  GAKGTVDLAIGEGRVLHFSAPVDSVMVAEPGIADLQVVSPGVIYVFGKAAGQTSLIALDS 90

Query: 105 DGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELS 164
           +G++   L + +    A +   L+     S  R+      V+  G V+ + ++     L 
Sbjct: 91  EGRETAALSLAVSSGTAAVTRPLKALHPQSQARINASGSRVIASGSVQDVGEATDLNAL- 149

Query: 165 ETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSS 224
                          + +  +N    AG  QV ++V  AEV R  L + G   +   ++ 
Sbjct: 150 ---------LSTEGQNFQSTVNSATYAGSAQVNIRVRFAEVSRSELLRYGVNWNALFNNG 200

Query: 225 GPSKSFAADFGGKFVSE---GGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAIS 281
             S       G    +        S        + + +L AL+    +  LAEP +TA++
Sbjct: 201 TFSFGLLTGGGLAADAAGGASNVISAGLASGNVNIDAMLEALQSNGVLEVLAEPNITAMT 260

Query: 282 GQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVI 341
           GQ+ASF +GG+ +   V  +     +    YGV L F+PT+L  GRI L+++ EVS  + 
Sbjct: 261 GQTASFLAGGE-VAVPVPVNREVVGIEYKPYGVSLLFSPTLLPNGRIALQVRPEVSSLMS 319

Query: 342 G----VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGAL 397
                VN   +PS+RVR+ADT VE+ SG T  +AGL + +  Q  + +P+L  +PILG L
Sbjct: 320 TSTLDVNGYQVPSFRVRRADTRVEVGSGQTFAIAGLFQRESSQDMDKVPMLGDMPILGNL 379

Query: 398 FRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEA 457
           FR+ RF R ETE+ I  TP+LV+PV  R ++ P D                         
Sbjct: 380 FRSKRFQRNETELVILITPYLVEPVKARVVATPLDKQRAAS------------------- 420

Query: 458 SEVEGQNYKGAIGFIY 473
           +   G    GA GF  
Sbjct: 421 TASAGPRSGGAFGFYM 436


>gi|330953268|gb|EGH53528.1| type III secretion component [Pseudomonas syringae Cit 7]
          Length = 438

 Score =  276 bits (706), Expect = 5e-72,   Method: Composition-based stats.
 Identities = 127/463 (27%), Positives = 205/463 (44%), Gaps = 37/463 (7%)

Query: 18  SSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKA 77
           +S   +  L       A   N   +  G    + + + +  +L     V  V+V++P  A
Sbjct: 5   ASVIRLLFLALSALLIAGGANAETIAKGAKGTVDLAIGEGRVLHFSAPVDSVMVAEPGIA 64

Query: 78  DVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIR 137
           D+ V SP  +Y+FGK  GQ ++I +  +G++   L + +    A +   L+     S  R
Sbjct: 65  DLQVVSPGVIYVFGKTAGQTSLIALDSEGRETATLSLAVSSGTAAVSRPLKALHPQSQAR 124

Query: 138 VEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVT 197
           +      V+  G V+ + ++     L                + +  +N    AG  QV 
Sbjct: 125 INASGSRVIASGAVQDVGEATDLNAL----------LSTEGQNFQSTVNSATYAGSAQVN 174

Query: 198 LKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGD---FSVKGVLDRF 254
           ++V  AEV R  L + G   +   ++   S            +  G     S        
Sbjct: 175 IRVRFAEVSRSELLRYGVNWNALFNNGTFSFGLLTGGSLAADAASGASNVISAGLTSGNV 234

Query: 255 SFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGV 314
           + + +L AL+    +  LAEP +TA++GQ+ASF +GG+ +   V  +     +    YGV
Sbjct: 235 NIDAMLEALQNNGVLEVLAEPNITAMTGQTASFLAGGE-VAVPVPVNREVVGIEYKPYGV 293

Query: 315 VLHFTPTVLSPGRIGLRIQTEVSEPVIGV----NAGDMPSYRVRKADTTVELPSGGTIVL 370
            L F+PT+L  GRI L+++ EVS  +       N   +PS+RVR+ADT VE+ SG T  +
Sbjct: 294 SLLFSPTLLPNGRIALQVRPEVSSLMSTTTLDVNGYQVPSFRVRRADTRVEVGSGQTFAI 353

Query: 371 AGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRP 430
           AGL + +  Q  + +P+L  +PILG+LFR+ RF R ETE+ I  TP+LV+PV  R  + P
Sbjct: 354 AGLFQRESSQDMDKVPMLGDMPILGSLFRSKRFQRNETELVILITPYLVEPVKERVAATP 413

Query: 431 DDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIY 473
            D                         +   G    GA GF  
Sbjct: 414 LDKQRAAS-------------------TAAAGPRSGGAFGFYM 437


>gi|253701800|ref|YP_003022989.1| type II and III secretion system protein [Geobacter sp. M21]
 gi|251776650|gb|ACT19231.1| type II and III secretion system protein [Geobacter sp. M21]
          Length = 451

 Score =  276 bits (705), Expect = 7e-72,   Method: Composition-based stats.
 Identities = 109/431 (25%), Positives = 182/431 (42%), Gaps = 47/431 (10%)

Query: 51  SIGLNKVIILQVPVDVQDVLVSDPTKADV-VVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           ++ +N+ ++L +    + V ++D    DV        + + GK +G  N+I+   + +  
Sbjct: 33  TVIVNRGVVLNLKNPARYVNITDKDVIDVPDPLRRNQLLINGKKIGSTNLIVWEENNENP 92

Query: 110 LNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLS 169
              D+ +  D   +E  +R +  + +I V+   DTVVL G V      ++A E+++ + +
Sbjct: 93  TFFDVRVVGDREAIESQIRDYAPNDDISVQYAQDTVVLSGKVANEMTGKKAEEIAKAYSA 152

Query: 170 QSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKS 229
                        KV+N + +    QV L+V +A+V R  LK++G    + G ++    +
Sbjct: 153 -------------KVLNHITVDEPQQVLLQVKVAQVDRTSLKRLGISAMVKGRTAEGFMN 199

Query: 230 FAADFGGKFVSEGGD---------------------------FSVKGVLDRFSFETVLHA 262
                 G                                   F+V           VL A
Sbjct: 200 LVGAPSGTSSVTNSSATRFTSTEASGIAGSIPGLGSFDPLDAFNVGVSYFPAGIGAVLQA 259

Query: 263 LERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTG--ATSVTTHDYGVVLHFTP 320
           L      + LAEP L   SG+  +F +G +  Y  + S+ G   +S+     GV L F P
Sbjct: 260 LSSKGLAKILAEPNLLVKSGEEGNFLAGSRIPYSVLISTGGASTSSIIFETVGVKLKFKP 319

Query: 321 TVLSPGRIGLRIQT-EVSEPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQ 379
            VL  G I L+I   EVS     +     P    R   T VEL  G +++LAGLL+++  
Sbjct: 320 QVLQNGLINLKIDPAEVSSIAGTLAVNGYPIIDTRDVRTDVELRDGESLILAGLLQEEQI 379

Query: 380 QLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMR-DLSRPDDHYSVED 438
           +    IPLL  IPILGALFR+S+ +  E ++    TP +VKP         P D  +  +
Sbjct: 380 KTMSKIPLLGDIPILGALFRSSQKDIREKDLVFFITPKIVKPTPAGVATKLPTDAVTPAE 439

Query: 439 DAKAFF--FNR 447
           +    +    R
Sbjct: 440 EKGYDWIPLGR 450


>gi|289624387|ref|ZP_06457341.1| type III secretion component, putative [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289646614|ref|ZP_06477957.1| type III secretion component, putative [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|330868629|gb|EGH03338.1| type III secretion component [Pseudomonas syringae pv. aesculi str.
           0893_23]
          Length = 429

 Score =  275 bits (704), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 122/436 (27%), Positives = 197/436 (45%), Gaps = 37/436 (8%)

Query: 45  GKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGH 104
           G    + + + +  +L     V  V+V++P  AD+ V SP  +Y+FGK  GQ ++I +  
Sbjct: 23  GAKGTVDLAIGEGRVLHFSAPVDSVMVAEPGIADLQVVSPGVIYVFGKAAGQTSLIALDS 82

Query: 105 DGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELS 164
           +G++   L + +    A +   L+     S  R+      V+  G V+ + ++     L 
Sbjct: 83  EGRETAALSLAVSSGTAAVTRPLKALHPQSQARINASGSRVIASGSVQDVGEATDLNAL- 141

Query: 165 ETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSS 224
                          + +  +N    AG  QV ++V  AEV R  L + G   +   ++ 
Sbjct: 142 ---------LSTEGQNFQSTVNSATYAGSAQVNIRVRFAEVSRSELLRYGVNWNALFNNG 192

Query: 225 GPSKSFAADFGGKFVSE---GGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAIS 281
             S            +        S        + + +L AL+    +  LAEP +TA++
Sbjct: 193 TFSFGLLTGGALAADAAGGASNVISAGLASGNVNIDAMLEALQSNGVLEVLAEPNITAMT 252

Query: 282 GQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVI 341
           GQ+ASF +GG+ +   V  +     +    YGV L F+PT+L  GRI L+++ EVS  + 
Sbjct: 253 GQTASFLAGGE-VAVPVPVNREVVGIEYKPYGVSLLFSPTLLPNGRIALQVRPEVSSLMS 311

Query: 342 GV----NAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGAL 397
                 N   +PS+RVR+ADT VE+ SG T  +AGL + +  Q  + +P+L  +PILG L
Sbjct: 312 TTTLDVNGYQVPSFRVRRADTRVEVGSGQTFAIAGLFQRESSQDMDKVPMLGDMPILGNL 371

Query: 398 FRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEA 457
           FR+ RF R ETE+ I  TP+LV+PV  R ++ P D                         
Sbjct: 372 FRSKRFQRNETELVILITPYLVEPVKDRVVATPLDKQRAAS------------------- 412

Query: 458 SEVEGQNYKGAIGFIY 473
           +   G    GA GF  
Sbjct: 413 TASAGPRSGGAFGFYM 428


>gi|330985203|gb|EGH83306.1| type III secretion component [Pseudomonas syringae pv. lachrymans
           str. M301315]
          Length = 429

 Score =  275 bits (704), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 121/436 (27%), Positives = 197/436 (45%), Gaps = 37/436 (8%)

Query: 45  GKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGH 104
           G    + + + +  +L     +  V+V++P  AD+ V SP  +Y+FGK  GQ ++I +  
Sbjct: 23  GAKGTVDLAIGEGRVLHFSAPLDSVMVAEPGIADLQVVSPGVIYVFGKAAGQTSLIALDS 82

Query: 105 DGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELS 164
           +G++   L + +    A +   L+     S  R+      V+  G V+ + ++     L 
Sbjct: 83  EGRETAALSLAVSSSTAAVTRPLKALHPQSQARINASGSRVIASGSVQDVGEATDLNAL- 141

Query: 165 ETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSS 224
                          + +  +N    AG  QV ++V  AEV R  L + G   +   ++ 
Sbjct: 142 ---------LSTEGQNFQSTVNSATYAGSAQVNIRVRFAEVSRSELLRYGVNWNALFNNG 192

Query: 225 GPSKSFAADFGGKFVSE---GGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAIS 281
             S            +        S        + + +L AL+    +  LAEP +TA++
Sbjct: 193 TFSFGLLTGGALAADAAGGASNVISAGLASGNVNIDAMLEALQSNGVLEVLAEPNITAMT 252

Query: 282 GQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVI 341
           GQ+ASF +GG+ +   V  +     +    YGV L F+PT+L  GRI L+++ EVS  + 
Sbjct: 253 GQTASFLAGGE-VAVPVPVNREVVGIEYKPYGVSLLFSPTLLPNGRIALQVRPEVSSLMS 311

Query: 342 GV----NAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGAL 397
                 N   +PS+RVR+ADT VE+ SG T  +AGL + +  Q  + +P+L  +PILG L
Sbjct: 312 TTTLDVNGYQVPSFRVRRADTRVEVGSGQTFAIAGLFQRESSQDMDKVPMLGDMPILGNL 371

Query: 398 FRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEA 457
           FR+ RF R ETE+ I  TP+LV+PV  R ++ P D                         
Sbjct: 372 FRSKRFQRNETELVILITPYLVEPVKDRVVATPLDKQRAAS------------------- 412

Query: 458 SEVEGQNYKGAIGFIY 473
           +   G    GA GF  
Sbjct: 413 TASAGPRSGGAFGFYM 428


>gi|87308911|ref|ZP_01091049.1| probable type II secretion system protein [Blastopirellula marina
           DSM 3645]
 gi|87288254|gb|EAQ80150.1| probable type II secretion system protein [Blastopirellula marina
           DSM 3645]
          Length = 540

 Score =  275 bits (704), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 114/497 (22%), Positives = 205/497 (41%), Gaps = 55/497 (11%)

Query: 1   MRYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKK----------- 49
           MR L     T +++ L +   +  +   I  A   +  +S       +K           
Sbjct: 3   MRNLSTALAT-LAMILSAGGIAFGQAQEILPAPNQLEQLSSPNAATLQKQFDLIDEVLEP 61

Query: 50  ---ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILI--GH 104
               S+  ++  I++    V  V +++P   +V   SP  M + G  VGQ  + L     
Sbjct: 62  ELIFSLMTSQSKIVRTKSPVFRVAITNPAVVEVNEFSPTEMEVIGSAVGQTTMTLWFNNA 121

Query: 105 DGKQ--------MLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQD 156
           DG          + N D   + +   L+  +      S +++  ++D +++ G  R  ++
Sbjct: 122 DGTVSTLRYLIIVSNDDNRADLEYGKLQAHINEMFPYSRVQLFPIADKLIVRGQARDSKE 181

Query: 157 SQRAVELSETFLSQSGRNQYANSS----------------SKKVMNLLNIAGEDQVTLKV 200
           +   + +          N   + +                +  ++NLL + GE QV LKV
Sbjct: 182 AAEILAVIGDQAVNQNGNISGSGTVNVGSVARLPDAEDLETTSLINLLEVPGEQQVMLKV 241

Query: 201 TIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVL 260
            +AE+ R   +++G   S+   S   + +            GG  ++  +LD    E  +
Sbjct: 242 RVAELSRQAARELGMDFSVMEESFSIAHTIM----------GGAGNLSAILDGGDVELFI 291

Query: 261 HALERATAIRTLAEPTLTAISGQSASFTSGGQH--LYKTVSSSTGATSVTTHDYGVVLHF 318
            A     + + LAEPTL  +SGQSASF +GG+            GA S +   +G  + F
Sbjct: 292 RAFSSNGSAKILAEPTLMTLSGQSASFIAGGEFAVPTAVGVGGIGAVSTSFRGFGTQVQF 351

Query: 319 TPTVLSPGRIGLRIQTEVSEPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDI 378
            PTV+    I L +   VS     ++   +P   +R A TTV+L  G  + +AGL++D+ 
Sbjct: 352 MPTVMDKDMIRLSVAPSVSSINQSLSVDGVPGLDIRGAVTTVDLREGQWLAIAGLIQDEQ 411

Query: 379 QQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLS--RPDDHYSV 436
           +  +  +PLL  IP +GA F +    R ETE+ I  +P LV P+    +    P    + 
Sbjct: 412 EASRSRLPLLGDIPYVGAAFGSQTTKRIETELVILVSPELVHPMERDQVPLYLPGMEVTE 471

Query: 437 EDDAKAFFFNRVNKIYG 453
             + + F   ++  + G
Sbjct: 472 PTNKEFFLHQQIEGLPG 488


>gi|197106489|ref|YP_002131866.1| Flp pilus assembly protein, secretin CpaC [Phenylobacterium
           zucineum HLK1]
 gi|196479909|gb|ACG79437.1| Flp pilus assembly protein, secretin CpaC [Phenylobacterium
           zucineum HLK1]
          Length = 438

 Score =  275 bits (703), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 102/424 (24%), Positives = 179/424 (42%), Gaps = 21/424 (4%)

Query: 41  DVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVI 100
             E    + I +  +K +  ++      ++VS P  A V   S R+ Y+ G   G  N++
Sbjct: 31  RSEPAPRRSIHVPRDKSLSFRLAQPAARIVVSQPEIAKVTATSDRSFYVQGLEFGSTNML 90

Query: 101 LIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRA 160
           + G  G+ +  LDI +  D   L+  L     +  +RV  + + ++L G V       +A
Sbjct: 91  VYGPGGRLLEVLDIRVGYDAEGLQQDLAAAFPNEPLRVRNLGEALMLTGEVTDTGVQYKA 150

Query: 161 VELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSIT 220
             +++ +            +   +++ +++    QV L+V + E  R  L+ IG + +I 
Sbjct: 151 EAIAQRY------------APDGLISRVSVRASQQVVLEVRVLEATRSALQDIGVEGAIG 198

Query: 221 GSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAI 280
            +S   +     +         G   + G       + +L ALE    +RTLA P L AI
Sbjct: 199 NNSWAVAFG---NGLIGASPAAGALGISGGWGDTRIDLMLTALEEKGVVRTLARPNLVAI 255

Query: 281 SGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPV 340
            GQ A+F +GG++ Y  V       S+    YGV L FTP V   G I L ++ EVS+  
Sbjct: 256 PGQKATFHAGGEYPYP-VPQRDDLISLEFRKYGVELTFTPVVQDNGLIRLDVEPEVSQLD 314

Query: 341 IGVN----AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGA 396
              +       +P   VR+  TTVEL  G ++ + GL + +       +P +  +P+LG+
Sbjct: 315 FTNSLRVQGFTVPGLIVRRTHTTVELKPGESLAIGGLFQREYTNALRQVPGIGDVPVLGS 374

Query: 397 LFRNSRFNREETEIFIAATPFLVKPVA-MRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPK 455
           LFR++R+ + ETE+ +  TP            +                  R       +
Sbjct: 375 LFRSARWKKAETELVVIVTPKFASTADMAAAEAMRTPPGREPTTPDLLLRGRALDKSITE 434

Query: 456 EASE 459
           E + 
Sbjct: 435 EGAP 438


>gi|320324504|gb|EFW80581.1| type III secretion component, putative [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320328376|gb|EFW84379.1| type III secretion component, putative [Pseudomonas syringae pv.
           glycinea str. race 4]
          Length = 429

 Score =  275 bits (703), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 122/436 (27%), Positives = 197/436 (45%), Gaps = 37/436 (8%)

Query: 45  GKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGH 104
           G    + + + +  +L     V  V+V++P  AD+ V SP  +Y+FG+  GQ ++I +  
Sbjct: 23  GAKGTVDLAIGEGRVLHFSAPVDSVMVAEPGIADLQVVSPGVIYVFGQAAGQTSLIALDS 82

Query: 105 DGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELS 164
           DG++   L + +    A +   L+     S  R+      V+  G V+ + ++     L 
Sbjct: 83  DGRETAALSLAVSSGTAAVTRPLKALHPQSQARINASGSRVIASGSVQDVGEATDLNAL- 141

Query: 165 ETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSS 224
                          + +  +N    AG  QV ++V  AEV R  L + G   +   ++ 
Sbjct: 142 ---------LSTEGQNFQSTVNSATYAGSAQVNIRVRFAEVSRSELLRYGVNWNALFNNG 192

Query: 225 GPSKSFAADFGGKFVSE---GGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAIS 281
             S            +        S        + + +L AL+    +  LAEP +TA++
Sbjct: 193 TFSFGLLTGGALAADAAGGASNVISAGLASGNVNIDAMLEALQSNGVLEVLAEPNITAMT 252

Query: 282 GQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVI 341
           GQ+ASF +GG+ +   V  +     +    YGV L F+PT+L  GRI L+++ EVS  + 
Sbjct: 253 GQTASFLAGGE-VAVPVPVNREVVGIEYKPYGVSLLFSPTLLPNGRIALQVRPEVSSLMS 311

Query: 342 GV----NAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGAL 397
                 N   +PS+RVR+ADT VE+ SG T  +AGL + +  Q  + +P+L  +PILG L
Sbjct: 312 TTTLDVNGYQVPSFRVRRADTRVEVGSGQTFAIAGLFQHESSQDMDKVPMLGDMPILGNL 371

Query: 398 FRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEA 457
           FR+ RF R ETE+ I  TP+LV+PV  R ++ P D                         
Sbjct: 372 FRSKRFQRNETELVILITPYLVEPVKDRVVATPLDKQRAAS------------------- 412

Query: 458 SEVEGQNYKGAIGFIY 473
           +   G    GA GF  
Sbjct: 413 TASAGPRSGGAFGFYM 428


>gi|284048526|ref|YP_003398865.1| type II and III secretion system protein [Acidaminococcus
           fermentans DSM 20731]
 gi|283952747|gb|ADB47550.1| type II and III secretion system protein [Acidaminococcus
           fermentans DSM 20731]
          Length = 590

 Score =  275 bits (703), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 98/461 (21%), Positives = 189/461 (40%), Gaps = 31/461 (6%)

Query: 34  AAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKN 93
            A I     +      +S+ +N    ++    +  + V +P  ADV + S     L GK 
Sbjct: 13  TAAILGMTGQALAATTLSVAVNGSRYMEASG-ITRLAVGNPEIADVRLLSGNDFLLVGKK 71

Query: 94  VGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRT 153
            G   +++   +G++    ++ +    A     ++  I    ++V+M++  V+L G V+ 
Sbjct: 72  PGSTTLLVWSDNGRE--EYNVFVSGSDAGTAQAIQEAIGYPEVQVQMMNGKVLLRGRVQN 129

Query: 154 IQDSQRAVELSETFLSQSGRNQYANSSSKK-------------VMNLLNIAGEDQVTLKV 200
             +   A+++++ +L   G       +  K             ++++L++    QV L  
Sbjct: 130 QYEHDSAIKVAQMYLGSGGGTTSTAQAGGKEGTAAQGGTTDSNIIDMLDMTEPTQVRLVA 189

Query: 201 TIAEVRRDILKQIGFQHSITGSSSGPSKSFAA-----DFGGKFVSEGGDFSVKGVLDRF- 254
            I E+     K +G Q+         + +  +        G F +    +  +G    F 
Sbjct: 190 QIIEINTSAEKDLGIQYWSPTLGDNTTGNSNSTDITRGTPGLFYAGENFYKQRGSFGWFG 249

Query: 255 ----SFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTH 310
               +    L AL  +   R L+ P++T +SGQ A    GG+      S+  G  ++   
Sbjct: 250 SHLSNLNASLQALVTSGKARILSRPSITTMSGQKAKILIGGRIPIP-TSAGDGQIAIDWR 308

Query: 311 DYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIG----VNAGDMPSYRVRKADTTVELPSGG 366
           DYGV L   P V +  +I  ++  EVS    G     N   +P+   R+A+  + + SG 
Sbjct: 309 DYGVKLDIEPVVDADNKITSKVHAEVSTLDYGHSVKENDFSIPAIASREAEAMINVRSGM 368

Query: 367 TIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRD 426
           T+ + GLL  +  +    IPLL  IPI+G  FR++   R+  E+ I  TP LV   +   
Sbjct: 369 TMAIGGLLNSEDSKSVSKIPLLGDIPIIGQFFRHTSTTRDNRELLILITPLLVGDDSPVS 428

Query: 427 LSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKG 467
           +S+         +       +V+     K  ++ + ++  G
Sbjct: 429 MSQRMKENYEASERYERNAEKVDVNTPVKPGNDKQERDIWG 469


>gi|50119734|ref|YP_048901.1| hypothetical protein ECA0789 [Pectobacterium atrosepticum SCRI1043]
 gi|49610260|emb|CAG73703.1| putative membrane protein [Pectobacterium atrosepticum SCRI1043]
          Length = 478

 Score =  275 bits (703), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 124/452 (27%), Positives = 219/452 (48%), Gaps = 27/452 (5%)

Query: 7   TFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDV 66
           T   +++  LF++   V     +  A    +     E+ +   + + +++  +LQ+    
Sbjct: 15  TCKRLLAAGLFNAVLPVTLTTMMLPA--TTMAAGVSEVAETNVVHLTVHQGRLLQLDALP 72

Query: 67  QDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMT 126
             VLV+DP  A   + SP  ++++ K+VG   +  +  +G  +  + ++ E D+  L   
Sbjct: 73  DSVLVADPNIASFELPSPGNLFVYAKSVGTTTLYAMDENGNVINAIRLVSEHDLKALGER 132

Query: 127 LRRFIADSNIRVEM-VSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRN----------- 174
           ++R    ++I++E  +   V++ G V T QD++R ++  + ++S S              
Sbjct: 133 MKREFPGADIQLEASIPSGVIVRGSVDTPQDAKRVIDSIQAYISASAGGQGGGGGGGEKL 192

Query: 175 QYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADF 234
             ++ SS KV+N L I    Q+ ++V + EV R +  ++GF  + + S+   + S  +  
Sbjct: 193 PGSSESSGKVINQLKIKTPSQINIQVRVVEVSRKLTSELGFNWAASLSTGSGNMSAGSGS 252

Query: 235 GGKFVSEGGD------FSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFT 288
                +           S      R     +L A+ +      LAEP LTA+SG++A+F 
Sbjct: 253 RLNLFNATTGRFANPTDSGFLNFGRSRLSGLLTAMNQQGMATVLAEPNLTAMSGETAAFA 312

Query: 289 SGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVN---- 344
           +GG+     +  +  + S+    YGV+L  TPT+LS  RI L I  EVSE     +    
Sbjct: 313 AGGEVPIVLI--TNNSVSIDYKSYGVILRMTPTLLSANRISLHIAPEVSELTDVGSVQLE 370

Query: 345 -AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRF 403
               +P+  VR+ADTTVEL SG +  LAG+L+    Q   G+P LS +P+ G LF +   
Sbjct: 371 GGSRIPALTVRRADTTVELASGQSFALAGMLRSAGSQTINGVPGLSSVPMFGRLFESEST 430

Query: 404 NREETEIFIAATPFLVKPVAMRDLSRPDDHYS 435
           ++EETE+ I AT ++V+PV   DL  P     
Sbjct: 431 SQEETELVIIATAYVVEPVNAGDLQTPGQGVK 462


>gi|197117446|ref|YP_002137873.1| Flp pilus assembly secretin CpaC [Geobacter bemidjiensis Bem]
 gi|197086806|gb|ACH38077.1| Flp pilus assembly secretin CpaC [Geobacter bemidjiensis Bem]
          Length = 451

 Score =  275 bits (702), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 113/429 (26%), Positives = 187/429 (43%), Gaps = 45/429 (10%)

Query: 51  SIGLNKVIILQVPVDVQDVLVSDPTKADV-VVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           ++ +N+ ++L +    + V ++D    DV        + + GK +G  N+I+   +  + 
Sbjct: 33  TVIVNRGVVLNLKNPARYVNITDKDVIDVPDPLRRNQLLINGKKIGSTNLIVWEENNDKP 92

Query: 110 LNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLS 169
              D+ +  D   +E  +R +    +I V+   DTV+L G V      ++A E+++ + +
Sbjct: 93  TFFDVRVVGDREAIESQIRDYAPKDDISVQYAQDTVILSGKVANEMTGKKAEEIAKAYSA 152

Query: 170 QSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKS 229
                        KV+N + +    QV L+V +A+V R  LK++G    + G ++    +
Sbjct: 153 -------------KVLNHITVDEPQQVLLQVKVAQVDRTSLKRLGLSAIVKGRTAEGFTN 199

Query: 230 FAADFGGK----------FVSEGGDFSVKGVLDRFSFE-----------------TVLHA 262
                 G           F S  G+  V  +     F+                  VL A
Sbjct: 200 LVGAPSGTSRNTESTPTRFTSTEGNGIVGNIPGIGGFDPLNAFNVGVSYFPAGIGAVLQA 259

Query: 263 LERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTG--ATSVTTHDYGVVLHFTP 320
           L      + LAEP L   SG+  +F +G +  Y  + S+ G   +S+     GV L F P
Sbjct: 260 LSSKGLAKILAEPNLLVKSGEEGNFLAGSRIPYSVLISTGGASTSSIVFETVGVKLKFKP 319

Query: 321 TVLSPGRIGLRIQT-EVSEPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQ 379
            VL  G I L+I   EVS     +     P    R   T VEL  G ++VLAGLL+++  
Sbjct: 320 QVLQNGLINLKIDPAEVSSIAGTLAVNGYPIIDTRDVRTDVELRDGESLVLAGLLQEEQI 379

Query: 380 QLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMR-DLSRPDDHYSVED 438
           +    IPLL  IPILGALFR+S+ +  E ++    TP +VKP         P D  + E+
Sbjct: 380 KNMSKIPLLGDIPILGALFRSSQKDIREKDLVFFITPKIVKPTPAGVATKLPTDAVTPEE 439

Query: 439 DAKAFFFNR 447
           +    +  R
Sbjct: 440 EKGYDWIPR 448


>gi|253687068|ref|YP_003016258.1| type II and III secretion system protein [Pectobacterium
           carotovorum subsp. carotovorum PC1]
 gi|251753646|gb|ACT11722.1| type II and III secretion system protein [Pectobacterium
           carotovorum subsp. carotovorum PC1]
          Length = 478

 Score =  275 bits (702), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 126/455 (27%), Positives = 220/455 (48%), Gaps = 27/455 (5%)

Query: 4   LQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVP 63
            + T   +++  LF++   V     +  A      +S   I    ++ + +N+  +LQ+ 
Sbjct: 12  FRGTCKRLLAACLFNAVLPVTLTTMMLPATTLAAGVSTAPI--TDEVHLTVNQGRLLQLA 69

Query: 64  VDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHL 123
                VLV+DP  A   + SP  ++++ K+VG   +  +  +G  +  + ++ E D+  L
Sbjct: 70  DTPDSVLVADPNIASFELPSPGNLFVYAKSVGVTTLYAMDENGNVINAIRLVSEHDLKAL 129

Query: 124 EMTLRRFIADSNIRVEM-VSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRN-------- 174
              ++R    ++I++E  +   V++ G V T QD++R ++  + ++S S           
Sbjct: 130 GERMKREFPGADIQLEASIPSGVIVRGSVDTPQDAKRVIDSIQAYISASSGGQGGGGGGG 189

Query: 175 ---QYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFA 231
                ++ SS KV+N L I    Q+ ++V + EV R +  ++GF  + + S+   + S  
Sbjct: 190 EKLPGSSESSGKVINQLKIKTPSQINIQVRVVEVSRKLTSELGFNWAASLSTGSGNMSAG 249

Query: 232 ADFGGKFVSEGGD------FSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSA 285
           +       +           S      R     +L A+ +      LAEP LTA+SG++A
Sbjct: 250 SGSRLNLFNATTGRFSNPTDSGFLNFGRSRLSGLLTAMNQQGMATVLAEPNLTAMSGETA 309

Query: 286 SFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVN- 344
           +F +GG+     +  +  + S+    YGV+L  TPT+LS  RI L I  EVSE     + 
Sbjct: 310 AFAAGGEVPIVLI--TNNSVSIDYKSYGVILRMTPTLLSANRISLHIAPEVSELTDVGSV 367

Query: 345 ----AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRN 400
                  +P+  VR+ADTTVEL SG +  LAG+L+    Q   G+P LS +P+ G LF +
Sbjct: 368 QLEGGSRIPALTVRRADTTVELASGQSFALAGMLRSAGSQTINGVPGLSSVPMFGRLFES 427

Query: 401 SRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYS 435
              ++EETE+ I AT ++V+PV   DL  P     
Sbjct: 428 EATSQEETELVIIATAYVVEPVNAGDLQTPGQGVK 462


>gi|145299828|ref|YP_001142669.1| flp pilus assembly protein FlpC [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142852600|gb|ABO90921.1| flp pilus assembly protein FlpC [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 461

 Score =  274 bits (701), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 112/457 (24%), Positives = 192/457 (42%), Gaps = 38/457 (8%)

Query: 46  KGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHD 105
             + +++   +  +L     V+D  V++     V   S + + ++G+ VG+ ++++   D
Sbjct: 14  AAESLTLTPEQSTLLNFDEPVRDAFVANSELVRVHSPSDQQLLIYGRKVGRTDLVVTAQD 73

Query: 106 GKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSE 165
           G+ + +  + +  D+A L+   R+    S +        +V+ G V +   +   + + E
Sbjct: 74  GRTLGHYRVQVVADLAPLKQLARQHFPQSRLTFSESGGAIVVAGEVTSPLQAHEILAMVE 133

Query: 166 TFLSQSGRNQYANSS------------------------SKKVMNLLNIAGEDQVTLKVT 201
            F          +                             V+N L +AG DQ+ + V 
Sbjct: 134 AFAKGIQPQGVPSGPVAPAQPQSGNQDEGAAVAGGGSGQYANVINQLRLAGSDQINISVR 193

Query: 202 IAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLH 261
           I E++R   +Q+G + S  G             G +F       S  G  D      ++ 
Sbjct: 194 IVEMQRTTSEQLGLRWSAMGEY----LQLGVSPGNRFPKPAERGSWGGKKDVVYINAIID 249

Query: 262 ALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPT 321
           AL   + +  LAEP LTA SG++A+F SGG+  +   +   G   +    +G+ L  TPT
Sbjct: 250 ALVENSLVNVLAEPNLTAKSGEAATFMSGGEFPFPVGNGDNG-PEIEFKKFGISLELTPT 308

Query: 322 VLSPGRIGLRIQTEVS----EPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDD 377
           +L   RI L +  EVS    E  + +    +P    R+  TT+EL  G +  LAGL++  
Sbjct: 309 LLDNNRISLTVSPEVSTLSRENSVSIAGVVVPGIETRRTTTTIELADGQSFALAGLVRTH 368

Query: 378 IQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPV-AMRDLSRPDDHYSV 436
             Q  E +P L +IP L   F ++ F  +E+E+ I AT  LV+P      LS P DHY  
Sbjct: 369 RNQSSEALPFLGEIPGLAPFFGSNSFKNQESELVIIATARLVQPTSDPLSLSTPLDHYRA 428

Query: 437 EDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIY 473
               +  FF  +    G  E    +     G  G+ Y
Sbjct: 429 PSRFERRFFTDM----GSTERPGAQATRLFGNYGYSY 461


>gi|251789646|ref|YP_003004367.1| type II and III secretion system protein [Dickeya zeae Ech1591]
 gi|247538267|gb|ACT06888.1| type II and III secretion system protein [Dickeya zeae Ech1591]
          Length = 474

 Score =  274 bits (701), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 124/432 (28%), Positives = 209/432 (48%), Gaps = 32/432 (7%)

Query: 32  ANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFG 91
           +   +   +  +I    +I + +N+  +LQ+      VL++DP  A   + SP  +++F 
Sbjct: 27  SATTLPVAAVTQIEATSEIRLNINQGRMLQLDHIPDSVLIADPAIASFELPSPGNVFVFA 86

Query: 92  KNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEM-VSDTVVLHGM 150
           K VG   +  +  DG+ +  + +++E D+  L+  LRR   D+ I++E  V + V++ G 
Sbjct: 87  KGVGNTTLYAMDVDGQVVSAIHLVVEHDLDALKERLRREFPDAQIQLEASVPNGVIVRGS 146

Query: 151 VRTIQDSQRAVELSETFLSQSGRN--------------QYANSSSKKVMNLLNIAGEDQV 196
           V T QD+++ ++  + ++  S  +                ++S+S  V+N L +    Q+
Sbjct: 147 VETPQDAKKVIDSVQAWVGASASSRGSAGGGGGGGSAMPASSSTSPNVVNQLKVRTPSQI 206

Query: 197 TLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGD----------FS 246
            ++V + EV R +  ++GF    + +    +  F +     F S   +            
Sbjct: 207 NIRVRVVEVSRKLTHELGFNWDSSLNRGRNTIGFGSGALSNFFSATSNTFSREAGSASLG 266

Query: 247 VKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATS 306
                   S  T+L AL        LAEP LTA+SG++A+F +GG+     +  +  + S
Sbjct: 267 YNYTGSDGSLGTLLSALNSQGMASVLAEPNLTAMSGETAAFAAGGEVPIVLI--TGNSVS 324

Query: 307 VTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVN-----AGDMPSYRVRKADTTVE 361
           +    YGV+L  TPT+LS  RI L I  EVSE     +        +P+  VR+ADTTVE
Sbjct: 325 IDYKSYGVILRMTPTLLSANRISLHIAPEVSELTSVGSVQLEGGSTIPALTVRRADTTVE 384

Query: 362 LPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKP 421
           L SG +  LAG+L+    Q   G+P LS IP+LG  F     + EETE+ I AT ++V P
Sbjct: 385 LASGQSFALAGMLRSSNSQTVAGVPGLSGIPLLGRAFERESTSSEETELVIIATAYVVAP 444

Query: 422 VAMRDLSRPDDH 433
           V+   L  P   
Sbjct: 445 VSAGTLQTPGQG 456


>gi|148259497|ref|YP_001233624.1| type II and III secretion system protein [Acidiphilium cryptum
           JF-5]
 gi|146401178|gb|ABQ29705.1| type II and III secretion system protein [Acidiphilium cryptum
           JF-5]
          Length = 491

 Score =  274 bits (701), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 123/466 (26%), Positives = 194/466 (41%), Gaps = 37/466 (7%)

Query: 28  PIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTM 87
           P   + A    +   E  + + ++I      ++ +     +V V+DP    V   S  T+
Sbjct: 44  PAAASPARHATMRPAEAARARGLTIEQGSGRLITLKGSAANVFVADPGVVAVRPASAHTL 103

Query: 88  YLFGKNVGQANVILIGHDGKQMLNLDILIE---RDIAHLEMTLRRFIADSNIRVEMVSDT 144
           ++FG   G   V +    G  +  L + +       A +     R    + + +   ++ 
Sbjct: 104 FVFGTAPGFTTVAVTDAQGHAVATLHVAVTPKTYPAAAIRAGATRSAPGARLSISSAANG 163

Query: 145 VVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAE 204
           VV+ G V T     + ++ +                  KV+N   +    QV LKV IA+
Sbjct: 164 VVVRGNVPTPVQDYQIMQQAHLIAGTGA----------KVVNQTEVRLPQQVALKVRIAQ 213

Query: 205 VRRDILKQIGFQHSITGSS-------SGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFE 257
           + R I +Q+G      G+         G S     +         G ++    +   + +
Sbjct: 214 MSRTITQQLGINWQSAGNGISVGKFLFGFSALDVLNGSSPATPAAGSYNAGLSVGGGAID 273

Query: 258 TVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLH 317
           +VL AL        LAEPTLTA+SGQSASF  GG      V    G  +V    +GV L 
Sbjct: 274 SVLDALNSDNLAHILAEPTLTALSGQSASFIDGGSFPVP-VPGQNGQVTVQYKKFGVQLK 332

Query: 318 FTPTVLSPGRIGLRIQTEVSEPVIGV--------NAGDMPSYRVRKADTTVELPSGGTIV 369
           F P VL  G I L +Q  VS P             +  +PS   + A TTV + SG T+ 
Sbjct: 333 FRPVVLDNGSIILHVQPTVSSPTTQNAFQIAVAGTSIVVPSLSTQSASTTVVIGSGQTLA 392

Query: 370 LAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPV-AMRDLS 428
           +AGLL +   Q  + +P L  +P+LGA FR+  +NR+E E+ I  TP+LVKPV     L 
Sbjct: 393 IAGLLSNSSNQTDKSVPGLGDMPVLGAAFRDDNYNRQEQELVILVTPYLVKPVNNAGQLM 452

Query: 429 RPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
            PD+ +S  +  +    +R +     +           G  GFI +
Sbjct: 453 TPDEGWSPPNQIQRIVLHRDSGGARREIVLP-------GQAGFILR 491


>gi|261820214|ref|YP_003258320.1| type II and III secretion system protein [Pectobacterium wasabiae
           WPP163]
 gi|261604227|gb|ACX86713.1| type II and III secretion system protein [Pectobacterium wasabiae
           WPP163]
          Length = 475

 Score =  274 bits (700), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 126/452 (27%), Positives = 217/452 (48%), Gaps = 30/452 (6%)

Query: 7   TFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDV 66
           T   ++   LF++   V  + P     A V            ++ + +++  +L +    
Sbjct: 15  TCKRLLIASLFNAVLPVMLMSPAATQAAGV-----SVAPVTDEVHLTVHQGRLLHLDALP 69

Query: 67  QDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMT 126
             VLV+DP  A   + SP  ++++ KNVG   +  +  +GK +  + ++ E D+  L   
Sbjct: 70  DSVLVADPNIASFELPSPGNLFVYAKNVGTTTLYAMDENGKVINAIRLVSEHDLKALSER 129

Query: 127 LRRFIADSNIRVEM-VSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQ---------- 175
           ++R    ++I++E  +   V++ G V T QD++R ++  +T+++ S              
Sbjct: 130 IKREFPGADIQLEASIPSGVIVRGSVDTPQDAKRVIDSIQTYINASSNGAQGGGGGGDQL 189

Query: 176 -YANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADF 234
             ++ +S KV+N L I    Q+ ++V + EV R +  ++GF  + + S+   + +  +  
Sbjct: 190 PGSSETSGKVVNQLKIKTPSQINIQVRVVEVSRKLTSELGFNWAASLSTGSGNMTAGSGS 249

Query: 235 GGKFVSEGGD------FSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFT 288
                +           S      R     +L A+ +      LAEP LTA+SG++A+F 
Sbjct: 250 RLNLFNATTGRFANPTDSGFLNFGRSRLGGLLTAMNQQGMATVLAEPNLTAMSGETAAFA 309

Query: 289 SGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVN---- 344
           +GG+     +  +  + S+    YGV+L  TPT+LS  RI L I  EVSE     +    
Sbjct: 310 AGGEVPIVLI--TNNSVSIDYKSYGVILRMTPTLLSANRISLHIAPEVSELTDVGSVQLE 367

Query: 345 -AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRF 403
               +P+  VR+ADTTVEL SG +  LAG+L+    Q   G+P LS IP+ G LF +   
Sbjct: 368 GGSRIPALTVRRADTTVELASGQSFALAGMLRSAGSQTINGVPGLSGIPMFGRLFESEST 427

Query: 404 NREETEIFIAATPFLVKPVAMRDLSRPDDHYS 435
           N EETE+ I AT ++V+PV   DL  P     
Sbjct: 428 NHEETELVIIATAYVVEPVNAGDLQTPGQGIR 459


>gi|71733713|ref|YP_274717.1| type III secretion component [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|71554266|gb|AAZ33477.1| type III secretion component, putative [Pseudomonas syringae pv.
           phaseolicola 1448A]
          Length = 437

 Score =  274 bits (700), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 118/401 (29%), Positives = 191/401 (47%), Gaps = 18/401 (4%)

Query: 45  GKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGH 104
           G    + + + +  +L     V  V+V++P  AD+ V SP  +Y+FGK  GQ ++I +  
Sbjct: 31  GAKGTVDLAIGEGRVLHFSAPVDSVMVAEPGIADLQVVSPGVIYVFGKAAGQTSLIALDS 90

Query: 105 DGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELS 164
           DG++   L + +    A +   L+     S  R+      V+  G V+ + ++     L 
Sbjct: 91  DGRETAALSLAVSSGTAAVTRPLKALHPQSQARINASGSRVIASGSVQDVGEATDLNAL- 149

Query: 165 ETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSS 224
                          + +  +N    AG  QV ++V  AEV R  L + G   +   ++ 
Sbjct: 150 ---------LSTEGQNFQSTVNSATYAGSAQVNIRVRFAEVSRSELLRYGVNWNALFNNG 200

Query: 225 GPSKSFAADFGGKFVSE---GGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAIS 281
             S            +        S        + + +L AL+    +  LAEP +TA++
Sbjct: 201 TFSFGLLTGGALAADAAGGASNVISAGLASGNVNIDAMLEALQSNGVLEVLAEPNITAMT 260

Query: 282 GQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVI 341
           GQ+ASF +GG+ +   V  +     +    YGV L F+PT+L  GRI L+++ EVS  + 
Sbjct: 261 GQTASFLAGGE-VAVPVPVNREVVGIEYKPYGVSLLFSPTLLPNGRIALQVRPEVSSLMS 319

Query: 342 GV----NAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGAL 397
                 N   +PS+RVR+ADT VE+ SG T  +AGL + +  Q  + +P+L  +PILG L
Sbjct: 320 TTTLDVNGYQVPSFRVRRADTRVEVGSGQTFAIAGLFQRESSQDMDKVPMLGDMPILGNL 379

Query: 398 FRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVED 438
           FR+ RF R ETE+ I  TP+LV+PV  R ++ P D      
Sbjct: 380 FRSKRFQRNETELVILITPYLVEPVKDRVVATPLDKQRAAS 420


>gi|149176581|ref|ZP_01855194.1| putative outer membrane channel for pilus assembly CpaC
           [Planctomyces maris DSM 8797]
 gi|148844694|gb|EDL59044.1| putative outer membrane channel for pilus assembly CpaC
           [Planctomyces maris DSM 8797]
          Length = 590

 Score =  273 bits (699), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 118/471 (25%), Positives = 193/471 (40%), Gaps = 39/471 (8%)

Query: 1   MRYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIIL 60
           +R  +      +   L + +       P     +  +     E     K+ +      IL
Sbjct: 8   IRVKRLPVLVTLVCSLIALSAYAQDEQPAPPGASEPVVQVSSEKM---KLEVTEKFSKIL 64

Query: 61  QVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDI 120
           + P  ++ V   DPT   V   +P  + +     G   +++   +GK +  L+  +  D 
Sbjct: 65  KFPGKIKRVDGFDPTVLSVSALTPNELRIQALVPGVTTLVITDENGK-VYTLETFVSGDA 123

Query: 121 AHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSS 180
            HL+  LR     S++    V D+VVL G V   +     VE++E F             
Sbjct: 124 RHLQAYLRELFPTSSVTAIKVQDSVVLRGWVTEPEAITEMVEIAEQFF------------ 171

Query: 181 SKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSS----------------S 224
              V+N + +AG  QV LKV I EV+R  ++Q+G        S                +
Sbjct: 172 PNGVLNQMKLAGVQQVLLKVKIMEVQRSKIRQLGVNWLFLNQSGYAYSTPGTLVPITGIN 231

Query: 225 GPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQS 284
            P     A    + +  G       V     F+  + AL++   ++ LAEP L   SG+ 
Sbjct: 232 VPFGGPPALTASQNLISGTSLGFGLVDGSSIFQAFIEALKKEALLKILAEPELVTTSGRP 291

Query: 285 ASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PV 340
           A+  SGG+     V  S G  ++   ++GV +   P VL  GR+ L +Q EVSE      
Sbjct: 292 ANLLSGGEFP-ILVPQSLGTVTIEWREFGVRMEAVPIVLGNGRLRLEVQPEVSERDFSNA 350

Query: 341 IGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRN 400
           + V    +P   VR+A+T VE+  G T+V+AGL+           P L ++P++GA FR 
Sbjct: 351 VQVAGTTVPGLTVRRANTAVEMNFGETMVIAGLISSRKTAETSKTPFLGELPVVGAAFRR 410

Query: 401 SRFNREETEIFIAATPFLVKPVAMRDLSR--PDDHYSVEDDAKAFFFNRVN 449
            R+   ETE+ I  TP LV P+    +    P    +   D + +    + 
Sbjct: 411 VRYTEGETELVIMVTPELVSPLKSGQVPPGGPGLFTATPTDRELYLDGVLE 461


>gi|330830432|ref|YP_004393384.1| protein transporter, outer membrane secretin (secretin) family
           [Aeromonas veronii B565]
 gi|328805568|gb|AEB50767.1| Protein transporter, outer bacterial membrane secretin (Secretin)
           family [Aeromonas veronii B565]
          Length = 465

 Score =  273 bits (699), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 115/469 (24%), Positives = 198/469 (42%), Gaps = 38/469 (8%)

Query: 34  AAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKN 93
           A ++ +  +     + +++   +  +L     V D  V++     V   S + + ++G+ 
Sbjct: 6   AILLAMLPLWAAAAESLTLTPEQSTLLNFDEPVLDAFVANSELVRVHSPSDQQLLIYGRK 65

Query: 94  VGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRT 153
           VG  ++++   DG+ + +  + +  D+A LE   R+    S +        +V+ G V +
Sbjct: 66  VGHTDLVVTALDGRTLGHYRVTVVADLAPLEQLARQHFPQSRLTFSESGGAIVVAGEVTS 125

Query: 154 IQDSQRAVELSETFLSQSGRNQYANSS------------------------SKKVMNLLN 189
              +   + + E F         A S+                           V+N L 
Sbjct: 126 PLQAHEILSMVEGFAKGLQPQSVAQSTVMAPSPQAGNQDEGAAVAGGGSGQYANVINQLR 185

Query: 190 IAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKG 249
           +AG DQ+ + V I E++R   +Q+G + S  G             G +F       S  G
Sbjct: 186 LAGSDQINISVRIVEMQRTTSEQLGLRWSAMGEY----LQLGVSPGNRFPKPLERGSWTG 241

Query: 250 VLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTT 309
             D      ++ AL   + +  LAEP LTA SG++A+F SGG+  +   +   G   +  
Sbjct: 242 KKDVVYINAIIDALVENSLVNVLAEPNLTAKSGEAATFMSGGEFPFPVGNGDNG-PEIEF 300

Query: 310 HDYGVVLHFTPTVLSPGRIGLRIQTEVS----EPVIGVNAGDMPSYRVRKADTTVELPSG 365
             +G+ L  TPT+L   RI L +  EVS    E  + +    +P    R+  TT+EL  G
Sbjct: 301 KKFGISLELTPTLLDNNRISLTVSPEVSTLSRENSVTIAGVVVPGIETRRTTTTIELADG 360

Query: 366 GTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPV-AM 424
            +  LAGL++    Q  E +P L +IP L   F ++ F  +E+E+ I AT  LV+P    
Sbjct: 361 QSFALAGLVRSHRNQNNEALPFLGEIPGLAPFFGSNSFKNQESELVIIATARLVQPTSDP 420

Query: 425 RDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIY 473
             LS P DHY      +  FF  +    G  ++   +     G  G+ Y
Sbjct: 421 LSLSTPLDHYRAPSRFERLFFTDM----GSTQSPAAQTTRLFGNYGYSY 465


>gi|149909547|ref|ZP_01898201.1| general secretion pathway protein D [Moritella sp. PE36]
 gi|149807452|gb|EDM67403.1| general secretion pathway protein D [Moritella sp. PE36]
          Length = 432

 Score =  273 bits (698), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 113/405 (27%), Positives = 189/405 (46%), Gaps = 38/405 (9%)

Query: 46  KGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHD 105
             K +++   +   ++   ++  V ++DP  AD  V     + +FGK +G  ++I+   +
Sbjct: 11  AQKIVNLSEGEAKTIKSIKEIASVFIADPEIADYQVIDANKVVVFGKKIGSTSIIVFDEN 70

Query: 106 GKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSE 165
           G  + N  ++I + + H++  ++    ++++ +  V D VVL G+V T Q+      +  
Sbjct: 71  GDTITNNKLVINKSLVHIQQQIQLKYPNADVTIYNVGDQVVLSGIVATEQEKDDINIIVG 130

Query: 166 TFLSQ---------SGRNQYANSSSK--------KVMNLLNIAGEDQVTLKVTIAEVRRD 208
             L++                    +         ++N + +A   QV +K++IAEV   
Sbjct: 131 ELLNKKSDDYIIQWESTGTDTKYEMEFMKRRHFAGIVNNIEVAAVKQVNVKLSIAEVSHS 190

Query: 209 ILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATA 268
            L+  G ++S  G +SG   +    F                       +V+ A+   + 
Sbjct: 191 FLENFGIEYSSIGQTSGTFVNLVTKFSAS-----------------DIASVITAIADDSV 233

Query: 269 IRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRI 328
            + LAEP L+ ISG+SASF  GG+    TV   T  T+V   +YGV L     VL   +I
Sbjct: 234 GQILAEPNLSVISGESASFLVGGELPVVTVVDGT--TNVLYKEYGVRLSLMAKVLRDDKI 291

Query: 329 GLRIQTEVS--EPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIP 386
            L +  EVS  +        ++P+ + R+A TTVEL  G + VLAGLL  +  +  + IP
Sbjct: 292 ILSLSPEVSTLDNQYSSGTYNLPALKTRRARTTVELGDGQSFVLAGLLNTEDVESIKKIP 351

Query: 387 LLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPD 431
            L  IPILGALFR+S   R +TE+ I AT  LVKP+    +  P 
Sbjct: 352 FLGDIPILGALFRSSSTQRNKTELIIVATVNLVKPIHASQVQLPT 396


>gi|298487093|ref|ZP_07005143.1| type II/III secretion system protein [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298158336|gb|EFH99406.1| type II/III secretion system protein [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
          Length = 437

 Score =  273 bits (698), Expect = 5e-71,   Method: Composition-based stats.
 Identities = 124/436 (28%), Positives = 199/436 (45%), Gaps = 37/436 (8%)

Query: 45  GKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGH 104
           G    + + + +  +L     V  V+V++P  AD+ V SP  +Y+FGK  GQ ++I +G 
Sbjct: 31  GAKGTVDLAIGEGRVLHFSAPVDSVMVAEPGIADLQVVSPGVIYVFGKAAGQTSLIALGS 90

Query: 105 DGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELS 164
           +G++   L + +    A +   L+     S  R+      V+  G V+ + ++     L 
Sbjct: 91  EGRETAALSLAVSSGTAAVTRPLKALHPQSQARINASGSRVIASGSVQDVGEATDLNAL- 149

Query: 165 ETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSS 224
                          + +  +N    AG  QV ++V  AEV R  L + G   +   ++ 
Sbjct: 150 ---------LSTEGQNFQSTVNSATYAGSAQVNIRVRFAEVSRSELLRYGVNWNALFNNG 200

Query: 225 GPSKSFAADFGGKFVSE---GGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAIS 281
             S            +        S        + + +L AL+    +  LAEP +TA++
Sbjct: 201 TFSFGLLTGGALAADAAGGASNVISAGLASGNVNIDAMLEALQSNGVLEVLAEPNITAMT 260

Query: 282 GQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVI 341
           GQ+ASF +GG+ +   V  +     +    YGV L F+PT+L  GRI L+++ EVS  + 
Sbjct: 261 GQTASFLAGGE-VAVPVPVNREVVGIEYKPYGVSLLFSPTLLPNGRIALQVRPEVSSLMS 319

Query: 342 G----VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGAL 397
                VN   +PS+RVR+ADT VE+ SG T  +AGL + +  Q  + +P+L  +PILG L
Sbjct: 320 TITLDVNGYQVPSFRVRRADTRVEVGSGQTFAIAGLFQRESSQDMDKVPMLGDMPILGNL 379

Query: 398 FRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEA 457
           FR+ RF R ETE+ I  TP+LV+PV  R ++ P D                         
Sbjct: 380 FRSKRFQRNETELVILITPYLVEPVKDRVVATPLDKQRAAS------------------- 420

Query: 458 SEVEGQNYKGAIGFIY 473
           +   G    GA GF  
Sbjct: 421 TASAGPRSGGAFGFYM 436


>gi|88866586|gb|ABD57354.1| FlpC [Aeromonas salmonicida subsp. salmonicida A449]
          Length = 479

 Score =  273 bits (697), Expect = 5e-71,   Method: Composition-based stats.
 Identities = 112/457 (24%), Positives = 192/457 (42%), Gaps = 38/457 (8%)

Query: 46  KGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHD 105
             + +++   +  +L     V+D  V++     V   S + + ++G+ VG+ ++++   D
Sbjct: 32  AAESLTLTPEQSTLLNFDEPVRDAFVANSELVRVHSPSDQQLLIYGRKVGRTDLVVTAQD 91

Query: 106 GKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSE 165
           G+ + +  + +  D+A L+   R+    S +        +V+ G V +   +   + + E
Sbjct: 92  GRTLGHYRVQVVADLAPLKQLARQHFPQSRLTFSESGGAIVVAGEVTSPLQAHEILAMVE 151

Query: 166 TFLSQSGRNQYANSS------------------------SKKVMNLLNIAGEDQVTLKVT 201
            F          +                             V+N L +AG DQ+ + V 
Sbjct: 152 AFAKGIQPQGVPSGPVAPAQPQSGNQDEGAAVAGGGSGQYANVINQLRLAGSDQINISVR 211

Query: 202 IAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLH 261
           I E++R   +Q+G + S  G             G +F       S  G  D      ++ 
Sbjct: 212 IVEMQRTTSEQLGLRWSAMGEY----LQLGVSPGNRFPKPAERGSWGGKKDVVYINAIID 267

Query: 262 ALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPT 321
           AL   + +  LAEP LTA SG++A+F SGG+  +   +   G   +    +G+ L  TPT
Sbjct: 268 ALVENSLVNVLAEPNLTAKSGEAATFMSGGEFPFPVGNGDNG-PEIEFKKFGISLELTPT 326

Query: 322 VLSPGRIGLRIQTEVS----EPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDD 377
           +L   RI L +  EVS    E  + +    +P    R+  TT+EL  G +  LAGL++  
Sbjct: 327 LLDNNRISLTVSPEVSTLSRENSVSIAGVVVPGIETRRTTTTIELADGQSFALAGLVRTH 386

Query: 378 IQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPV-AMRDLSRPDDHYSV 436
             Q  E +P L +IP L   F ++ F  +E+E+ I AT  LV+P      LS P DHY  
Sbjct: 387 RNQSSEALPFLGEIPGLAPFFGSNSFKNQESELVIIATARLVQPTSDPLSLSTPLDHYRA 446

Query: 437 EDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIY 473
               +  FF  +    G  E    +     G  G+ Y
Sbjct: 447 PSRFERRFFTDM----GSTERPGAQATRLFGNYGYSY 479


>gi|227326302|ref|ZP_03830326.1| hypothetical protein PcarcW_02904 [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 479

 Score =  273 bits (697), Expect = 5e-71,   Method: Composition-based stats.
 Identities = 121/456 (26%), Positives = 216/456 (47%), Gaps = 28/456 (6%)

Query: 4   LQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVP 63
            + T   +++  LF++   V     +  A    +           ++ + +N+  +L + 
Sbjct: 12  FRGTCKRLLAAGLFNAVLPVTLTTMMLPA--TTLAAGVSVAPVTDEVRLTVNQGRLLHLN 69

Query: 64  VDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHL 123
                VLV+DP  A   + SP  ++++ K+VG   +  +  +G  +  + ++ E D+  L
Sbjct: 70  ALPDSVLVADPNIASFELPSPGNLFVYAKSVGTTTLYAMDENGNVINAIRLVSEHDLKAL 129

Query: 124 EMTLRRFIADSNIRVEM-VSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRN-------- 174
              ++R    ++I++E  +   V++ G V T QD++R ++  + ++S S           
Sbjct: 130 GERMKREFPGADIQLEASIPSGVIVRGSVDTPQDAKRVIDSIQAYISASSGGGGQGGGGG 189

Query: 175 ----QYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSF 230
                 ++ SS KV+N L I    Q+ ++V + EV R +  ++GF  + + S+   + + 
Sbjct: 190 GERLPGSSESSGKVINQLKIKTPSQINIQVRVVEVSRKLTSELGFNWAASLSTGSGNMTA 249

Query: 231 AADFGGKFVSEGGDFSVKGV------LDRFSFETVLHALERATAIRTLAEPTLTAISGQS 284
            +       +                  R     +L A+ +      LAEP LTA+SG++
Sbjct: 250 GSGSRLNLFNATTGRFANPTDAGFLNFGRSRLSGLLTAMNQQGMATVLAEPNLTAMSGET 309

Query: 285 ASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVN 344
           A+F +GG+     +  +  + S+    YGV+L  TPT+LS  RI L I  EVSE     +
Sbjct: 310 AAFAAGGEVPIVLI--TNNSVSIDYKSYGVILRMTPTLLSANRISLHIAPEVSELTDVGS 367

Query: 345 -----AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFR 399
                   +P+  VR+ADTTVEL SG +  LAG+L+    Q   G+P LS +P+ G LF 
Sbjct: 368 VQLEGGSRIPALTVRRADTTVELASGQSFALAGMLRSAGSQTINGVPGLSSVPMFGRLFE 427

Query: 400 NSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYS 435
           +   ++EETE+ I AT ++V+PV   DL  P     
Sbjct: 428 SESTSQEETELVIIATAYVVEPVNAGDLQTPGQGVK 463


>gi|117618977|ref|YP_855991.1| protein transporter, outer bacterial membrane secretin (secretin)
           family protein [Aeromonas hydrophila subsp. hydrophila
           ATCC 7966]
 gi|117560384|gb|ABK37332.1| protein transporter, outer bacterial membrane secretin (secretin)
           family [Aeromonas hydrophila subsp. hydrophila ATCC
           7966]
          Length = 465

 Score =  271 bits (694), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 113/457 (24%), Positives = 193/457 (42%), Gaps = 38/457 (8%)

Query: 46  KGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHD 105
             + +++   +  +L     V D  V++     V   S + + ++G+ VG+ ++++   D
Sbjct: 18  AAESLTLTPEQSTLLNFDEPVLDAFVANSELVRVHSPSDQQLLIYGRKVGRTDLVVTALD 77

Query: 106 GKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSE 165
           G+ + +  + +  D+A L+   R+    S +        +V+ G V +   +   + + E
Sbjct: 78  GRTLGHYRVQVVADLAPLKQLARQHFPQSRLSFSESGGAIVVAGEVTSPLQAHEILTMVE 137

Query: 166 TFLSQSGRNQYANSSSKK------------------------VMNLLNIAGEDQVTLKVT 201
            F         A  ++                          V+N L +AG DQ+ + V 
Sbjct: 138 GFAKGIQPQGSALGTTAPVPPQTGSQDEGAAVAGGGSGQYAHVINQLRLAGSDQINISVR 197

Query: 202 IAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLH 261
           I E++R   +Q+G + S  G             G +F       S  G  D      ++ 
Sbjct: 198 IVEMQRTTSEQLGLRWSAMGEY----LQLGVSPGNRFPKPAERGSWGGKKDVVYINAIID 253

Query: 262 ALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPT 321
           AL   + +  LAEP LTA SG++A+F SGG+  +   +   G   +    +G+ L  TPT
Sbjct: 254 ALVENSLVNVLAEPNLTAKSGEAATFMSGGEFPFPVGNGDNG-PEIEFKKFGISLELTPT 312

Query: 322 VLSPGRIGLRIQTEVS----EPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDD 377
           +L   RI L +  EVS    E  + +    +P    R+  TT+EL  G +  LAGL++  
Sbjct: 313 LLDNNRISLTVSPEVSTLSRENSVSIAGVVVPGIETRRTTTTIELADGQSFALAGLVRTH 372

Query: 378 IQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPV-AMRDLSRPDDHYSV 436
             Q  E +P L +IP L   F ++ F  +E+E+ I AT  LV+P      LS P DHY  
Sbjct: 373 RNQSSEALPFLGEIPGLAPFFGSNGFKNQESELVIIATARLVQPTSDPLSLSTPLDHYRA 432

Query: 437 EDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIY 473
               +  FF  +    G  E    +     G  G+ Y
Sbjct: 433 PSRFERLFFTDM----GSTERPGAQATRLFGNYGYSY 465


>gi|227114876|ref|ZP_03828532.1| hypothetical protein PcarbP_18025 [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 479

 Score =  270 bits (690), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 120/456 (26%), Positives = 217/456 (47%), Gaps = 28/456 (6%)

Query: 4   LQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVP 63
            + T   +++  LF++   V     +  A    +           ++ + +++  +LQ+ 
Sbjct: 12  FRGTCKRLLAAGLFNAVLPVTLTTMMLPA--TTLAAGVSVAPVTDEVHLTVHQGRLLQLN 69

Query: 64  VDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHL 123
                VLV+DP  A   + SP  ++++ K+VG   +  +  +G  +  + ++ E D+  L
Sbjct: 70  ELPDSVLVADPNIASFELPSPGNLFVYAKSVGTTTLYAMDENGNVINAIRLVSEHDLKAL 129

Query: 124 EMTLRRFIADSNIRVE-MVSDTVVLHGMVRTIQDSQRAVELSETFLSQS----------- 171
              ++R    ++I++E  +   V++ G V T QD++R ++  +T++  S           
Sbjct: 130 GERMKREFPGADIQLEPSIPSGVIVRGSVDTPQDAKRVIDSIQTYIKSSVGGGQGGGGGG 189

Query: 172 -GRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSF 230
             R   ++ +S  V+N L I    Q+ ++V + EV R +  ++GF  + + S+   + + 
Sbjct: 190 GERLPGSSETSGNVVNQLKIKTPSQINIQVRVVEVSRKLTSELGFNWAASLSTGSGNMTA 249

Query: 231 AADFGGKFVSEGGDFSVKGV------LDRFSFETVLHALERATAIRTLAEPTLTAISGQS 284
            +       +                  R     +L A+ +      LAEP LTA+SG++
Sbjct: 250 GSGSRLNLFNATTGRFANPTDAGFLNFGRSRLSGLLTAMNQQGMATVLAEPNLTAMSGET 309

Query: 285 ASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVN 344
           A+F +GG+     +  +  + S+    YGV+L  TPT+LS  RI L I  EVSE     +
Sbjct: 310 AAFAAGGEVPIVLI--TNNSVSIDYKSYGVILRMTPTLLSANRISLHIAPEVSELTDVGS 367

Query: 345 -----AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFR 399
                   +P+  VR+ADTTVEL SG +  LAG+L+    Q   G+P LS +P+ G LF 
Sbjct: 368 VQLEGGSRIPALTVRRADTTVELASGQSFALAGMLRSAGSQTINGVPGLSSVPMFGRLFE 427

Query: 400 NSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYS 435
           +   ++EETE+ I AT ++V+PV   DL  P     
Sbjct: 428 SEATSQEETELVIIATAYVVEPVNAGDLQTPGQGVK 463


>gi|89899603|ref|YP_522074.1| type II and III secretion system protein [Rhodoferax ferrireducens
           T118]
 gi|89344340|gb|ABD68543.1| type II and III secretion system protein [Rhodoferax ferrireducens
           T118]
          Length = 571

 Score =  270 bits (690), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 127/543 (23%), Positives = 213/543 (39%), Gaps = 97/543 (17%)

Query: 13  SIFLFSSNPSVAKLPPIKEANAAVINISD---VEIGKGKKISIGLNKVIILQVPVDVQDV 69
              + +   + AKLP    A A     +      +     + I + K  +L+    V  +
Sbjct: 25  GATVQAGKATAAKLPAPATAPARQALSTTGLCSRVNIAPAVLIPVGKSTVLRPSSPVTRI 84

Query: 70  LVSDPTKA-------------------------------DVVVHSPRTMYLFGKNVGQAN 98
           L+ +P  A                               DV++ +P  +YL GK +G  N
Sbjct: 85  LLGNPENARAARPADTPEGKKEEGVKTPSVNTRPGVADVDVLLLAPTEVYLLGKTIGTTN 144

Query: 99  VILIGHDGKQMLNLDILIERDIAHLEMTLRRFIA-DSNIRVEMVSDTVVLHGMVRTIQDS 157
           V+++  DG      D+++  D   L+  + + +  +  I+V    D++VL GMV   +  
Sbjct: 145 VVMLDRDGTC-TAFDVVVAMDTMALQAVIGQLLPIEKEIKVTSAFDSIVLSGMVSDTEAL 203

Query: 158 QRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQH 217
            R  +L+  ++        +N    +V+N+L +    QV L+V +AE+ + +L Q G   
Sbjct: 204 TRVTDLANAYVRGQDGGGQSNQ---RVVNMLEVGAPQQVMLEVKVAEISKSLLDQFGINF 260

Query: 218 S------------ITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFS---------- 255
           S                  G +        G   S     SV  V+              
Sbjct: 261 SRAYVPGDGSMMRFLSGIFGGAVGAMGQISGTGASGVPFSSVDAVIGGTVPIAGASGGNV 320

Query: 256 -------------------------FETVLHALERATAIRTLAEPTLTAISGQSASFTSG 290
                                        L+  +    ++ LAEPT+ AISGQ+ SF +G
Sbjct: 321 TVTYDATTGRPTYTTSYGTVPGRGVSNATLNMQKNDGLVKVLAEPTIMAISGQTGSFLAG 380

Query: 291 GQHLYKTVS---SSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE-------PV 340
           G+          S    T++   ++GV + FTPTVL  GRI LR++ EVSE         
Sbjct: 381 GKIFIPVSKDNGSGGSTTTLEEKEFGVSVRFTPTVLGSGRINLRVRPEVSELNVAGVQIS 440

Query: 341 IGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRN 400
            G     +PS+  RKA+TTV+L  G +  + GL+K++        P L ++P++GALFR+
Sbjct: 441 SGGLNAVLPSFTSRKAETTVQLMDGQSFAIGGLIKNNTTTNINAFPFLGELPVVGALFRS 500

Query: 401 SRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEV 460
           + F  + +E+    TP LVKP+       P D Y     ++     ++        AS  
Sbjct: 501 TEFQTDRSELVFVITPRLVKPL-PVGYRLPTDGYVPPSRSELILGGKLEGQRTDDAASGD 559

Query: 461 EGQ 463
              
Sbjct: 560 NPA 562


>gi|328952514|ref|YP_004369848.1| type II and III secretion system protein [Desulfobacca acetoxidans
           DSM 11109]
 gi|328452838|gb|AEB08667.1| type II and III secretion system protein [Desulfobacca acetoxidans
           DSM 11109]
          Length = 536

 Score =  270 bits (689), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 114/504 (22%), Positives = 195/504 (38%), Gaps = 61/504 (12%)

Query: 7   TFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDV 66
                +SI L     +  +    +  +        + I              + +    +
Sbjct: 53  YLSRWLSIVLLFFLLTSGRAVLAENESDFASKAGRIVIAPHM--------SFVKRTQRPI 104

Query: 67  QDVLVSDPTKADVVVHSPRTMYLFGK-NVGQANVILIGHDG-KQMLNLDILIERDI-AHL 123
             V++++P+ AD  + +P  +++ GK   G  ++ L   D   +   + +  +  +   +
Sbjct: 105 TRVVLANPSLADAELLTPTQLFIVGKVKQGVTSLTLWHGDNYAETYEIVVSFDDKVWNDV 164

Query: 124 EMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKK 183
           +  +RR +  + ++VE + + V+L G V +  D  +  ++++ F  +             
Sbjct: 165 QAAIRRLVPRARVKVERLPEGVMLDGAVESQGDLDKVDKIAKFFFGECT----------- 213

Query: 184 VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQH-------------------------- 217
             N++ + G  QV L+V +AEV R  +KQ+G                             
Sbjct: 214 --NMITVMGSQQVQLEVKVAEVSRSGIKQLGLGFLLDKDYKVAVFPSGTAAGAMAGDRTT 271

Query: 218 --SITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEP 275
                  SS    S  A            F             ++  L+     R LA P
Sbjct: 272 VSQWPTGSSDTKTSSLASVAALASPYSSAFQALVHGLNDDILGIVSLLQGQGLTRLLASP 331

Query: 276 TLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTE 335
           TL  +SGQ A F  GG+  Y+TV  STG        +GV+L FTP VL    I + +  E
Sbjct: 332 TLVTMSGQEAHFLVGGEIPYQTV-GSTGTPGTDFKKFGVMLKFTPYVLGDETITISVDPE 390

Query: 336 VSEPV-----IGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSK 390
           VS P         +   +P    R   +T++L  G    +AGLL+DD +   + IP L  
Sbjct: 391 VSAPDYTLGTTTSSGTTVPGLITRTGHSTLQLKDGQVFAMAGLLRDDFRSTVKKIPFLGN 450

Query: 391 IPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLS-RPDDHY-SVEDDAKAFFFNRV 448
           +PILG LF +  F R ETE+ I   P +V+ +  +++   P  +      D   F  NR 
Sbjct: 451 LPILGTLFTSKEFQRSETELMIIVKPKIVRALNPQEVPALPGSNMERDVSDLDFFILNRG 510

Query: 449 NKIYGPKEASEVE-GQNYKGAIGF 471
               G   A       ++ G IGF
Sbjct: 511 WPKTGASSAPPPAKAPSFVGEIGF 534


>gi|220922532|ref|YP_002497834.1| type II and III secretion system protein [Methylobacterium nodulans
           ORS 2060]
 gi|219947139|gb|ACL57531.1| type II and III secretion system protein [Methylobacterium nodulans
           ORS 2060]
          Length = 479

 Score =  269 bits (688), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 121/481 (25%), Positives = 192/481 (39%), Gaps = 57/481 (11%)

Query: 39  ISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQAN 98
            +  E     ++ + +NK   ++V     D+L+     A+V+  S +T+Y+ GK VG  N
Sbjct: 6   PAAGETITVTRVRVPVNKSQTMRVVAPFSDILIGASKIAEVIPLSDQTLYILGKEVGTTN 65

Query: 99  VILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQ 158
           V L+  + K +  +D+ +  D  ++   +        +R     D  VL G         
Sbjct: 66  VSLVDANKKVIGVVDVEVGLDAGNIGAKVLGGSGARGVRFTTEGDKAVLTGTAEDAV--- 122

Query: 159 RAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHS 218
                     +       +N +   VMN+  +    QV LKV   E+ R   + +G +  
Sbjct: 123 ---------AADRAVALASNLAPGGVMNMTTVRSTQQVMLKVRFIEIDRTAGRDLGVRWE 173

Query: 219 ITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLD-------------------------- 252
            T  S        A       +  G   +  + +                          
Sbjct: 174 GTNRSVAGRSGTVAATPEALTTAPGGNGIGLLSNAIPAVAGAALSTVAAPQFGQFAARLI 233

Query: 253 ---RFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSST----GAT 305
                  +  + ALE     R LAEP L A SGQ A F +GG++   T SSS        
Sbjct: 234 NSNSAKVDLFISALETQGLARRLAEPNLVASSGQPAEFLAGGEYPIPTASSSGALGVPTI 293

Query: 306 SVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGD----MPSYRVRKADTTVE 361
           +VT  ++GV L FTPTVLS G I L+++ EVSE    ++       +P    R+A T +E
Sbjct: 294 TVTFKEFGVRLTFTPTVLSNGLINLQLEPEVSEIDPAISVNTGLVTVPGLSKRRARTNIE 353

Query: 362 LPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKP 421
           +  G +  +AGLL+   ++  E +P L  IP+LGALF +  F + +TE+ +  TP LVKP
Sbjct: 354 MRDGQSFAIAGLLQAVNEKNLEQLPWLGSIPVLGALFSSKEFRQRDTELVVIVTPHLVKP 413

Query: 422 VAMRD-LSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNY-------KGAIGFIY 473
                 L+ P D     +DA  F   +               Q          G+ G + 
Sbjct: 414 SKPGQPLATPLDTRMPTNDADYFLGGQTELPKSKNPGKPSRLQELISAEGAAIGSYGHVV 473

Query: 474 K 474
           K
Sbjct: 474 K 474


>gi|87199101|ref|YP_496358.1| type II and III secretion system protein [Novosphingobium
           aromaticivorans DSM 12444]
 gi|87134782|gb|ABD25524.1| type II and III secretion system protein [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 539

 Score =  269 bits (687), Expect = 8e-70,   Method: Composition-based stats.
 Identities = 121/472 (25%), Positives = 208/472 (44%), Gaps = 56/472 (11%)

Query: 36  VINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVG 95
               +       + ++I + +  ++ VP  + DV V+D   ADV V S   +Y+FGK  G
Sbjct: 40  APLHAQGMTSPARTVTISIGRGELVTVPGRMADVFVADERVADVQVKSTNQLYVFGKAGG 99

Query: 96  QANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQ 155
           +  +      G  + + ++ +  ++  ++  L   + ++ I V  +++TV+L G V   +
Sbjct: 100 ETTIYASNAKGDVVWSANVRVGNNLDSIDQMLHLAMPEARINVATMNNTVLLTGTVAAPE 159

Query: 156 DSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGF 215
           D+  A  L + F+ +             V++ L +A   QV+L V  AEV R +++ +G 
Sbjct: 160 DAAEAERLVKAFVGEKT----------NVISRLKMATPLQVSLHVKFAEVSRSLVRTLGV 209

Query: 216 QHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFS---------FETVLHA---- 262
             +    + G             V+   +          S             + A    
Sbjct: 210 NLTTIDGTGGIKFGIGQGSTTGSVATNRNLPFGVGTSSTSGYILDPTGATSNYVSATGTS 269

Query: 263 ---------------------------LERATAIRTLAEPTLTAISGQSASFTSGGQHLY 295
                                       E    + TL+EP LTAISG++A F +GG++  
Sbjct: 270 VAASSSGTTIAGMGKLLGLDLLAALDAGETIGLVTTLSEPNLTAISGETAEFLAGGEYPI 329

Query: 296 KTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGV----NAGDMPSY 351
             VS   G TS+    YGV L +TPTVL+ GRI +R++ E SE         ++ ++P+ 
Sbjct: 330 P-VSQGLGTTSIEYKKYGVSLAYTPTVLANGRISIRVRPEASELSSTGALKLDSVEIPAL 388

Query: 352 RVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIF 411
            VR+A+TTVEL SG + ++AGLL++  Q     +P    IPILG+LFR++ + + ETE+ 
Sbjct: 389 TVRRAETTVELGSGQSFMIAGLLQNGAQNALTKMPGAGDIPILGSLFRSTSYKKGETELV 448

Query: 412 IAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQ 463
           I  TP+LV PV   D+  P D +   ++ +      +              Q
Sbjct: 449 IVVTPYLVNPVNANDIKLPTDGFQSPNEIQR-LLGHMESDGVTGGDRPKPTQ 499


>gi|197337022|ref|YP_002157812.1| general secretion pathway protein D [Vibrio fischeri MJ11]
 gi|197314274|gb|ACH63723.1| general secretion pathway protein D [Vibrio fischeri MJ11]
          Length = 440

 Score =  268 bits (685), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 110/401 (27%), Positives = 181/401 (45%), Gaps = 38/401 (9%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           I++      ++    DV  V VSDP  AD  V   + + ++GK +GQ++V++   +G  +
Sbjct: 27  INMSEGDSQVILANKDVGSVFVSDPKIADYQVIEKKKVIVYGKKIGQSSVMVFDRNGHTL 86

Query: 110 LNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLS 169
            N  +++ + +  ++  +     D ++ V  + + VVL G V T Q+      +    L 
Sbjct: 87  ANKKVIVNKSLDSIKQYISVKYPDVDVDVFNIGEQVVLSGTVSTEQEKDEINNIVGQLLD 146

Query: 170 QSGRNQYANSSSK---------------KVMNLLNIAGEDQVTLKVTIAEVRRDILKQIG 214
           +           +                ++N + +A   QV +K++IAEV +  L+ IG
Sbjct: 147 KDDEKFTFEQDMEDQDYEIQFMERTDYKGIVNNIEVATTKQVNVKISIAEVSQSFLQDIG 206

Query: 215 FQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAE 274
            Q+                      + G               +V+ A+   T  + LAE
Sbjct: 207 IQYG-------------------TDAAGVFIQPLTHFSSSDIMSVITAIGSDTVGQILAE 247

Query: 275 PTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQT 334
           P L+ +SG+SASF  GG+    T      +T+V   +YGV L     V    +I L +  
Sbjct: 248 PNLSVVSGESASFLVGGELPVVTTV--NNSTNVMYKEYGVRLELMAKVKKDDKITLSLVP 305

Query: 335 EVSEPVIG--VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIP 392
           EVS   I    ++ D+P+ + R+A TTVEL  G + VL GLL  + ++  + IP +  IP
Sbjct: 306 EVSSLDIQYENDSYDLPALKTRRARTTVELGDGQSFVLGGLLSSEDKESLQKIPFIGDIP 365

Query: 393 ILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDH 433
           ILGALFR S   R +TE+ I AT  LVKP+    +  P   
Sbjct: 366 ILGALFRGSSTKRNKTELLIVATVNLVKPIHSSQIQLPMMR 406


>gi|59713403|ref|YP_206178.1| general secretion pathway protein D [Vibrio fischeri ES114]
 gi|59481651|gb|AAW87290.1| general secretion pathway protein D [Vibrio fischeri ES114]
          Length = 440

 Score =  268 bits (684), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 110/401 (27%), Positives = 181/401 (45%), Gaps = 38/401 (9%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           I++      ++    DV  V VSDP  AD  V   + + ++GK +GQ++V++   +G  +
Sbjct: 27  INMSEGDSQVILANKDVGSVFVSDPKIADYQVIEKKKVIVYGKKIGQSSVMVFDRNGHTL 86

Query: 110 LNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLS 169
            N  +++ + +  ++  +     D ++ V  + + VVL G V T Q+      +    L 
Sbjct: 87  ANKKLIVNKSLDSIKQYISVKYPDVDVDVFNIGEQVVLSGTVSTEQEKDEINNIVGQLLD 146

Query: 170 QSGRNQYANSSSK---------------KVMNLLNIAGEDQVTLKVTIAEVRRDILKQIG 214
           +           +                ++N + +A   QV +K++IAEV +  L+ IG
Sbjct: 147 KDDEKFTFEQDMEDQDYEIQFMERTDYKGIVNNIEVATTKQVNVKISIAEVSQSFLQDIG 206

Query: 215 FQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAE 274
            Q+                      + G               +V+ A+   T  + LAE
Sbjct: 207 IQYG-------------------TDAAGVFIQPLTHFSSSDIMSVITAIGSDTVGQILAE 247

Query: 275 PTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQT 334
           P L+ +SG+SASF  GG+    T      +T+V   +YGV L     V    +I L +  
Sbjct: 248 PNLSVVSGESASFLVGGELPVVTTV--NNSTNVMYKEYGVRLELMAKVKKDDKITLSLVP 305

Query: 335 EVSEPVIG--VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIP 392
           EVS   I    ++ D+P+ + R+A TTVEL  G + VL GLL  + ++  + IP +  IP
Sbjct: 306 EVSSLDIQYENDSYDLPALKTRRARTTVELGDGQSFVLGGLLSSEDKESLQKIPFIGDIP 365

Query: 393 ILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDH 433
           ILGALFR S   R +TE+ I AT  LVKP+    +  P   
Sbjct: 366 ILGALFRGSSTKRNKTELLIVATVNLVKPIHSSQIQLPMMR 406


>gi|260775653|ref|ZP_05884549.1| type II/IV secretion system secretin RcpA/CpaC associated with Flp
           pilus assembly [Vibrio coralliilyticus ATCC BAA-450]
 gi|260608069|gb|EEX34238.1| type II/IV secretion system secretin RcpA/CpaC associated with Flp
           pilus assembly [Vibrio coralliilyticus ATCC BAA-450]
          Length = 442

 Score =  268 bits (684), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 109/414 (26%), Positives = 178/414 (42%), Gaps = 34/414 (8%)

Query: 35  AVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNV 94
           + +      +   + + +            ++  V VS+P  AD  V     + ++ K+ 
Sbjct: 12  SPLLSVATTVAASEYLPMAEGDARPFATQQEIGTVFVSNPAVADYQVIDKHKVVIYSKST 71

Query: 95  GQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTI 154
           G++++I+    G  +L+  I + +    ++  LR    ++ +    V + VVL G V + 
Sbjct: 72  GKSSLIVFDQSGNTILSRRIQVNKSADSIQRYLRNHYPNAQVNAYYVGEQVVLSGTVSSE 131

Query: 155 QDSQRAVELSETFLSQSGRNQYANSSSK---------------KVMNLLNIAGEDQVTLK 199
           Q       +    L +    Q     ++                V+N + +    QV +K
Sbjct: 132 QVKDEIYIVVGEMLEKPANRQKFELETEDESYEMKFMERREYDGVVNNIEVVVTKQVNVK 191

Query: 200 VTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETV 259
           V+IAEV +  L+QIG  +   G   G      A                          +
Sbjct: 192 VSIAEVSQKALEQIGVSYFSKGQVPGSGVFVNA---------------INAFSADDILMM 236

Query: 260 LHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFT 319
           ++A++  +  R LAEP L+  SG+SASF  GG+    T     G +SV+  ++GV L   
Sbjct: 237 INAIDNESVGRVLAEPNLSVTSGESASFLVGGELPVVTTI--DGGSSVSYKEFGVRLELM 294

Query: 320 PTVLSPGRIGLRIQTEVSEPVIG--VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDD 377
             V    +I L +  EVS        +  D+P+ + R+A TTVEL  G + VL GLL  +
Sbjct: 295 AKVKRDNKITLSLVPEVSSLDSQYENDTYDLPALKTRRARTTVELGDGQSFVLGGLLSSE 354

Query: 378 IQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPD 431
             +    IPL+  IPILG LFRN+   R +TE+ I AT  LVKPV    +S P 
Sbjct: 355 DMESLSKIPLIGDIPILGTLFRNAETERNKTELIIVATVNLVKPVETSTISLPT 408


>gi|283787693|ref|YP_003367558.1| tight adherence secretin RcpA [Citrobacter rodentium ICC168]
 gi|282951147|emb|CBG90838.1| putative tight adherence secretin RcpA [Citrobacter rodentium
           ICC168]
          Length = 482

 Score =  267 bits (682), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 124/496 (25%), Positives = 215/496 (43%), Gaps = 55/496 (11%)

Query: 5   QRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPV 64
            R   TM+S  L ++      LP    A                 + +   +        
Sbjct: 8   SRHVLTMLSHLLLTAVLLSFSLPAAAGA-----------------LYMKHGQSRNFHFTG 50

Query: 65  DVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLE 124
           D+  + +SDP  AD  V + + + ++ KN G  ++I+ G +   +L   I ++  ++ + 
Sbjct: 51  DLDTIFISDPRVADYKVVNNKNIIVYAKNTGTTDLIVYGRNNTVLLKHSISVDPFLSDIN 110

Query: 125 MTLRRFIADSNIRVE------MVSDTVV--LHGMVRTIQDSQRAVELSETFLSQSGRNQY 176
             + R    ++I V         +D VV  ++G V   +      +L  + ++ SG  + 
Sbjct: 111 QRVARLFPGNSIEVTRFMGGATAADKVVYIINGSVTDEESMDAIYQLVGSIVNSSGGEEK 170

Query: 177 ANSSSKK-------------------VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQH 217
            N S+ K                   V+N + +   +QV + +T+ EV +     +G   
Sbjct: 171 DNKSANKRVVDSKINTDLIEKKKYANVINKMQLVASNQVNVHLTVVEVSKTFTDALGIDW 230

Query: 218 SITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTL 277
           S    SS  +   + +  G F         KG  D  +  TV++A++  +  R +A+P L
Sbjct: 231 SSLTLSSIVNGGASINNPGTF----NLLGFKGGFDAKNISTVINAIQNDSVARIMAQPNL 286

Query: 278 TAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS 337
           T +SG++A F  GG+    + +S    T+VT  +YG+ L     V    +I L +  E+S
Sbjct: 287 TVLSGETADFLVGGEIPILSKNSDNEGTTVTYKEYGIKLSIAAKVEKKSKIKLSLSNEIS 346

Query: 338 EPVI--GVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILG 395
                   NA  +P+   R++ +T+EL  G +  + GLL +   +    +P +  IPILG
Sbjct: 347 SISGAYSFNAYSIPTLTTRRSSSTIELADGDSFAIGGLLTEKDYETLGKVPFIGDIPILG 406

Query: 396 ALFRNSRFNREETEIFIAATPFLVKPVAMR-DLSRPDDHYSVEDDAKAFFFNRVNKIYGP 454
           AL RNS   RE+TE+ I AT  LVKPVA   D+  P   Y+   + K FF   V+K  G 
Sbjct: 407 ALARNSNTQREKTELVIFATVNLVKPVASNRDIVLP--EYNKTSNNKLFFNVGVDK--GT 462

Query: 455 KEASEVEGQNYKGAIG 470
           +E    +  +   + G
Sbjct: 463 RENRLSKDTDKFLSYG 478


>gi|258620803|ref|ZP_05715838.1| Flp pilus assembly protein [Vibrio mimicus VM573]
 gi|258587001|gb|EEW11715.1| Flp pilus assembly protein [Vibrio mimicus VM573]
          Length = 444

 Score =  267 bits (682), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 106/442 (23%), Positives = 183/442 (41%), Gaps = 42/442 (9%)

Query: 47  GKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDG 106
            + +++       + +   +  V V+D T AD  +     + ++G   G  +VI+    G
Sbjct: 23  AELMNLDQGAAKTINLKRQIDTVFVADNTVADYRIVDQNKVVVYGVGQGATSVIVYDRGG 82

Query: 107 KQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSET 166
            ++ N ++++ + +  L+ TL     D +I V  V D VVL G V + +   +   L   
Sbjct: 83  NEIYNSEVVVNQSLRLLKQTLIARFPDESISVSNVGDQVVLDGTVSSEEVKYKIYRLVGE 142

Query: 167 FLSQ------------------SGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRD 208
            L +                        A      V+N L +   +Q+ +K+TIAEV   
Sbjct: 143 MLKKNVSKVNNHVIETGENNREETLQYTATYVYDGVINNLKVLTTEQINVKLTIAEVSSS 202

Query: 209 ILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATA 268
            L ++G  +   G                    G  ++            ++ A      
Sbjct: 203 FLSELGVSYGDIGGGD----------------VGKFYNKLLDFTAQDIVAIIAASGNDDI 246

Query: 269 IRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRI 328
            + LAEP L+ ISG++ASF  GG+         T   ++   +YG+ L     V     I
Sbjct: 247 GQVLAEPNLSVISGETASFLVGGEIPLAIKEDDT--YTIHYKEYGIKLSMVAKVTDSENI 304

Query: 329 GLRIQTEVSEPVI----GVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEG 384
            L +  EVS          ++ + PS + RKA TTV+L  G + VLAGLL  + ++    
Sbjct: 305 RLSLLPEVSSLDSVNRSDNSSYNFPSLKTRKAQTTVQLKDGQSFVLAGLLTTEERESLRK 364

Query: 385 IPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFF 444
           IP+L  IPILGALF +++ +R++TE+ I AT  LV PV    +  P   +    D +   
Sbjct: 365 IPILGDIPILGALFSSTKSDRKKTELIIVATVNLVDPVKTEQVKLPA--FKKTSDLERLL 422

Query: 445 FNRVNKIYGPKEASEVEGQNYK 466
              ++ +  P+    +    + 
Sbjct: 423 RIDLSGVDEPELQRTINAGGFN 444


>gi|86159249|ref|YP_466034.1| type II and III secretion system protein [Anaeromyxobacter
           dehalogenans 2CP-C]
 gi|85775760|gb|ABC82597.1| type II and III secretion system protein [Anaeromyxobacter
           dehalogenans 2CP-C]
          Length = 487

 Score =  266 bits (681), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 125/484 (25%), Positives = 207/484 (42%), Gaps = 54/484 (11%)

Query: 11  MMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVL 70
           M    +  +   VA      +     + I D E+G  + +S+   +  +L V   +  + 
Sbjct: 1   MSRHAVVVALMLVAGRAAAAQDVVPTMRI-DREVGAARSMSLEAGQNRLLVVSDQIGRIA 59

Query: 71  VSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRF 130
           V++P  AD+ V +P  + L  K +G  ++ L   D   +  + + + R++  L   L+  
Sbjct: 60  VANPDVADLKVVTPYQVLLTAKGIGSTDLTLWDRDNHPL-VIALQVTRNLEGLRKQLKEL 118

Query: 131 IADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNI 190
            A   I V    D VV+ G V  ++  +R  E++                + KV NL+ +
Sbjct: 119 FAGEKIEVSSAGDLVVISGQVSDVRIPERVAEVAR-------------LHATKVANLVQV 165

Query: 191 AGEDQVTLKVTIAEVRRDILKQIGFQH----------SITGSSSGPSKSFAADFGGKFVS 240
           +G+ QV L+V  AEV R  L+++G                  +      F        + 
Sbjct: 166 SGQQQVQLEVRFAEVGRTGLREMGVNFFHKSDDGKRVGGMTGNRTYPGDFLNTQSNPAIP 225

Query: 241 EGGDFS---------------------VKGVLDRFSFETVLHALERATAIRTLAEPTLTA 279
             G                              +F F  +L+ LE++   +TLAEPTL A
Sbjct: 226 GTGPRGLWGPGMPPDVPNPAFNNAFSFFLSQGGQFPFSVMLNLLEQSNLAKTLAEPTLVA 285

Query: 280 ISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEP 339
           +SGQ A+F +GG+       S+ G T+V    +G+ L FTPTV+    I LR++ EVS+ 
Sbjct: 286 MSGQEAAFLAGGELPIPLA-STFGQTAVEWKKFGIQLRFTPTVIGD-AIHLRLKAEVSDL 343

Query: 340 VIGVNAGD----MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILG 395
                       +P    R+++TT+ L  G +  +AGL+ D ++     +P+L  IPILG
Sbjct: 344 DPTTAVTVGGTTIPGLVSRQSETTIRLGDGQSFAVAGLISDKVRSQSARVPVLGSIPILG 403

Query: 396 ALFRNSRFNREETEIFIAATPFLVKPVAMRDL-SRPDD-HYSVEDDAKAFFFNRVNKIYG 453
           ALFR+  + R+ETE+ +  T  L KPVA  +L   P D   +   DA  F          
Sbjct: 404 ALFRSQAYQRDETELLVVVTARLAKPVAPHELPPLPTDFENNDPSDAALFLLGSDGSAVK 463

Query: 454 PKEA 457
             + 
Sbjct: 464 QPKP 467


>gi|262164949|ref|ZP_06032687.1| type II/IV secretion system secretin RcpA/CpaC associated with Flp
           pilus assembly [Vibrio mimicus VM223]
 gi|262027329|gb|EEY45996.1| type II/IV secretion system secretin RcpA/CpaC associated with Flp
           pilus assembly [Vibrio mimicus VM223]
          Length = 444

 Score =  266 bits (681), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 106/442 (23%), Positives = 182/442 (41%), Gaps = 42/442 (9%)

Query: 47  GKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDG 106
            + +++       + +   +  V V+D T AD  +     + ++G   G  +VI+    G
Sbjct: 23  AELMNLDQGAAKTINLKRQIDTVFVADNTVADYRIVDQNKVVVYGVGQGATSVIVYDRGG 82

Query: 107 KQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSET 166
            ++ N ++++ + +  L+ TL     D +I V  V D VVL G V + +   +   L   
Sbjct: 83  NEIYNSEVVVNQSLRLLKQTLIARFPDESISVSNVGDQVVLDGTVSSEEVKYKIYRLVGE 142

Query: 167 FLSQ------------------SGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRD 208
            L +                        A      V+N L +   +Q+ +K+TIAEV   
Sbjct: 143 MLKKNVSKVNNHVIETGENNREETLQYTATYVYDGVINNLKVLTTEQINVKLTIAEVSSS 202

Query: 209 ILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATA 268
            L ++G  +   G                    G  ++            ++ A      
Sbjct: 203 FLSELGVSYGDIGGGD----------------VGKFYNKLLDFTAQDIVAIIAASGNDDI 246

Query: 269 IRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRI 328
            + LAEP L+ ISG++ASF  GG+         T   ++   +YG+ L     V     I
Sbjct: 247 GQVLAEPNLSVISGETASFLVGGEIPLAIKEDDT--YTIHYKEYGIKLSMVAKVTDSENI 304

Query: 329 GLRIQTEVSEPVI----GVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEG 384
            L +  EVS          ++ + PS + RKA TTV+L  G + VLAGLL  + ++    
Sbjct: 305 RLSLLPEVSSLDSVNRSDNSSYNFPSLKTRKAQTTVQLKDGQSFVLAGLLTTEERESLRK 364

Query: 385 IPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFF 444
           IP+L  IPILGALF +++ +R++TE+ I AT  LV PV    +  P   +    D +   
Sbjct: 365 IPILGDIPILGALFSSTKSDRKKTELIIVATVNLVDPVKTEQVKLPA--FKKTSDLERLL 422

Query: 445 FNRVNKIYGPKEASEVEGQNYK 466
              +  +  P+    +    + 
Sbjct: 423 RIDLTGVDEPELQRTINAGGFN 444


>gi|325108834|ref|YP_004269902.1| type II and III secretion system protein [Planctomyces brasiliensis
           DSM 5305]
 gi|324969102|gb|ADY59880.1| type II and III secretion system protein [Planctomyces brasiliensis
           DSM 5305]
          Length = 736

 Score =  266 bits (680), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 99/488 (20%), Positives = 187/488 (38%), Gaps = 49/488 (10%)

Query: 22  SVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVV 81
           +  +          +           +K+ + LN+  +++    V  + ++DPT  D+  
Sbjct: 43  APTRSAQSSRIQQRLDARIVSMPQVERKLELVLNRSQLVKTRSRVTRMAIADPTVIDIAP 102

Query: 82  HSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIA----------HLEMTLRRFI 131
                  + G  +G   + L   +    L  ++ +  D             LE  +    
Sbjct: 103 FEEDEFAIIGTAIGSTTLTLWFENDDNPLIYEVTVIDDPNVEEQLRIDYGKLERKIAILF 162

Query: 132 ADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSS----------- 180
            +S + +  + + +V+ G  +   ++ R +++            Y  +            
Sbjct: 163 PNSKVYLIPLHEKLVVKGQAKDAAEAARILQIVRGEFLDDYGGLYGPNGGAGRGGGGGGG 222

Query: 181 -------------SKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPS 227
                        S  ++N+L + GE QV L VTIAE+ R  L+++G   ++  ++    
Sbjct: 223 YDDDGIRDEDDLYSSFIVNMLQVPGEYQVMLHVTIAELNRSQLRRMGVDFAVLFANGQHF 282

Query: 228 KSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASF 287
                         GG  ++ G+ +      +++AL      + L+ P+LT +SG  A F
Sbjct: 283 IGSTIS--------GGVPTLTGIFNNGDISVLINALASNGTAKILSRPSLTTLSGHPAQF 334

Query: 288 TSGGQH--LYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNA 345
            +GG+              TS     +G  +   PTV+      LRI  E S+     + 
Sbjct: 335 LAGGEFAVPTTVGVGGVQGTSTQFRGFGTSMVVVPTVVDGDLFRLRIAPEFSQINQNNSV 394

Query: 346 GDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGAL-FRNSRFN 404
           G +P    R+  TTVEL  G TIVL GLL          IPLL +IP++G L F   R  
Sbjct: 395 GGIPGLDSRRVQTTVELREGQTIVLGGLLSRQTASEVTRIPLLGEIPLIGPLMFNTKRAT 454

Query: 405 REETEIFIAATPFLVKPVAMRDL-SRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQ 463
            +E E+ +  TP +V+ +   ++   P  + +  +D + +   R     G  +    +  
Sbjct: 455 EDELELLVLVTPEIVRAMDPDEVPPMPGYYVTHPNDRELY---RYAMTEGAPDLEVYQLA 511

Query: 464 NYKGAIGF 471
            Y   +G+
Sbjct: 512 PYGNKVGY 519


>gi|283779855|ref|YP_003370610.1| type II and III secretion system protein [Pirellula staleyi DSM
           6068]
 gi|283438308|gb|ADB16750.1| type II and III secretion system protein [Pirellula staleyi DSM
           6068]
          Length = 585

 Score =  266 bits (680), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 108/476 (22%), Positives = 199/476 (41%), Gaps = 24/476 (5%)

Query: 2   RYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQ 61
           RY        + + L  + P+ ++   +         +     G  +K+ + +N   +++
Sbjct: 13  RYSLLAGLPALLVALTFAAPAFSQPMSLPGVGPMPAAVKFKVQGPAEKLEMTVNTSRVVE 72

Query: 62  VPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIA 121
            P DV  +LV++P    +   SP ++ L     G   + +   D + +  LD+++  D+ 
Sbjct: 73  FPFDVPKMLVNNPDLVRITPISPNSIQLSAVKGGVTQLNVWNADDQ-VTTLDLIVIPDVQ 131

Query: 122 HLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSS 181
            LEM L+    D+ IR+  ++ ++ + G V   +       ++E +              
Sbjct: 132 ELEMILKHEFPDAAIRLRPLASSLYISGFVPKAEMVASITRVAEDYFP------------ 179

Query: 182 KKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAA---DFGGKF 238
            K++N + + G  +V L V + EV R  L+ +GF  +        ++S +      G   
Sbjct: 180 -KIINNMTVGGVQKVLLHVKVMEVSRTKLRTMGFDWAQLNGDDFVTQSVSGLLQTPGTLT 238

Query: 239 VSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTV 298
            + G       + D   F   L AL +    + LAEPTL  +SG+ A F  GG+      
Sbjct: 239 GNTGATVRFGILTDNNQFYGFLEALRQNDLAKLLAEPTLVTMSGRPAYFNVGGEVPIPM- 297

Query: 299 SSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIG--VNAGDMPSYRVRKA 356
             S G T+V    +G  + F P VL  G I L ++ EV+E           +P +R R A
Sbjct: 298 QQSLGVTTVQYKQFGTRIDFVPIVLGNGSIRLEVRPEVTEIDPSLRDAVTGVPGFRQRGA 357

Query: 357 DTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATP 416
           DT VE+ +G T+ +AGL+ + ++    G+P L+ +P  G  FR       E E+ I  TP
Sbjct: 358 DTAVEIKAGQTMAIAGLVYNRVEASNRGVPFLADLPWAGGAFRRVSEKVNEVELVIMVTP 417

Query: 417 FLVKPVAMRDLSR--PDDHYSVEDDAKAFFFNRVN--KIYGPKEASEVEGQNYKGA 468
              + +   ++    P    +   D + +    +   K          +G  ++G 
Sbjct: 418 EFTEALDPSEVPACGPGQLTTSPTDKELYGRGYIEVPKANCNNGNCAPQGSMFQGT 473


>gi|170022934|ref|YP_001719439.1| type II and III secretion system protein [Yersinia
           pseudotuberculosis YPIII]
 gi|169749468|gb|ACA66986.1| type II and III secretion system protein [Yersinia
           pseudotuberculosis YPIII]
          Length = 423

 Score =  266 bits (679), Expect = 6e-69,   Method: Composition-based stats.
 Identities = 104/440 (23%), Positives = 191/440 (43%), Gaps = 35/440 (7%)

Query: 41  DVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVI 100
                  K+I + +    I+++  ++  V VS    AD  +    ++ ++ K  G A   
Sbjct: 10  FENSANAKQIYLPIGGSHIIKMQEEIDTVFVSAAKTADYEIVDNNSVIIYAKKEGLAEFT 69

Query: 101 LIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRA 160
           L   + + +    +L+   I      +R    DS I +  + ++ +L G   T +     
Sbjct: 70  LFNKNHQPISKTRVLVNNTINDAYRRIRTEFPDSKIEINKIGESYILTGSAETEEAKDTI 129

Query: 161 VELSETFLSQSGRNQ-----YANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGF 215
             +     +     +      ++   + V+N + +   +QV +K+TI E+ +D  + IG 
Sbjct: 130 ANIVGEATASKKEKEREEHYQSSPEYRGVINKIKLPQANQVNVKLTIVEITKDFTENIGL 189

Query: 216 QHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEP 275
             +   S++G  +                       +  S  T++HA+      + LAEP
Sbjct: 190 DWNSIKSAAGAFQFLN-------------------FNAQSISTLVHAINDEAIAKVLAEP 230

Query: 276 TLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTE 335
            L+ +SG+ ASF  GG+    + + +    SV   ++G+ L+    V    RI + +  E
Sbjct: 231 NLSVLSGEYASFLVGGEIPIVSTNQNG--ISVEYKEFGIKLNIGAKVNEKKRIRVMLGEE 288

Query: 336 VSEPVIGVN---AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIP 392
           VS      N       PS R+RKA+TTVEL  G + +L GL+    ++  + IP +  +P
Sbjct: 289 VSSIDKVFNLRGGDSYPSLRIRKANTTVELGDGESFILGGLISSTERESLKKIPFIGDVP 348

Query: 393 ILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIY 452
           +LGALFRN++  R ++E+ + AT  LVKPV+ R +  PD  +      + FF    N   
Sbjct: 349 LLGALFRNAQTQRNQSELVVVATVNLVKPVSARQIELPD--FMHTSTIERFF----NLTN 402

Query: 453 GPKEASEVEGQNYKGAIGFI 472
                   + +++    GFI
Sbjct: 403 IKDAKRRKQAKDFLQKGGFI 422


>gi|261251281|ref|ZP_05943855.1| type II/IV secretion system secretin RcpA/CpaC associated with Flp
           pilus assembly [Vibrio orientalis CIP 102891]
 gi|260938154|gb|EEX94142.1| type II/IV secretion system secretin RcpA/CpaC associated with Flp
           pilus assembly [Vibrio orientalis CIP 102891]
          Length = 441

 Score =  266 bits (679), Expect = 7e-69,   Method: Composition-based stats.
 Identities = 107/442 (24%), Positives = 185/442 (41%), Gaps = 43/442 (9%)

Query: 46  KGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHD 105
             + +S+       + +   +  V V++   AD  +     + ++G   G  +VI+    
Sbjct: 22  ASQLMSLDQGAAKTINLKRQIATVFVANQQIADYKIIDDNKVVVYGVGQGSTSVIVYDRG 81

Query: 106 GKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSE 165
           G ++ N ++++ + +  L+ T+     D N+ V  V D VVL G+V + +  Q+   L  
Sbjct: 82  GNEIYNAELVVNQSLRLLKQTIIARFPDENVVVSNVGDQVVLDGIVSSEEVKQKVYRLVG 141

Query: 166 TFLSQ-----------------SGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRD 208
             L +                    +  +  +  +V+N L +   +Q+ +K+T+AEV   
Sbjct: 142 EMLKKERRRHTYELRDADGEEYDELDYTSRFTYDQVINHLKVLTTEQINVKLTVAEVSSS 201

Query: 209 ILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATA 268
            L ++G  +S +G                    G   +           +V+ A      
Sbjct: 202 FLSELGVSYSDSGE------------------PGKFVNKLLDFTAQDIVSVISASGDDKI 243

Query: 269 IRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRI 328
            + LAEP L+ ISG+ ASF +GG+             S++  +YGV L     V     I
Sbjct: 244 GQVLAEPNLSVISGEQASFLAGGEIPIAVRDEDG--ISISYKEYGVKLAMVAKVTDSENI 301

Query: 329 GLRIQTEVSEPVIGVNAGD----MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEG 384
            L +  EVS              +P+ R R+A TTV L  G + VLAGLL  + ++    
Sbjct: 302 RLTLIPEVSSIDESNKTSTGLISVPTLRTRRAQTTVHLKDGQSFVLAGLLTSEEREALTK 361

Query: 385 IPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFF 444
           IP L  IPILGALF ++  NR +TE+ I AT  LV PV    +  P   +    D +   
Sbjct: 362 IPFLGDIPILGALFSHTTTNRSKTELIIVATVNLVDPVESEQVKLP--SFKRTSDIERLL 419

Query: 445 FNRVNKIYGPKEASEVEGQNYK 466
              ++++  P+    +E   + 
Sbjct: 420 RIDLSELNEPELEGTIEQGGFN 441


>gi|332162954|ref|YP_004299531.1| putative tight adherance operon protein [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|325667184|gb|ADZ43828.1| putative tight adherance operon protein [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
          Length = 410

 Score =  266 bits (679), Expect = 7e-69,   Method: Composition-based stats.
 Identities = 106/403 (26%), Positives = 188/403 (46%), Gaps = 33/403 (8%)

Query: 59  ILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIER 118
           +++   ++  V VS    AD  +    ++ ++ K  G A  IL   +   +    IL++ 
Sbjct: 1   MIKTQEEIDTVFVSAAAIADYELVGKNSIIVYAKQEGTAEFILFNQNHHPIKKSAILVDN 60

Query: 119 DIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYAN 178
            I      +R    +S+I +  + D+ +L G V T +  +    +    +         +
Sbjct: 61  TITAAHKRIRLEYPESDIEINKIGDSYILTGTVETEEAKETIASIIGEAIGSEKTIASNS 120

Query: 179 SSSK-------------KVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSG 225
                            +V+N + + G +QV +K+TIAEV +D  + IG   S  G+ SG
Sbjct: 121 KKDSDGNNQYFNSPEYSRVVNKIKLPGSNQVNVKLTIAEVSKDFSENIGMDWSTIGNFSG 180

Query: 226 PSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSA 285
             + F  +   KF ++G                ++HA+   +  R LAEP L+ +SG+SA
Sbjct: 181 SFQFFKLNGSNKFNAKG-------------ISALVHAINDDSIARVLAEPNLSVLSGESA 227

Query: 286 SFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPV---IG 342
           SF  GG+     V+++  +T +T   +G+ L+    V +  RI +++  EVS        
Sbjct: 228 SFLVGGELPL--VNTTANSTVITYKQFGIKLNIGAKVNAKKRIRIKLDEEVSSVDKVFNI 285

Query: 343 VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSR 402
                 PS+R RKA TT+EL  G + +L GL+    ++  + IP +  IPILGA FRN+ 
Sbjct: 286 DGGDAYPSFRTRKAATTLELGDGESFILGGLISSSEREALKKIPFIGDIPILGAFFRNAE 345

Query: 403 FNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFF 445
             + +TE+ + AT  LV+PV+ +++  P  ++      + FF 
Sbjct: 346 TRKNQTELVVVATVNLVRPVSEKEVELP--NFMHTSTLERFFN 386


>gi|51597670|ref|YP_071861.1| outer membrane secretin family protein [Yersinia pseudotuberculosis
           IP 32953]
 gi|186896808|ref|YP_001873920.1| type II and III secretion system protein [Yersinia
           pseudotuberculosis PB1/+]
 gi|51590952|emb|CAH22610.1| putative outer membrane secretin family protein [Yersinia
           pseudotuberculosis IP 32953]
 gi|186699834|gb|ACC90463.1| type II and III secretion system protein [Yersinia
           pseudotuberculosis PB1/+]
          Length = 439

 Score =  266 bits (679), Expect = 8e-69,   Method: Composition-based stats.
 Identities = 105/440 (23%), Positives = 190/440 (43%), Gaps = 35/440 (7%)

Query: 41  DVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVI 100
                  K+I + +    I+++  ++  V VS    AD  +    ++ ++ K  G A   
Sbjct: 26  FENSANAKQIYLPIGGSHIIKMQEEIDTVFVSAAKTADYEIVDNNSVIIYAKKEGLAEFT 85

Query: 101 LIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRA 160
           L   + + +    +L+   I      +R    DS I +  + ++ +L G   T +     
Sbjct: 86  LFNKNHQPISKTRVLVNNTINDAYRRIRTEFPDSKIEINKIGESYILTGSAETEEAKDTI 145

Query: 161 VELSETFLSQSGRNQ-----YANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGF 215
             +     +     +      +N   + V+N + +   +QV +K+TI E+ +D  + IG 
Sbjct: 146 ASIVGEATASKKEKEREESYQSNPEYRGVINKIKLPQANQVNVKLTIVEITKDFTENIGL 205

Query: 216 QHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEP 275
             +   S++G  +                       +  S  T++HA+      + LAEP
Sbjct: 206 DWNSIKSAAGAFQFLN-------------------FNAQSISTLVHAINDEAIAKVLAEP 246

Query: 276 TLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTE 335
            L+ +SG+ ASF  GG+    + + +    SV   ++G+ L+    V    RI + +  E
Sbjct: 247 NLSVLSGEYASFLVGGEIPIVSTNQNG--ISVEYKEFGIKLNIGAKVNEKKRIRVMLGEE 304

Query: 336 VSEPVIGVN---AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIP 392
           VS      N       PS R+RKA+TTVEL  G + +L GL+    ++  + IP +  +P
Sbjct: 305 VSSIDKVFNLRGGDSYPSLRIRKANTTVELGDGESFILGGLISSTERESLKKIPFIGDVP 364

Query: 393 ILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIY 452
           +LGALFRN++  R ++E+ + AT  LVKPV+ R +  PD  +      + FF    N   
Sbjct: 365 LLGALFRNAQTQRNQSELVVVATVNLVKPVSARQIELPD--FMHTSTVERFF----NLTN 418

Query: 453 GPKEASEVEGQNYKGAIGFI 472
                   + + +    GFI
Sbjct: 419 IKDAKRRKQAKEFLQKGGFI 438


>gi|86144318|ref|ZP_01062650.1| Flp pilus assembly protein [Vibrio sp. MED222]
 gi|85837217|gb|EAQ55329.1| Flp pilus assembly protein [Vibrio sp. MED222]
          Length = 441

 Score =  265 bits (678), Expect = 9e-69,   Method: Composition-based stats.
 Identities = 110/442 (24%), Positives = 186/442 (42%), Gaps = 43/442 (9%)

Query: 46  KGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHD 105
             + +++       + +   +  V V++   AD  +     + ++G   G  +VI+    
Sbjct: 22  ASELMNLDQGAAKTINLKRQISTVFVANQEIADYKIIDENKVVVYGVGQGTTSVIVYDRG 81

Query: 106 GKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSE 165
           G ++ N ++++ + +  L+ TL     D N+ V  V D VVL G+V + +  Q+   L  
Sbjct: 82  GNEIYNAELVVNQSLRLLKQTLIARFPDENVVVSNVGDQVVLDGIVGSEEIKQKINRLVG 141

Query: 166 TFLSQSGRNQY-----------------ANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRD 208
             L +  R                    A  +  +V+N L +   +Q+ +K+T+AEV   
Sbjct: 142 EMLKKDRRRAAYELKDADGEALDELEYTAKYNYDQVINNLKVLTTEQINVKLTVAEVSSS 201

Query: 209 ILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATA 268
            L ++G  +S +G                    G   +           +V+ A      
Sbjct: 202 FLTELGVTYSDSGD------------------PGTFVNKLLDFTAQDIVSVISASGDDKI 243

Query: 269 IRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRI 328
            R LAEP L+ ISG+ ASF +GG+             +++  +YGV L     V     I
Sbjct: 244 GRVLAEPNLSVISGEQASFLAGGEIPIAIRDEDG--ITISYKEYGVKLAMVAKVTDTENI 301

Query: 329 GLRIQTEVSEPV----IGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEG 384
            L +  EVS              +PS R R+A TTV L  G + VLAGLL  + ++    
Sbjct: 302 RLTLIPEVSSIDESNKTTTGLISVPSLRTRRAQTTVHLKDGQSFVLAGLLTSEERESLTK 361

Query: 385 IPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFF 444
           IP+L  IPILGALF +S  NR +TE+ I AT  LV PV    +  P   +    D +   
Sbjct: 362 IPILGDIPILGALFSHSSTNRSKTELIIVATVNLVDPVEQEQVKLP--SFRRTSDLERLL 419

Query: 445 FNRVNKIYGPKEASEVEGQNYK 466
              ++++  P+  + +    + 
Sbjct: 420 RIDLSELDEPELENTINQGGFN 441


>gi|197123317|ref|YP_002135268.1| type II and III secretion system protein [Anaeromyxobacter sp. K]
 gi|196173166|gb|ACG74139.1| type II and III secretion system protein [Anaeromyxobacter sp. K]
          Length = 484

 Score =  265 bits (678), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 123/465 (26%), Positives = 202/465 (43%), Gaps = 54/465 (11%)

Query: 20  NPSVAKLPPIKEANAAVINIS-DVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKAD 78
              +        A   V  +  D E+G  + +S+   +  +L V   +  + V++P  AD
Sbjct: 8   VALMLVGGGAAAAQDVVPTMRIDREVGAARSMSLEAGQNRLLVVSDQIGRIAVANPDVAD 67

Query: 79  VVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRV 138
           + V +P  + L  K +G  ++ L   D   +  + + + R++  L   L+   A   I V
Sbjct: 68  LKVVTPYQVLLTAKGIGSTDLTLWDRDNHPL-VVALQVTRNLEGLRKQLKELFAGEKIDV 126

Query: 139 EMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTL 198
               D VV+ G V  ++  +R  E++                + KV NL+ ++G+ QV L
Sbjct: 127 SSAGDLVVISGQVSDVRIPERVAEVAR-------------LHASKVANLVQVSGQQQVQL 173

Query: 199 KVTIAEVRRDILKQIGFQH----------SITGSSSGPSKSFAADFGGKFVSEGGDFS-- 246
           +V  AEV R  L+++G                  +      F        +   G     
Sbjct: 174 EVRFAEVGRTGLREMGVNFFHKSDDGKRVGGMTGNRTYPGDFLNTQSNPAIPGTGPRGLW 233

Query: 247 -------------------VKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASF 287
                                    +F F  +L+ LE++   +TLAEPTL A+SGQ A+F
Sbjct: 234 GPGLPPDVPNAAFNNAFSFFLSQGGQFPFSVMLNLLEQSNLAKTLAEPTLVAMSGQEAAF 293

Query: 288 TSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGD 347
            +GG+       S+ G T+V    +G+ L FTPTV+    I LR++ EVS+         
Sbjct: 294 LAGGELPIPLA-STFGQTAVEWKKFGIQLRFTPTVIGD-AIHLRLKAEVSDLDPTTAVTV 351

Query: 348 ----MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRF 403
               +P    R+++TT+ L  G +  +AGL+ D ++     +P+L  IPILGALFR+  +
Sbjct: 352 GGTTIPGLVSRQSETTIRLGDGQSFAVAGLISDKVRSQSARVPVLGSIPILGALFRSQAY 411

Query: 404 NREETEIFIAATPFLVKPVAMRDL-SRPDD-HYSVEDDAKAFFFN 446
            R+ETE+ +  T  L KPVA  +L   P D   +   DA  F   
Sbjct: 412 QRDETELLVVVTARLAKPVAPHELPPLPTDFENNDPSDAALFLLG 456


>gi|153948843|ref|YP_001399594.1| type II/III secretion system protein [Yersinia pseudotuberculosis
           IP 31758]
 gi|152960338|gb|ABS47799.1| type II/III secretion system protein [Yersinia pseudotuberculosis
           IP 31758]
          Length = 439

 Score =  265 bits (677), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 105/440 (23%), Positives = 189/440 (42%), Gaps = 35/440 (7%)

Query: 41  DVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVI 100
                  K+I + +    I++   ++  V VS    AD  +    ++ ++ K  G A   
Sbjct: 26  FENTATAKQIYLPIGGSHIIKTQEEIDTVFVSAAKTADYEIVDNNSVIIYAKKEGLAEFT 85

Query: 101 LIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRA 160
           L   + + +    +L+   I      +R    DS I +  + ++ +L G   T +     
Sbjct: 86  LFNKNHQPISKTRVLVNNTINDAYRRIRTEFPDSKIEINKIGESYILTGSAETEEAKDTI 145

Query: 161 VELSETFLSQSGRNQ-----YANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGF 215
             +     +     +      +N   + V+N + +   +QV +K+TI E+ +D  + IG 
Sbjct: 146 TSIIGEATASKKEKEREESYQSNPEYRGVINKIKLPQANQVNVKLTIVEITKDFTENIGL 205

Query: 216 QHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEP 275
             +   S++G  +                       +  S  T++HA+      + LAEP
Sbjct: 206 DWNSIKSAAGAFQFLN-------------------FNAQSISTLVHAINDEAIAKVLAEP 246

Query: 276 TLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTE 335
            L+ +SG+ ASF  GG+    + + +    SV   ++G+ L+    V    RI + +  E
Sbjct: 247 NLSVLSGEYASFLVGGEIPIVSTNQNG--ISVEYKEFGIKLNIGAKVNEKKRIRVMLGEE 304

Query: 336 VSEPVIGVN---AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIP 392
           VS      N       PS R+RKA+TTVEL  G + +L GL+    ++  + IP +  +P
Sbjct: 305 VSSIDKVFNLRGGDSYPSLRIRKANTTVELGDGESFILGGLISSTERESLKKIPFIGDVP 364

Query: 393 ILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIY 452
           +LGALFRN++  R ++E+ + AT  LVKPV+ R +  PD  +      + FF    N   
Sbjct: 365 LLGALFRNAQTQRNQSELVVVATVNLVKPVSARQIELPD--FMHTSTVERFF----NLTN 418

Query: 453 GPKEASEVEGQNYKGAIGFI 472
                   + + +    GFI
Sbjct: 419 IKDAKRRKQAKEFLQKGGFI 438


>gi|148974885|ref|ZP_01811865.1| rough colony protein RcpA [Vibrionales bacterium SWAT-3]
 gi|145965394|gb|EDK30643.1| rough colony protein RcpA [Vibrionales bacterium SWAT-3]
          Length = 441

 Score =  265 bits (676), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 107/442 (24%), Positives = 185/442 (41%), Gaps = 43/442 (9%)

Query: 46  KGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHD 105
             + +++       + +   +  V V++   AD  +     + ++G   G  +VI+    
Sbjct: 22  ASELMNLDQGAAKTINLKRQISTVFVANQEIADYKIIDENKVVVYGVGQGTTSVIVYDRG 81

Query: 106 GKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSE 165
           G ++ N ++++ + +  L+ TL     D N+ V  + D VVL G+V + +  Q+   L  
Sbjct: 82  GNEIYNAELVVNQSLRLLKQTLIARFPDENVVVSNIGDQVVLDGIVGSEEIKQKINRLVG 141

Query: 166 TFLSQ-----------------SGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRD 208
             L++                       A  +  +V+N L +   +Q+ +K+T+AEV   
Sbjct: 142 EMLNKERRRAAYELKDADGEALDEIEYTAQYNYDQVINNLKVLTTEQINVKLTVAEVSSS 201

Query: 209 ILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATA 268
            L ++G  +S +G                    G   +            V+ A      
Sbjct: 202 FLTELGVTYSDSGE------------------PGTFVNKLLDFTAQDIVAVISASGDDKI 243

Query: 269 IRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRI 328
            R LAEP L+ ISG+ ASF +GG+             +++  +YGV L     V     I
Sbjct: 244 GRVLAEPNLSVISGEQASFLAGGEIPIAVRDEDG--ITISYKEYGVKLAMVAKVTDTENI 301

Query: 329 GLRIQTEVSEPV----IGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEG 384
            L +  EVS              +PS R R+A TTV L  G + VLAGLL  + ++    
Sbjct: 302 RLTLIPEVSSIDESNKTTTGLISVPSLRTRRAQTTVHLKDGQSFVLAGLLTSEERESLTK 361

Query: 385 IPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFF 444
           IP+L  IPILGALF ++  NR +TE+ I AT  LV PV    +  P   +    D +   
Sbjct: 362 IPILGDIPILGALFSHTSTNRSKTELIIVATVNLVDPVEQEQVKLP--SFRRTSDLERLL 419

Query: 445 FNRVNKIYGPKEASEVEGQNYK 466
              ++++  P+  + +    + 
Sbjct: 420 RIDLSELDEPELENTINQGGFN 441


>gi|149178342|ref|ZP_01856934.1| probable type II secretion system protein [Planctomyces maris DSM
           8797]
 gi|148842868|gb|EDL57239.1| probable type II secretion system protein [Planctomyces maris DSM
           8797]
          Length = 546

 Score =  265 bits (676), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 103/440 (23%), Positives = 183/440 (41%), Gaps = 38/440 (8%)

Query: 49  KISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILI--GHDG 106
           ++S+      IL++ +DV  V ++DP+K +VV    + + + GK+ G   + L       
Sbjct: 67  ELSVQQRHSKILKMKMDVFRVAIADPSKIEVVAFGSQEVEVIGKDTGTTTMTLWLGDEAN 126

Query: 107 KQMLNLDI----------LIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQD 156
            Q+L++ +          L   +    +  +  F  +S I++   +D +++ G  R  Q+
Sbjct: 127 PQILSVQVKVEGDNSIEDLRRMEYGEFQKMINEFFPNSKIQLVPFADKLIVRGQARDEQE 186

Query: 157 SQRAVELSETF--------------------LSQSGRNQYANSSSKKVMNLLNIAGEDQV 196
           + + + +                         +       A      V+++L + GE Q+
Sbjct: 187 AVQIITIIRARSGSGGGQGGGGGGGSLFADGAAADPFPGGAMLPEATVIDMLKVPGEKQI 246

Query: 197 TLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSF 256
            LKV IA++ R   +             G ++ F      + +  GG   V         
Sbjct: 247 MLKVRIAQIDRSAARTASTNIIAQSGDFGWAQLFTGV--AQQLGNGGTGLVTASFTSSDV 304

Query: 257 ETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQH--LYKTVSSSTGATSVTTHDYGV 314
           +  + AL +    + LAEP L  ISG++A+F SGG+             A + T   +G 
Sbjct: 305 DVFISALAQNGYAKILAEPNLVTISGRTANFISGGEFAVPTVVGVGGAQAATTTFKGFGT 364

Query: 315 VLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLL 374
            L F PTVL   RI L++    S     + +G +    V+   TTV+L  G  + +AGLL
Sbjct: 365 QLSFLPTVLDKDRIRLQVSPSFSTVNPALTSGGVLGVNVQAVTTTVDLREGQVLAIAGLL 424

Query: 375 KDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLS--RPDD 432
           ++  +     +P +  IP++G LF N   +R+ETE+ I  +P LV P+   D     P  
Sbjct: 425 QEQQRGDLNRVPFIGDIPLVGPLFSNKGVSRDETELIILISPELVHPMEPEDAPTVLPGM 484

Query: 433 HYSVEDDAKAFFFNRVNKIY 452
             +   D   FF N +    
Sbjct: 485 EVTEPGDVDFFFMNNIEGKP 504


>gi|121534343|ref|ZP_01666167.1| type II and III secretion system protein [Thermosinus
           carboxydivorans Nor1]
 gi|121307113|gb|EAX48031.1| type II and III secretion system protein [Thermosinus
           carboxydivorans Nor1]
          Length = 408

 Score =  264 bits (675), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 101/379 (26%), Positives = 173/379 (45%), Gaps = 29/379 (7%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           +++ +N+  +L     VQ V V++P  ADV+V S   + + GK  G   + +    G+  
Sbjct: 29  LTVAVNQSRVLGFSG-VQRVAVANPEIADVLVVSGTEVLVVGKAPGLTTMHVWTEAGR-- 85

Query: 110 LNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLS 169
              ++ +  D A +   ++  +    IRV  V+ TV+L G V T Q   RA +L+  +  
Sbjct: 86  ATYEVEVGVDDAKVAGEIKSILGYDGIRVSKVNRTVILEGAVDTQQQKARAEKLAAVY-- 143

Query: 170 QSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKS 229
                        KV++LL +    QV ++  + E+ R  +K++G +   +  + G    
Sbjct: 144 -----------GDKVVSLLEVLRPVQVKIEAKVIEINRQKIKELGIKWGNSADTPGTFI- 191

Query: 230 FAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTS 289
               FG   ++         +         L AL ++ A + L++P +  +SG  AS   
Sbjct: 192 ----FGQSALNSKVGDVFGDLGGYADINAQLSALVKSGAAKVLSQPNVVTLSGDKASIMI 247

Query: 290 GGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVN----- 344
           GGQ        +   T +   DYG+ L   P V   G I  R++ EVS            
Sbjct: 248 GGQIPVPVAQDNNKIT-IEWKDYGIKLDIAPEVNGDGLIQSRVKAEVSSLDYNSANSIKL 306

Query: 345 --AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSR 402
               ++P  R+RKA+T + L SG T+ + GL+  +  +    +P+L  +P+LG LFR++ 
Sbjct: 307 GAGMEIPPVRLRKAETAIALSSGQTMAIGGLIATETSKDVVKVPMLGDLPVLGHLFRSTS 366

Query: 403 FNREETEIFIAATPFLVKP 421
           F R ETE+ +  TP LV P
Sbjct: 367 FRRGETELLVLITPSLVNP 385


>gi|238897548|ref|YP_002923227.1| putative tight adherance operon protein [Candidatus Hamiltonella
           defensa 5AT (Acyrthosiphon pisum)]
 gi|229465305|gb|ACQ67079.1| putative tight adherance operon protein [Candidatus Hamiltonella
           defensa 5AT (Acyrthosiphon pisum)]
          Length = 459

 Score =  264 bits (675), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 104/462 (22%), Positives = 199/462 (43%), Gaps = 55/462 (11%)

Query: 39  ISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQAN 98
                      + +   + ++++   ++  V VS+P  AD  +    T+ ++ K  G++ 
Sbjct: 24  PGSANAANTGDLFMSEGESLVIKKKQNIDTVFVSNPAVADYKIVDHNTVIIYAKAEGKSE 83

Query: 99  VILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQ 158
                 +     +  ++++  I  +   +R    +S +++E +  + +L GM  T +   
Sbjct: 84  FTFFEPNQNISYHATVMVDNIIKVVSDKIRMLYPESQVQIEKIGKSYLLTGMAPTEEVRD 143

Query: 159 RAVELSETFLSQSGRNQY--------------------------ANSSSKKVMNLLNIAG 192
             V +    +     N                             N   ++++N + +  
Sbjct: 144 NIVRMVGESIQSPKSNDKDTVSVRLDISDKGDASETTENVNSSLTNKVYERLINQIQLPV 203

Query: 193 EDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLD 252
            +QV +K++I EV ++    IGF+ +  G+ S    +F AD                   
Sbjct: 204 SNQVNVKLSIVEVSKEFKDNIGFEWANLGTFSFHKFNFTAD------------------- 244

Query: 253 RFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDY 312
                 +++AL+  +  R LAEP L+ +SG+SASF  GG+  Y     ++   S+   ++
Sbjct: 245 --RITHLVNALQDDSIARVLAEPNLSVLSGESASFLVGGEIPYVKDRDASNRASIDFKEF 302

Query: 313 GVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAG--DMPSYRVRKADTTVELPSGGTIVL 370
           G+ L  T  V    R+ + +  E+S  +    A    MPS + R+A+TTVEL  G + VL
Sbjct: 303 GIKLSVTAKVNENKRVKVMLSEEISSVIGNTKAEEFTMPSLKKRRANTTVELADGESFVL 362

Query: 371 AGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRP 430
            GL+  + Q+  + +P +  IPILG+ FR+++ N    E+ + AT  LVKP+  ++++ P
Sbjct: 363 GGLMNQEEQEALQKVPFIGDIPILGSFFRHTKTNNRSIELIVVATVNLVKPIPSKEITLP 422

Query: 431 DDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFI 472
           D  +        F    V K    K+ +E     + G  GFI
Sbjct: 423 D--FMKTSSIARFLNLSVIKNISQKKEAE----AFLGKGGFI 458


>gi|209809170|ref|YP_002264708.1| type II/III secretion system protein [Aliivibrio salmonicida
           LFI1238]
 gi|208010732|emb|CAQ81123.1| type II/III secretion system protein [Aliivibrio salmonicida
           LFI1238]
          Length = 445

 Score =  264 bits (675), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 113/398 (28%), Positives = 189/398 (47%), Gaps = 36/398 (9%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           I++       + V  D+  V +SDP  AD  V   R + ++GK++G ++V++ G  G  +
Sbjct: 30  INMSEGGAKTISVEQDISSVFLSDPKIADYQVIDKRKIVIYGKSIGSSSVLIFGEKGNTL 89

Query: 110 LNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLS 169
            N  I++ + +A ++  +     D+ + +  V + VVL+G V T Q+      +    L 
Sbjct: 90  SNKKIMVNKSLATIQQYISVKYPDTAVDIFNVGEQVVLNGTVSTEQEKDEINGIVGELLE 149

Query: 170 QSGRNQYANSSSK---------------KVMNLLNIAGEDQVTLKVTIAEVRRDILKQIG 214
           +S ++       +                V+N + +A   QV +K++IAEV +  L+QIG
Sbjct: 150 KSRKDFQFEQDMEDQDYEIQFMERHEYEGVVNNIVVATTKQVNVKISIAEVSQSFLEQIG 209

Query: 215 FQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAE 274
            Q+  + S  G        F                       +V+ A+   +  + LAE
Sbjct: 210 IQYGTSASVPGVFVQPLTSFSSS-----------------DIMSVITAIGNDSVGQILAE 252

Query: 275 PTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQT 334
           P L+ ISG+SASF  GG+    T      +T+V   ++GV L     V    +I L +  
Sbjct: 253 PNLSVISGESASFLVGGELPVVTTV--NNSTNVVYKEFGVRLDLMAKVKKDDKITLSLVP 310

Query: 335 EVSEPVIG--VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIP 392
           EVS        ++ ++P+ + R+A TTVEL  G + VL GLL  + ++  + +P +  IP
Sbjct: 311 EVSSLDTQYENDSYNLPALKTRRARTTVELGDGQSFVLGGLLNSEDKESLQKVPFIGDIP 370

Query: 393 ILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRP 430
           ILGALFRNS   R +TE+ I AT  LV+P+    +  P
Sbjct: 371 ILGALFRNSVTQRNKTELIIVATVNLVQPIHPSQIQLP 408


>gi|312883308|ref|ZP_07743034.1| Flp pilus assembly protein [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309368924|gb|EFP96450.1| Flp pilus assembly protein [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 440

 Score =  264 bits (675), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 109/439 (24%), Positives = 190/439 (43%), Gaps = 35/439 (7%)

Query: 42  VEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVIL 101
                 + ++I  +    + +   +  V + +PT AD  +     + +FG  VG  +VI+
Sbjct: 23  SNCSAAEILNIDQDSAKTINLKNSISTVFLVNPTIADYKIIDDNKLVIFGVGVGSTSVIV 82

Query: 102 IGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAV 161
            G  G ++ N ++++ + +  L+ T+        I V  + D VVL G+V + +  +   
Sbjct: 83  YGKGGSEIYNTELIVNKSLRLLKQTILARFPGETISVSNIGDQVVLDGVVSSERVKKAVS 142

Query: 162 ELS----------ETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILK 211
            L           + +   SG N     +  +++N + +   +Q+ +K+T+AEV    L 
Sbjct: 143 RLVGEMLKKQRNVQKYSDASGGNTQLEYNYHEIINNMKVLSTEQINVKITVAEVASSFLN 202

Query: 212 QIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRT 271
           +IG  +S  G  +G   +    F                        V+ A+   +    
Sbjct: 203 EIGVSYSEMGGEAGKFVNKITHFSA-----------------KDIVAVISAVGNESVGHV 245

Query: 272 LAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLR 331
           LAEP L+ ISG+ ASF  GG+             S++  +YGV L     V     I L 
Sbjct: 246 LAEPNLSVISGEKASFLVGGEIPI--GVRDDKGVSISYKEYGVKLSMIAKVADSENIRLS 303

Query: 332 IQTEVSEPVIG----VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPL 387
           +  EVS         V     PS + R+A+TTV+L  G + VLAGLL+ + ++    +P 
Sbjct: 304 LFPEVSTIDENHVTKVGQLTAPSLQTRRAETTVQLKDGQSFVLAGLLRSEERESLSKVPY 363

Query: 388 LSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNR 447
           L  IPI+GALF +S+ +R +TE+ I AT  LV PV    +  P   +    D +      
Sbjct: 364 LGDIPIIGALFSHSKTDRSKTELIIVATVNLVTPVDPDKVKLP--GFHRTSDIERLLNID 421

Query: 448 VNKIYGPKEASEVEGQNYK 466
           ++++  PK    +    + 
Sbjct: 422 LSELTEPKLGDMIIQGGFN 440


>gi|325108090|ref|YP_004269158.1| type II and III secretion system protein [Planctomyces brasiliensis
           DSM 5305]
 gi|324968358|gb|ADY59136.1| type II and III secretion system protein [Planctomyces brasiliensis
           DSM 5305]
          Length = 714

 Score =  264 bits (674), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 111/486 (22%), Positives = 193/486 (39%), Gaps = 39/486 (8%)

Query: 2   RYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISD--VEIGKGKKISIGLNKVII 59
           R   R      +  L   +    +         A +   +    +    ++S+      +
Sbjct: 22  RVFGRVLSVNTAALLLLGSLVCVQPSSASGQTHAPVTEGEIYHVLSATNQLSLTERFSRV 81

Query: 60  LQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERD 119
           L++   +  V   DP    V   +P  + +   + G   ++L+    K    +++ +E D
Sbjct: 82  LELEKRITRVDGFDPAVLTVSALTPHRVRIQAVSAGVTTLVLVDEFDKT-YTIEVFVEGD 140

Query: 120 IAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANS 179
           + +L+  + RF  DS+++   V D+VVL G+V       +  E++E F            
Sbjct: 141 VRYLQSYIDRFFPDSSVKAVKVKDSVVLRGVVADPSHISQITEVAEQFFP---------- 190

Query: 180 SSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFG---- 235
              KV+N +     +QV L+V I E +R  ++Q+GF  S    S   S +  +       
Sbjct: 191 ---KVINHMQFGAANQVRLQVRIMEAQRSRIRQLGFNWSFLNGSGYVSSNPGSLSSPLGA 247

Query: 236 ------------GKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQ 283
                       G         S   V     F   L AL++   +R L E ++ A SG+
Sbjct: 248 NLTPGQTPGLSYGGAGLSDSSISFGVVNANSVFRGFLEALKQEGLLRILVETSVVADSGR 307

Query: 284 SASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----P 339
            AS  SGG+     V  + G  SV   ++GV L   P VL  G++ L I  E SE     
Sbjct: 308 PASLLSGGEFP-ILVPQALGTLSVEWKEFGVKLEAVPIVLGQGQVILEIAPEFSERDFAN 366

Query: 340 VIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFR 399
              ++   +P+   R+A+T V +  G T+++ GL+        + +P L ++P +GA FR
Sbjct: 367 AAQLDNTTVPAITTRRANTQVRMKFGQTLMIGGLIATRYTAETDKVPFLGELPGIGAAFR 426

Query: 400 NSRFNREETEIFIAATPFLVKPVAMRDLS--RPDDHYSVEDDAKAFFFNRVNKIYGPKEA 457
             R++  ETE+ I  TP  V P+    +    P     V  D + F+   +         
Sbjct: 427 RVRYDENETELIILVTPEYVAPLDPHQVPDGGPGQFSDVPTDRELFWQGMIEVPNYGGPM 486

Query: 458 SEVEGQ 463
               G 
Sbjct: 487 PPNAGG 492


>gi|227820510|ref|YP_002824481.1| type II and III secretion system protein RhcC2 [Sinorhizobium
           fredii NGR234]
 gi|227339509|gb|ACP23728.1| type II and III secretion system protein RhcC2 [Sinorhizobium
           fredii NGR234]
          Length = 447

 Score =  263 bits (673), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 112/435 (25%), Positives = 194/435 (44%), Gaps = 21/435 (4%)

Query: 3   YLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQV 62
              R   T     L               +    ++  + ++     + + + +  IL+ 
Sbjct: 5   RSLRPVRTGKVFLLILLTVLAVHCALPSASAQVKVDAINGQV-----LELTVGEGTILRF 59

Query: 63  PVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAH 122
              V+ V ++D   ADV V SP  +Y++    G  N+I +  D      + + +  +   
Sbjct: 60  DEPVESVFLADTAIADVRVVSPGVVYIYATKTGDTNLIALSADQMTRGTVQVRVSGNPRA 119

Query: 123 LEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSK 182
            E +       + + + +     V  G  R + ++     + +++          ++  +
Sbjct: 120 AEQSALALQPTTRVDISLFGGQYVGTGQTRNVGEAMDMESVLQSY----------STPDR 169

Query: 183 KVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEG 242
             +N   IAG +QV ++V  AEV R+ L + G   S+  +S   S       G     + 
Sbjct: 170 PALNNTTIAGSNQVNIRVRFAEVARNELTRFGIDWSLFVNSGSFSFGIVRTGGASNEDDT 229

Query: 243 GDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSST 302
           G  ++    D  +   +L AL+    +  LAEP +TA++GQ+ASF +GG+     V +  
Sbjct: 230 G-IAIGARGDHVNVNVLLDALQANGILTILAEPNITAVTGQTASFLAGGEIPVP-VPAGD 287

Query: 303 GATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVN----AGDMPSYRVRKADT 358
           G   +    +GV L FTPT+L   RI L+++ EVS              +PS R+R+ADT
Sbjct: 288 GQIGIEYKQFGVSLQFTPTLLPNNRIALQVRPEVSSVSQDSVVSISGLVVPSLRIRRADT 347

Query: 359 TVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFL 418
            VE+ SG T  +AGL +    Q     P++  +PILG LF++ RF R ETE+ I  TP+L
Sbjct: 348 AVEVGSGQTFAIAGLFQRQESQTLNKTPVVGDVPILGELFKSKRFQRNETELVILITPYL 407

Query: 419 VKPVAMRDLSRPDDH 433
           V P + R++  P D 
Sbjct: 408 VTPTSERNMKTPLDS 422


>gi|218676249|ref|YP_002395068.1| Flp pilus assembly protein [Vibrio splendidus LGP32]
 gi|218324517|emb|CAV25991.1| Flp pilus assembly protein [Vibrio splendidus LGP32]
          Length = 446

 Score =  263 bits (673), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 110/442 (24%), Positives = 186/442 (42%), Gaps = 43/442 (9%)

Query: 46  KGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHD 105
             + +++       + +   +  V V++   AD  +     + ++G   G  +VI+    
Sbjct: 27  ASELMNLDQGAAKTINLKRQISTVFVANQEVADYKIIDENKVVVYGVGQGATSVIVYDRG 86

Query: 106 GKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSE 165
           G ++ N ++++ + +  L+ TL     D N+ V  V D VVL G+V + +  Q+   L  
Sbjct: 87  GNEIYNAELVVNQSLRLLKQTLIARFPDENVVVSNVGDQVVLDGIVGSEEIKQKINRLVG 146

Query: 166 TFLSQSGRNQY-----------------ANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRD 208
             L +  R                    A  +  +V+N L +   +Q+ +K+T+AEV   
Sbjct: 147 EMLKKDRRRAAYELKDADGEALDELEYTAKYNYDQVINNLKVLTTEQINVKLTVAEVSSS 206

Query: 209 ILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATA 268
            L ++G  +S +G                    G   +           +V+ A      
Sbjct: 207 FLTELGVTYSDSGQ------------------PGTFVNKLLDFTAQDIVSVISASGDDKI 248

Query: 269 IRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRI 328
            R LAEP L+ ISG+ ASF +GG+             +++  +YGV L     V     I
Sbjct: 249 GRVLAEPNLSVISGEQASFLAGGEIPIAVRDQDG--ITISYKEYGVKLAMVAKVTDTENI 306

Query: 329 GLRIQTEVSEPV----IGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEG 384
            L +  EVS              +PS R R+A TTV L  G + VLAGLL  + ++    
Sbjct: 307 RLTLIPEVSSIDESNKTTTGLISVPSLRTRRAQTTVHLKDGQSFVLAGLLTSEERESLTK 366

Query: 385 IPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFF 444
           IP+L  IPILGALF +S  NR +TE+ I AT  LV PV    +  P   +    D +   
Sbjct: 367 IPILGDIPILGALFSHSSTNRSKTELIIVATVNLVDPVEQEQVKLP--SFRRTSDLERLL 424

Query: 445 FNRVNKIYGPKEASEVEGQNYK 466
              ++++  P+  + +    + 
Sbjct: 425 RIDLSELDEPELENTINQGGFN 446


>gi|197118220|ref|YP_002138647.1| Flp pilus assembly secretin CpaC [Geobacter bemidjiensis Bem]
 gi|197087580|gb|ACH38851.1| Flp pilus assembly secretin CpaC [Geobacter bemidjiensis Bem]
          Length = 494

 Score =  263 bits (672), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 118/459 (25%), Positives = 193/459 (42%), Gaps = 62/459 (13%)

Query: 41  DVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVI 100
            V         + +N+ +++ +    + V ++ P  A++VV SP  + + GK VG   +I
Sbjct: 23  PVAAHAAVTTEVVVNRSVLVDLHTKSERVSIASPDVAELVVISPTQLQINGKKVGSTTLI 82

Query: 101 LIGHDGKQ------MLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTI 154
           +    GK       +   + ++E  I  L+  +++     NI+V+  +DT+VL G     
Sbjct: 83  VWDTAGKTSFFDVRVKRNESVLESQIEALQDQIQQMAPKDNIKVDYANDTIVLSGTAANE 142

Query: 155 QDSQRAVELSETFLSQSGRNQYANSSSKK---------------------------VMNL 187
           Q   +A++L++ + + +G    A ++                              V+N 
Sbjct: 143 QTVAKALQLAQAYTAGNGSKAGAPATDPPLDTSRSSYQLSETQTGRQGGDADTVITVLNH 202

Query: 188 LNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSV 247
           + I    QV L+V +A+V +  LK +G    I G+S+    +      G+   +  D SV
Sbjct: 203 VEIVEPQQVLLEVKVAQVDKTALKSLGISAFIRGASAEGFSNLVGAPVGELAIKNPDGSV 262

Query: 248 KGVLDR-------------------------FSFETVLHALERATAIRTLAEPTLTAISG 282
           +                                   VL AL      + LAEP L   SG
Sbjct: 263 RSQATGIAGPIPGLANFTPIDSYQLGVSSFKAGIGAVLRALVTKNLAKVLAEPNLMVQSG 322

Query: 283 QSASFTSGGQHLYKTVSSST--GATSVTTHDYGVVLHFTPTVLSPGRIGLRIQT-EVSEP 339
           Q   F +G +  Y  VS      ATS+   D GV L+F P VL  G I L+I   EVS  
Sbjct: 323 QVGKFLAGSKIPYSIVSGVGALSATSIQFIDVGVKLNFKPEVLENGLISLKIDPAEVSSI 382

Query: 340 VIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFR 399
              +     P    R+  T V+L  G +++LAGLL+++  +    IP+L  IPILGALFR
Sbjct: 383 TGVLAVNGYPIIDTREVRTRVKLKDGESLILAGLLQEEAIKAMSKIPILGDIPILGALFR 442

Query: 400 NSRFNREETEIFIAATPFLVKPVAMRD-LSRPDDHYSVE 437
           +++ + +E E+    TP LV   A    +  P D     
Sbjct: 443 STQDDIKEKELVFFITPKLVTASAPGSRILLPTDKPLTP 481


>gi|307133496|dbj|BAJ19008.1| RcpA [Aggregatibacter actinomycetemcomitans]
          Length = 460

 Score =  262 bits (670), Expect = 7e-68,   Method: Composition-based stats.
 Identities = 94/428 (21%), Positives = 180/428 (42%), Gaps = 25/428 (5%)

Query: 35  AVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNV 94
           AV+          +  S+      ++Q    +  + VS P  AD  +    T  ++ K  
Sbjct: 17  AVLGAVFSLNAYAQNFSLDKGATQLVQTKEKIDTIFVSSPNIADYEILDDNTFIIYAKEE 76

Query: 95  GQANVILIGHDGKQMLNLDILIERDIAHLE---MTLRRFIADSNIRVEMVSDTVVLHGMV 151
           G+  V   G DG+ + +  + ++  +  +      L+    ++N+ V+ V    V+ G  
Sbjct: 77  GRTEVTAFGADGRPLTSDTVNVDSVVTSIADTNKQLKSRFPNTNLSVKKVGKAYVIEGKA 136

Query: 152 RTIQDSQRAVELSETFLSQSGRNQYANSSSK-----------KVMNLLNIAGEDQVTLKV 200
           R+ ++S     +    L    +                     V++  NIA   Q+ +K+
Sbjct: 137 RSQEESDEVRRIVGEALGSGRKVTETKLGEDSLPFLDKYHYDGVVDNANIADTTQINVKL 196

Query: 201 TIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVL 260
           ++ EV + + + +G   S    S           GG   ++G        LD       +
Sbjct: 197 SVVEVNKKLSEAMGINWSHVAGSGPLVGGNFGFGGGFNGNQG-----VLRLDAKGISAFI 251

Query: 261 HALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTP 320
           +AL+  +  + LAEP ++ +SG++A    GG+  +       G+ ++   ++G+ L    
Sbjct: 252 NALDNQSNGKILAEPNISMLSGETADILVGGEIPFAQ-RDRDGSPTIIYKEFGIKLAVAA 310

Query: 321 TVLSPGRIGLRIQTEVSEPVIGVN---AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDD 377
            +    RI L +   VS      N    G++P +  RKA +  E+ +G + ++ GL   +
Sbjct: 311 KLQKNNRIRLALDQTVSTIAGNYNFDGIGNIPFFNTRKAKSLFEVANGESFIIGGLFSSN 370

Query: 378 IQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVE 437
             +    +PLL  IPILG+ FR++   R++ E+ I AT  +VKPV  +D+  PD  +   
Sbjct: 371 DLEGINKVPLLGDIPILGSFFRSATTERDKKELVIVATVNVVKPVNEKDVVYPD--FEKT 428

Query: 438 DDAKAFFF 445
              + FF 
Sbjct: 429 GTMERFFH 436


>gi|154250526|ref|YP_001411350.1| type II and III secretion system protein [Parvibaculum
           lavamentivorans DS-1]
 gi|154154476|gb|ABS61693.1| type II and III secretion system protein [Parvibaculum
           lavamentivorans DS-1]
          Length = 461

 Score =  262 bits (670), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 109/438 (24%), Positives = 191/438 (43%), Gaps = 32/438 (7%)

Query: 28  PIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTM 87
           P+       + +    +   + +SI +    IL++   V  + +++P+  DV V S R +
Sbjct: 22  PMLAVLLTALLLPQGPVLAAETLSISIGGQRILKLGQTVDRIAIANPSIVDVKVISSREL 81

Query: 88  YLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVL 147
            + G++ G  ++ +    G    +  +++  DI  L+  L R  A ++++       VVL
Sbjct: 82  RILGQSEGTTDLDIWFAGGAS-KSYYVVVGADITGLQSELARDPALADVKATETGKGVVL 140

Query: 148 HGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRR 207
            G V +++  QRA E++ ++L +               ++L +A    V ++V  A V  
Sbjct: 141 KGQVYSLEAQQRAREIARSYLGKDAG------------DMLTVADRRMVAVEVRFAAVST 188

Query: 208 DILKQIGFQHSITGSSS-------GPSKSFAADFGGKFVSEGG-----DFSVKGVLDRFS 255
             LK +G       +S          S SF    G     +        F++       +
Sbjct: 189 STLKALGLNFQSLDNSFQFAAIGPNASSSFGYTPGAGLDPDTSLPLSQAFNLFLAWPGSN 248

Query: 256 FETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSS--TGATSVTTHDYG 313
              V+ AL  A   + LAEPTL   SG+ A F +GG+       S    G  ++    +G
Sbjct: 249 LLGVISALSSANLAQLLAEPTLLVRSGEDADFLAGGEIPIPVPQSGVGNGTVTIEYKKFG 308

Query: 314 VVLHFTPTVLSPGRIGLRIQTEVSEPVIG----VNAGDMPSYRVRKADTTVELPSGGTIV 369
           V L    TVL   RI L++  EVSE        V    +P+ R R   TT+EL  G + V
Sbjct: 309 VQLGVAATVLDNDRIVLKVSPEVSELDYTNALVVQGFRIPALRTRSTRTTIELGDGQSFV 368

Query: 370 LAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDL-S 428
           LAGL+      +++ IP + ++P++G  F+ ++  RE  E+ I ATP LV P+   ++  
Sbjct: 369 LAGLMYSTSGNIEDRIPGIGELPVIGTFFKRTQNARERQELIIVATPRLVSPMEAGEVPP 428

Query: 429 RPDDHYSVEDDAKAFFFN 446
            P + +  + D      N
Sbjct: 429 LPGEGHVYDSDLGQNLLN 446


>gi|4768955|gb|AAD29695.1| rough colony protein A [Aggregatibacter actinomycetemcomitans]
          Length = 460

 Score =  262 bits (670), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 94/428 (21%), Positives = 180/428 (42%), Gaps = 25/428 (5%)

Query: 35  AVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNV 94
           AV+          +  S+      ++Q    +  + VS P  AD  +    T  ++ K  
Sbjct: 17  AVLGAVFSLNAYAQNFSLDKGATQLVQTKEKIDTIFVSSPNIADYEILDDNTFIIYAKEE 76

Query: 95  GQANVILIGHDGKQMLNLDILIERDIAHLE---MTLRRFIADSNIRVEMVSDTVVLHGMV 151
           G+  V   G DG+ + +  + ++  +  +      L+    ++N+ V+ V    V+ G  
Sbjct: 77  GRTEVTAFGADGRPLTSDTVNVDSVVTSIADTNKQLKSRFPNTNLSVKKVGKAYVIEGEA 136

Query: 152 RTIQDSQRAVELSETFLSQSGRNQYANSSSKK-----------VMNLLNIAGEDQVTLKV 200
           R+ ++S     +    L    +                     V++  NIA   Q+ +K+
Sbjct: 137 RSQEESDEVRRIVGEALGSGRKVTETKLGEDSLPFLDKYHYDDVVDNANIADTTQINVKL 196

Query: 201 TIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVL 260
           ++ EV + + + +G   S    S           GG   ++G        LD       +
Sbjct: 197 SVVEVNKKLSEAMGINWSHVAGSGPLVGGNFGFGGGFNGNQG-----VLRLDAKGISAFI 251

Query: 261 HALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTP 320
           +AL+  +  + LAEP ++ +SG++A    GG+  +       G+ ++   ++G+ L    
Sbjct: 252 NALDNQSNGKVLAEPNISMLSGETADILVGGEIPFAQ-RDRDGSPTIIYKEFGIKLAVAA 310

Query: 321 TVLSPGRIGLRIQTEVSEPVIGVN---AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDD 377
            +    RI L +   VS      N    G++P +  RKA +  E+ +G + ++ GL   +
Sbjct: 311 KLQKNNRIRLALDQTVSTIAGNYNFDGIGNIPFFNTRKAKSLFEVANGESFIIGGLFSSN 370

Query: 378 IQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVE 437
             +    +PLL  IPILG+ FR++   R++ E+ I AT  +VKPV  +D+  PD  +   
Sbjct: 371 DLEGINKVPLLGDIPILGSFFRSATTERDKKELVIVATVNVVKPVNEKDVVYPD--FEKT 428

Query: 438 DDAKAFFF 445
              + FF 
Sbjct: 429 GTMERFFH 436


>gi|307548787|dbj|BAJ19109.1| RcpA [Aggregatibacter actinomycetemcomitans]
 gi|307548802|dbj|BAJ19123.1| RcpA [Aggregatibacter actinomycetemcomitans]
          Length = 460

 Score =  262 bits (669), Expect = 9e-68,   Method: Composition-based stats.
 Identities = 94/428 (21%), Positives = 180/428 (42%), Gaps = 25/428 (5%)

Query: 35  AVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNV 94
           AV+          +  S+      ++Q    +  + VS P  AD  +    T  ++ K  
Sbjct: 17  AVLGAVFSLNAYAQNFSLDKGATQLVQTKEKIDTIFVSSPNIADYEILDDNTFIIYAKEE 76

Query: 95  GQANVILIGHDGKQMLNLDILIERDIAHLE---MTLRRFIADSNIRVEMVSDTVVLHGMV 151
           G+  V   G DG+ + +  + ++  +  +      L+    ++N+ V+ V    V+ G  
Sbjct: 77  GRTEVTAFGADGRPLTSDTVNVDSVVTSIADTNKQLKSRFPNTNLSVKKVGKAYVIEGKA 136

Query: 152 RTIQDSQRAVELSETFLSQSGRNQYANSSSK-----------KVMNLLNIAGEDQVTLKV 200
           R+ ++S     +    L    +                     V++  NIA   Q+ +K+
Sbjct: 137 RSQEESDEVRRIVGEALGSGRKVTETKLGEDSLPFLDKYHYDGVVDNANIADTTQINVKL 196

Query: 201 TIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVL 260
           ++ EV + + + +G   S    S           GG   ++G        LD       +
Sbjct: 197 SVVEVNKKLSEAMGINWSHVAGSGPLVGGNFGFGGGFNGNQG-----VLRLDAKGISAFI 251

Query: 261 HALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTP 320
           +AL+  +  + LAEP ++ +SG++A    GG+  +       G+ ++   ++G+ L    
Sbjct: 252 NALDNQSNGKVLAEPNISMLSGETADILVGGEIPFAQ-RDRDGSPTIIYKEFGIKLAVAA 310

Query: 321 TVLSPGRIGLRIQTEVSEPVIGVN---AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDD 377
            +    RI L +   VS      N    G++P +  RKA +  E+ +G + ++ GL   +
Sbjct: 311 KLQKNNRIRLALDQTVSTIAGNYNFDGIGNIPFFNTRKAKSLFEVANGESFIIGGLFSSN 370

Query: 378 IQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVE 437
             +    +PLL  IPILG+ FR++   R++ E+ I AT  +VKPV  +D+  PD  +   
Sbjct: 371 DLEGINKVPLLGDIPILGSFFRSATTERDKKELVIVATVNVVKPVNEKDVIYPD--FEKT 428

Query: 438 DDAKAFFF 445
              + FF 
Sbjct: 429 GTMERFFH 436


>gi|8096202|dbj|BAA96101.1| unnamed protein product [Actinobacillus actinomycetemcomitans]
          Length = 460

 Score =  262 bits (669), Expect = 9e-68,   Method: Composition-based stats.
 Identities = 94/428 (21%), Positives = 180/428 (42%), Gaps = 25/428 (5%)

Query: 35  AVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNV 94
           AV+          +  S+      ++Q    +  + VS P  AD  +    T  ++ K  
Sbjct: 17  AVLGAVFSLNAYAQNFSLDKGATQLVQTKEKIDTIFVSSPNIADYEILDDNTFIIYAKEE 76

Query: 95  GQANVILIGHDGKQMLNLDILIERDIAHLE---MTLRRFIADSNIRVEMVSDTVVLHGMV 151
           G+  V   G DG+ + +  + ++  +  +      L+    ++N+ V+ V    V+ G  
Sbjct: 77  GRTEVTAFGADGRPLTSDTVNVDSVVTSIADTNKQLKSRFPNTNLSVKKVGKAYVIEGKA 136

Query: 152 RTIQDSQRAVELSETFLSQSGRNQYANSSSK-----------KVMNLLNIAGEDQVTLKV 200
           R+ ++S     +    L    +                     V++  NIA   Q+ +K+
Sbjct: 137 RSQEESDEVRRIVGEALGSGRKVTETKLGEDSLPFLDKYHYDGVVDNANIADTTQINVKL 196

Query: 201 TIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVL 260
           ++ EV + + + +G   S    S           GG   ++G        LD       +
Sbjct: 197 SVVEVNKKLSEAMGINWSHVAGSGPLVGGNFGFGGGFNGNQG-----VLRLDAKGISAFI 251

Query: 261 HALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTP 320
           +AL+  +  + LAEP ++ +SG++A    GG+  +       G+ ++   ++G+ L    
Sbjct: 252 NALDNQSNGKVLAEPNISMLSGETADILVGGEIPFAQ-RDRDGSPTIIYKEFGIKLAVAA 310

Query: 321 TVLSPGRIGLRIQTEVSEPVIGVN---AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDD 377
            +    RI L +   VS      N    G++P +  RKA +  E+ +G + ++ GL   +
Sbjct: 311 KLQKNNRIRLALDQTVSTIAGNYNFDGIGNIPFFNTRKAKSLFEVANGESFIIGGLFSSN 370

Query: 378 IQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVE 437
             +    +PLL  IPILG+ FR++   R++ E+ I AT  +VKPV  +D+  PD  +   
Sbjct: 371 DLEGINKVPLLGDIPILGSFFRSATTERDKKELVIVATVNVVKPVNEKDVVYPD--FEKT 428

Query: 438 DDAKAFFF 445
              + FF 
Sbjct: 429 GTMERFFH 436


>gi|318604223|emb|CBY25721.1| type II/IV secretion system secretin RcpA/CpaC,associated with Flp
           pilus assembly [Yersinia enterocolitica subsp.
           palearctica Y11]
          Length = 410

 Score =  262 bits (669), Expect = 9e-68,   Method: Composition-based stats.
 Identities = 105/403 (26%), Positives = 187/403 (46%), Gaps = 33/403 (8%)

Query: 59  ILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIER 118
           +++   ++  V VS    AD  +    ++ ++ K  G A  IL   +   +    IL++ 
Sbjct: 1   MIKTQEEIDTVFVSAAAIADYELVGKNSIIVYAKQEGTAEFILFNQNHHPIKKSAILVDN 60

Query: 119 DIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYAN 178
            I      +R    +S+I +  + D+ +L G V T +  +    +    +         +
Sbjct: 61  TITAAHKRIRLEYPESDIEINKIGDSYILTGTVETEEAKETIASIIGEAIGSEKTIASNS 120

Query: 179 SSSK-------------KVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSG 225
                            +V+N + + G +QV +K+TIAEV +D  + IG   S  G+ SG
Sbjct: 121 KKDSDGNNQYFNSPEYSRVVNKIKLPGSNQVNVKLTIAEVSKDFSENIGMDWSTIGNFSG 180

Query: 226 PSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSA 285
             + F  +   KF ++G                ++HA+   +  R LAEP L+ +SG+SA
Sbjct: 181 SFQFFKLNGSNKFNAKG-------------ISALVHAINDGSIARVLAEPNLSVLSGESA 227

Query: 286 SFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPV---IG 342
           SF  GG+     V+++  +T +T   +G+ L+    V +  RI +++  EVS        
Sbjct: 228 SFLVGGELPL--VNTTANSTVITYKQFGIKLNIGAKVNAKKRIRIKLDEEVSSVDKVFNI 285

Query: 343 VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSR 402
                 PS+R RKA TT+EL  G + +L GL+    ++  + IP +  IPILGA F N+ 
Sbjct: 286 DGGDAYPSFRTRKAATTLELGDGESFILGGLISSSEREALKKIPFIGDIPILGAFFSNAE 345

Query: 403 FNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFF 445
             + +TE+ + AT  LV+PV+ +++  P  ++      + FF 
Sbjct: 346 TRKNQTELVVVATVNLVRPVSEKEVELP--NFMHTSTLERFFN 386


>gi|323493934|ref|ZP_08099051.1| Flp pilus assembly protein [Vibrio brasiliensis LMG 20546]
 gi|323311875|gb|EGA65022.1| Flp pilus assembly protein [Vibrio brasiliensis LMG 20546]
          Length = 441

 Score =  262 bits (669), Expect = 9e-68,   Method: Composition-based stats.
 Identities = 107/442 (24%), Positives = 185/442 (41%), Gaps = 43/442 (9%)

Query: 46  KGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHD 105
             + +S+       + +   +  V V++   AD  +     + ++G   G  +VI+    
Sbjct: 22  ASQLMSLDQGAAKTINLKRQIATVFVANQQIADYKIIDENKVVVYGVGQGSTSVIVYDRG 81

Query: 106 GKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSE 165
           G ++ N ++++ + +  L+ T+     D N+ V  V D VVL G+V + +  Q+   L  
Sbjct: 82  GNEIYNAELVVNQSLRLLKQTIIARFPDENVVVSNVGDQVVLDGIVSSEEVKQKVYRLVG 141

Query: 166 TFLSQ-----------------SGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRD 208
             L +                    +  +  +  +V+N L +   +Q+ +K+T+AEV   
Sbjct: 142 EMLKKERRRHTYELRDADGEEYDELDYTSRFTYDQVINNLKVLTTEQINVKLTVAEVSSS 201

Query: 209 ILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATA 268
            L ++G  +S +G                    G   +           +V+ A      
Sbjct: 202 FLTELGVTYSDSGE------------------PGKFVNKLLDFTAQDIVSVISASGDDKI 243

Query: 269 IRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRI 328
            + LAEP L+ ISG+ ASF +GG+             S++  +YGV L     V     I
Sbjct: 244 GQVLAEPNLSVISGEQASFLAGGEIPIAVRDEDG--ISISYKEYGVKLAMVAKVTDSENI 301

Query: 329 GLRIQTEVSEPVIGVNAGD----MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEG 384
            L +  EVS              +P+ R R+A TTV L  G + VLAGLL  + ++    
Sbjct: 302 RLTLIPEVSSIDESNKTSTGLISVPTLRTRRAQTTVHLKDGQSFVLAGLLTSEEREALTK 361

Query: 385 IPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFF 444
           IP L  IPILGALF ++  NR +TE+ I AT  LV PV    +  P   +    D +   
Sbjct: 362 IPFLGDIPILGALFSHTTTNRSKTELIIVATVNLVDPVESEQVKLP--SFKRTSDIERLL 419

Query: 445 FNRVNKIYGPKEASEVEGQNYK 466
              ++++  P+    +E   + 
Sbjct: 420 RIDLSELNEPELEGTIEQGGFN 441


>gi|262173894|ref|ZP_06041571.1| type II/IV secretion system secretin RcpA/CpaC associated with Flp
           pilus assembly [Vibrio mimicus MB-451]
 gi|261891252|gb|EEY37239.1| type II/IV secretion system secretin RcpA/CpaC associated with Flp
           pilus assembly [Vibrio mimicus MB-451]
          Length = 419

 Score =  262 bits (669), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 106/439 (24%), Positives = 182/439 (41%), Gaps = 42/439 (9%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           +++       + +   +  V V+D T AD  +     + ++G   G  +VI+    G ++
Sbjct: 1   MNLDQGAAKTINLKRQIDTVFVADNTVADYRIVDQNKVVVYGVGQGATSVIVYDRGGNEI 60

Query: 110 LNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLS 169
            N ++++ + +  L+ TL     D +I V  V D VVL G V + +   +   L    L 
Sbjct: 61  YNSEVVVNQSLRLLKQTLIARFPDESISVSNVGDQVVLDGTVSSEEVKYKIYRLVGEMLK 120

Query: 170 Q------------------SGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILK 211
           +                        A      V+N L +   +Q+ +K+TIAEV    L 
Sbjct: 121 KNVSKVNNHVIETGENNREETLQYTATYVYDGVINNLKVLTTEQINVKLTIAEVSSSFLS 180

Query: 212 QIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRT 271
           ++G  +   G                    G  ++            ++ A       + 
Sbjct: 181 ELGVSYGDIGGGD----------------VGKFYNKLLDFTAQDIVAIIAASGNDDIGQV 224

Query: 272 LAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLR 331
           LAEP L+ ISG++ASF  GG+         T   ++   +YG+ L     V     I L 
Sbjct: 225 LAEPNLSVISGETASFLVGGEIPLAIKEDDT--YTIHYKEYGIKLSMVAKVTDSENIRLS 282

Query: 332 IQTEVSEPVI----GVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPL 387
           +  EVS          ++ + PS + RKA TTV+L  G + VLAGLL  + ++    IP+
Sbjct: 283 LLPEVSSLDSVNRSDNSSYNFPSLKTRKAQTTVQLKDGQSFVLAGLLTTEERESLRKIPI 342

Query: 388 LSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNR 447
           L  IPILGALF +++ +R++TE+ I AT  LV PV    +  P   +    D +      
Sbjct: 343 LGDIPILGALFSSTKSDRKKTELIIVATVNLVDPVKTEQVKLPA--FKKTSDLERLLRID 400

Query: 448 VNKIYGPKEASEVEGQNYK 466
           ++ +  P+    +    + 
Sbjct: 401 LSGVDEPELQRTINAGGFN 419


>gi|262275469|ref|ZP_06053279.1| type II/IV secretion system secretin RcpA/CpaC associated with Flp
           pilus assembly [Grimontia hollisae CIP 101886]
 gi|262220714|gb|EEY72029.1| type II/IV secretion system secretin RcpA/CpaC associated with Flp
           pilus assembly [Grimontia hollisae CIP 101886]
          Length = 454

 Score =  261 bits (668), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 107/425 (25%), Positives = 186/425 (43%), Gaps = 33/425 (7%)

Query: 43  EIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILI 102
           +      I++G      L+    +  V +SDP  AD  V     + +FG+ +G   +I+ 
Sbjct: 25  QASAAGVINLGTGDARSLEFNAVIGTVFISDPDIADYQVIDSNKLVVFGRKLGTTTLIVF 84

Query: 103 GHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVE 162
             D + + +  I++ + +  +E  L     D ++ V  + + VVL G+V T ++      
Sbjct: 85  DEDSQTLSHRKIVVNQSLTKIEQILAIRYPDVDVSVLNMGEQVVLTGVVPTQKEKNEIYA 144

Query: 163 LSETFLSQS----------------GRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVR 206
           +    LS+                   +  A  + + ++N L +    QV +K+TIAEV 
Sbjct: 145 VVGELLSKKFVERRTQWKTSFDEEFDIDFMARRTYEGLVNNLEVTVTKQVNVKLTIAEVN 204

Query: 207 RDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERA 266
             ++ ++G +                 F G      G     G     +    + A+   
Sbjct: 205 SSLINELGIKW---------GTILEDGFAGNGQFFKGITGFGGRT--TNVAAYISAINDD 253

Query: 267 TAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPG 326
              + L+EP ++ ISG++ASF  GG+              +   ++G+ L     VL   
Sbjct: 254 NVGQVLSEPNVSVISGETASFLVGGEIPITYRIDDG--YRIEYKEFGIGLDLAAEVLRDD 311

Query: 327 RIGLRIQTEVSEPVI--GVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEG 384
           +I L +  +VS      G    D+PS++VR+A TT+EL  G + VLAGLL  + ++    
Sbjct: 312 KIKLSVMPQVSSVDNQYGDTLLDIPSFKVRRARTTLELGDGDSFVLAGLLSSEDEEALSK 371

Query: 385 IPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFF 444
           IP +  +PILGALFRN+   R +TE+ I AT  LV+PV+  +++ P            FF
Sbjct: 372 IPFIGDVPILGALFRNTSTTRRKTELVIVATVSLVEPVSSANITIP--SIQRTSALSRFF 429

Query: 445 FNRVN 449
              +N
Sbjct: 430 GVNLN 434


>gi|119566857|gb|ABL84265.1| RcpA [Yersinia ruckeri]
          Length = 438

 Score =  261 bits (668), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 106/434 (24%), Positives = 191/434 (44%), Gaps = 34/434 (7%)

Query: 46  KGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHD 105
             + + +   +  I+ V  ++  +  S    AD  +    ++ ++ K  G A   L    
Sbjct: 31  HAEALYLATGESHIINVKDEIDTIFSSATKVADYELIGTNSIIIYAKEEGLAEFNLFDKK 90

Query: 106 GKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSE 165
            K +  + + +++ I+  +  +R    DS I +  + +  +L G  +T +  +   ++  
Sbjct: 91  NKPIHKVAVFVDKIISKAKKRIRIEYPDSQININKLGEGYILTGTAQTEEARETIEKIVA 150

Query: 166 TFLSQ----SGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITG 221
             +        +  Y   S   + N + I   +QV +K+TIAEV +D    IG   S  G
Sbjct: 151 NAIGSVPVRQEKWGYTIHSHSNITNKITIPVTNQVNVKLTIAEVTKDFTDNIGLDWSTIG 210

Query: 222 SSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAIS 281
           + SG       + G                      T++ A+   +  R LAEP L+ +S
Sbjct: 211 NVSGSFHFTQFNAG-------------------KISTLVQAINDESVARVLAEPNLSVLS 251

Query: 282 GQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPV- 340
           G++ASF  GG+    + + +T   +V+  ++G+ L+    V    RI +++  EVS    
Sbjct: 252 GETASFLVGGELPIVSTTQNT--INVSYKEFGIKLNIGAKVSESKRIRVKLDEEVSSLDK 309

Query: 341 --IGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALF 398
                     P+ R RKA TTVEL  G + +L GL+  + ++  + IPL+  IPILGALF
Sbjct: 310 MFNVDGGSSYPALRTRKAGTTVELGDGESFILGGLISREDKENLKKIPLIGDIPILGALF 369

Query: 399 RNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEAS 458
           R +    + +E+ + AT  LVKP+  +D+  PD  +      + FF    N  +  +   
Sbjct: 370 RKTGTQTKRSELVVIATVNLVKPMQSKDVGLPD--FMKTSTLERFF----NYTFIRESKQ 423

Query: 459 EVEGQNYKGAIGFI 472
           E   + +    GFI
Sbjct: 424 EKLAKKFLSQGGFI 437


>gi|296124072|ref|YP_003631850.1| type II and III secretion system protein [Planctomyces limnophilus
           DSM 3776]
 gi|296016412|gb|ADG69651.1| type II and III secretion system protein [Planctomyces limnophilus
           DSM 3776]
          Length = 772

 Score =  261 bits (667), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 107/515 (20%), Positives = 198/515 (38%), Gaps = 64/515 (12%)

Query: 8   FFTMMSIFLFSSNPSVAKLPPIKEANAA--VINISDVEIGKGKKISIGLNKVIILQVPVD 65
              + ++ L      V  +    +++ A  +  + +      + + +   +  ++    +
Sbjct: 131 VPAVNALPLPQRAVPVRTVQDSNQSDTARQLHRLIESMPSSEEDLEVIHRRSQLIVTRAN 190

Query: 66  VQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDI----------L 115
           V    ++DP   DVV + PR + + G + G   + L      + L   +           
Sbjct: 191 VIRAAIADPNVIDVVQYGPREISIIGVSRGTTTLTLWFEGAAEPLIYLVKVIRDPALDFQ 250

Query: 116 IERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGR-- 173
              D   LE  L+    +S + +  +S  +V+ G  R  +++   + +    +       
Sbjct: 251 RRLDYGKLEKKLQTLFPNSKVYLIPMSYKIVVRGQARDAEEAAHILSIVRGEVINQEGSL 310

Query: 174 ---------------------------------NQYANSSSKKVMNLLNIAGEDQVTLKV 200
                                               ++ ++  ++N L + GE QV+L V
Sbjct: 311 GGPQPFLGGLGGDLGGGSSTIDNGAIGGIGNSFGGASDLAAGFIINELRVPGEFQVSLTV 370

Query: 201 TIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVL 260
            IAE+ R  + + G   S+  + S   +S            GG  ++ G+ D      +L
Sbjct: 371 RIAELNRSEMFKAGADISVLFNGSQLIESSLT---------GGAATLGGIFDNGDVSILL 421

Query: 261 HALERATAIRTLAEPTLTAISGQSASFTSGGQH--LYKTVSSSTGATSVTTHDYGVVLHF 318
             L+     + L EP LT +SG+ A F +GG+         +     S T   +G  +  
Sbjct: 422 DWLKTNGIGKILVEPRLTVLSGRQARFLAGGEFAVPTIIGIAGAQGQSTTFRGFGTSVLV 481

Query: 319 TPTVLSPGRIGLRIQTEVSEPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDI 378
           TPTVL    I L    E S+     +   +P    R+ DTTVE+  G T+ LAGL    +
Sbjct: 482 TPTVLDRDLIRLSTIAEYSDLNQANSVQGIPGTNARRIDTTVEMREGQTLALAGLYSHLM 541

Query: 379 QQLKEGIPLLSKIPILG-ALFRNSRFNREETEIFIAATPFLVKPVAMRDLSR-PDDHYSV 436
           +     IP L  IP +G ALF      ++E E+ I  TP +V+P+   ++   P    + 
Sbjct: 542 KTNISKIPFLGDIPKIGPALFSRKEKTQDENELLILITPDIVRPMDPEEVPPVPGFEVTY 601

Query: 437 EDDAKAFFFNRVNKIYGPKEASEVEGQNY-KGAIG 470
             D + F++NR+    G  +    +   Y  G+ G
Sbjct: 602 PGDHEFFWYNRIE---GTPDTGHYQVPPYGSGSNG 633


>gi|32473554|ref|NP_866548.1| outer membrane channel for pilus assembly CpaC [Rhodopirellula
           baltica SH 1]
 gi|32398234|emb|CAD78329.1| putative outer membrane channel for pilus assembly CpaC
           [Rhodopirellula baltica SH 1]
          Length = 589

 Score =  261 bits (667), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 113/455 (24%), Positives = 193/455 (42%), Gaps = 36/455 (7%)

Query: 16  LFSSNPSVAKLPPIKEANAAVINISDVEIGKGK------KISIGLNKVIILQVPVDVQDV 69
           L ++   +A L   +   A          G  +      ++ + +    IL +   +   
Sbjct: 20  LLATAFGLAMLSVSQPVMAQSATTLASAAGDHQINQTVERMDLIVKSSRILSLGERIPRF 79

Query: 70  LVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRR 129
            V +         S   + +FGK  G   + L   + K +  +D+ +  D   +E  L  
Sbjct: 80  QVHNEEVLGATPVSENQIQVFGKTPGTTQINLWDTEDK-LYTIDVTVVADAREVEGILNS 138

Query: 130 FIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLN 189
            +  +++RV  + ++ ++ G V ++ D  +AV ++E F +              V+N + 
Sbjct: 139 QLPLASLRVTPIGESAIISGYVTSVDDVDKAVAITEQFYTT-------------VINNIQ 185

Query: 190 IAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSS----GPSKSFAADFG-----GKFVS 240
           + G  QV L   I EV R  L+++G   +I   +     GPS       G       F  
Sbjct: 186 VVGIQQVLLHTKIMEVSRTKLRELGVDLAILDDNFTLLNGPSGVLDVGAGIVEGDAGFGP 245

Query: 241 EGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSS 300
                +        +FET+++AL      + LAEPT+ A  G+ A FT GG+     V  
Sbjct: 246 IPLGDTNLRFNVNGNFETLINALHEQRLTKLLAEPTVVATHGRPARFTVGGRIP-TIVPG 304

Query: 301 STGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVI----GVNAGDMPSYRVRKA 356
             G   +T  DYG  + F P V+ PGRI L ++ EVSEP       VN  ++ ++  R  
Sbjct: 305 QNGQVQITYEDYGTSIDFLPFVVGPGRIRLEVRPEVSEPDPSRAVTVNGTNVTAFTTRYV 364

Query: 357 DTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATP 416
           +T VE+ +G T  LAGLL+   +      P    +P +G LFR  +  R E E+ I  TP
Sbjct: 365 ETAVEMQAGQTFALAGLLQSRTESTTSRTPFFGSLPYVGTLFRKMQERRNEIELLILVTP 424

Query: 417 FLVKPVAMRDLSR--PDDHYSVEDDAKAFFFNRVN 449
            LV+ +   ++ R  P  +    DD + + +  + 
Sbjct: 425 ELVEAMDPHEVPRGGPGMNSHSPDDKEFYLYGHIE 459


>gi|254506218|ref|ZP_05118362.1| general secretion pathway protein D [Vibrio parahaemolyticus 16]
 gi|219551036|gb|EED28017.1| general secretion pathway protein D [Vibrio parahaemolyticus 16]
          Length = 431

 Score =  261 bits (666), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 105/413 (25%), Positives = 186/413 (45%), Gaps = 34/413 (8%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           +++G  +   +    ++  V +SDP  AD  V     + +FGK VG  +++    + + +
Sbjct: 12  MNLGEGEAKAINTKAEIASVFISDPQIADYQVVDKNKLVIFGKKVGTVSLLAFDDNSETI 71

Query: 110 LNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLS 169
           ++  +++ + + H++  ++    D +I +  + + VVL G V + +       L    L+
Sbjct: 72  ISRKLVVNQSLIHIQQQVQIRYPDVSISIYNLGEQVVLAGKVPSEKIRDEINILVGELLN 131

Query: 170 QSGRNQY---------------ANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIG 214
           +   +                      K ++N + ++   QV +K++IAEV +  L+Q G
Sbjct: 132 KEYEDYKIEWDLGENTYEMEFMTRRHYKGIVNNIEVSTTKQVNVKLSIAEVSQSFLEQFG 191

Query: 215 FQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAE 274
            ++    SS+        D    F +                 +V+ A+      + LAE
Sbjct: 192 VKYGTLDSSANFMGGTFVDQLINFSAA-------------DIVSVISAIGDDAVGQVLAE 238

Query: 275 PTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQT 334
           P L+ ISG++ASF  GG+    TV    G T+V   ++G+ L     VL   +I L +  
Sbjct: 239 PNLSVISGETASFLVGGEIPVVTVV--DGGTNVLFKEFGIRLEMMAKVLQDDKIKLSLMP 296

Query: 335 EVSEPVIGVNAG--DMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIP 392
           EVS            +P+ + R+A TTVEL  G + VL GLL  + ++    +P +  +P
Sbjct: 297 EVSSLDTQYQNDRYSLPALKTRRARTTVELGDGQSFVLGGLLSTEDRESLSRVPFIGDVP 356

Query: 393 ILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFF 445
           ILGALFR++   R +TE+ I AT  LVKPV    +  P          + FF 
Sbjct: 357 ILGALFRHTETVRNKTELVIVATVNLVKPVNPSQIQLPT--MKRTTTMQRFFN 407


>gi|238755450|ref|ZP_04616790.1| Type II/III secretion system protein [Yersinia ruckeri ATCC 29473]
 gi|238706291|gb|EEP98668.1| Type II/III secretion system protein [Yersinia ruckeri ATCC 29473]
          Length = 430

 Score =  260 bits (665), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 106/434 (24%), Positives = 191/434 (44%), Gaps = 34/434 (7%)

Query: 46  KGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHD 105
             + + +   +  I+ V  ++  +  S    AD  +    ++ ++ K  G A   L    
Sbjct: 23  HAEALYLATGESHIINVKDEIDTIFSSATKVADYELIGTNSIIIYAKEEGLAEFNLFDKK 82

Query: 106 GKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSE 165
            K +  + + +++ I+  +  +R    DS I +  + +  +L G  +T +  +   ++  
Sbjct: 83  NKPIHKVAVFVDKIISKAKKRIRIEYPDSQININKLGEGYILTGTAQTEEARETIEKIVA 142

Query: 166 TFLSQ----SGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITG 221
             +        +  Y   S   + N + I   +QV +K+TIAEV +D    IG   S  G
Sbjct: 143 NAIGSVPVRQEKWGYTIHSHSNITNKITIPVTNQVNVKLTIAEVTKDFTDNIGLDWSTIG 202

Query: 222 SSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAIS 281
           + SG       + G                      T++ A+   +  R LAEP L+ +S
Sbjct: 203 NVSGSFHFTQFNAG-------------------KISTLVQAINDESVARVLAEPNLSVLS 243

Query: 282 GQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPV- 340
           G++ASF  GG+    + + +T   +V+  ++G+ L+    V    RI +++  EVS    
Sbjct: 244 GETASFLVGGELPIVSTTQNT--INVSYKEFGIKLNIGAKVSESKRIRVKLDEEVSSLDK 301

Query: 341 --IGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALF 398
                     P+ R RKA TTVEL  G + +L GL+  + ++  + IPL+  IPILGALF
Sbjct: 302 MFNVDGGSSYPALRTRKAGTTVELGDGESFILGGLISREDKENLKKIPLIGDIPILGALF 361

Query: 399 RNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEAS 458
           R +    + +E+ + AT  LVKP+  +D+  PD  +      + FF    N  +  +   
Sbjct: 362 RKTGTQTKRSELVVIATVNLVKPMQSKDVGLPD--FMKTSTLERFF----NYTFIRESKQ 415

Query: 459 EVEGQNYKGAIGFI 472
           E   + +    GFI
Sbjct: 416 EKLAKKFLSQGGFI 429


>gi|251791991|ref|YP_003006711.1| RcpA [Aggregatibacter aphrophilus NJ8700]
 gi|247533378|gb|ACS96624.1| RcpA [Aggregatibacter aphrophilus NJ8700]
          Length = 460

 Score =  260 bits (665), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 102/430 (23%), Positives = 190/430 (44%), Gaps = 29/430 (6%)

Query: 35  AVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNV 94
           AV+          +  S+      ++Q    +  + VS P+ AD  +    T  ++ K+ 
Sbjct: 17  AVLGAMFSLNAYAQNFSLEKGATQLVQTKEKIDTIFVSSPSVADYEILDDNTFIIYAKDE 76

Query: 95  GQANVILIGHDGKQMLNLDILIERDIAHLE---MTLRRFIADSNIRVEMVSDTVVLHGMV 151
           G+A V   G DG+ + +  + ++  + ++      L+    ++N+ V+ V    V+ G  
Sbjct: 77  GKAEVTAFGADGRPLTSDTVNVDSVVTNIADTNKQLKTHFPNTNLSVKKVGKAYVIEGKA 136

Query: 152 RTIQDSQRAVELSETFLSQSGRNQYANSSSK-----------KVMNLLNIAGEDQVTLKV 200
           RT ++S     +    L    +       ++            V++  NI    Q+ +K+
Sbjct: 137 RTQEESDEVRRIVGEALGTGRKVTETKLGNESVPFLDKYSYEGVVDHSNINDTTQINVKL 196

Query: 201 TIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVL--DRFSFET 258
           T+ EV + + + +G   S    S           GG F + GG    +GVL  D      
Sbjct: 197 TVVEVNKKLSEAMGINWSHIAGS-------GPLLGGNFSAAGGFNGTQGVLRLDAKGISA 249

Query: 259 VLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHF 318
            ++AL+  +  + LAEP ++ +SG++A    GG+  +       G+ S+   ++GV L  
Sbjct: 250 FINALDNQSNGKILAEPNISMLSGETADILVGGEIPFAQ-RDKEGSPSIIYKEFGVKLAV 308

Query: 319 TPTVLSPGRIGLRIQTEVSEPVIGVN---AGDMPSYRVRKADTTVELPSGGTIVLAGLLK 375
              +    RI L +   VS      N    G++P +  R+A +  E+ +G + ++ GL  
Sbjct: 309 AAKLQKNNRIRLVLDQSVSTLAGNYNFEGIGNIPYFDTRRAKSLFEVANGESFIIGGLFS 368

Query: 376 DDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYS 435
            +  +    +PLL  +PILG+ FRN+  NRE+ E+ I AT  +VKPV  +++  PD  + 
Sbjct: 369 SNDVEGINKVPLLGDVPILGSFFRNASTNREKKELVIVATVNVVKPVEEKNIVYPD--FE 426

Query: 436 VEDDAKAFFF 445
                + FF 
Sbjct: 427 QTGTMERFFH 436


>gi|238793622|ref|ZP_04637245.1| Type II/III secretion system protein [Yersinia intermedia ATCC
           29909]
 gi|238727037|gb|EEQ18568.1| Type II/III secretion system protein [Yersinia intermedia ATCC
           29909]
          Length = 425

 Score =  260 bits (665), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 106/420 (25%), Positives = 183/420 (43%), Gaps = 30/420 (7%)

Query: 34  AAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKN 93
           A  I  + V     K + +   +  I++   ++  V VS    AD  +    ++ ++ K 
Sbjct: 4   AIAICQTVVNQAYAKPVYLSSGESYIIKTEEEIDTVFVSTAAIADYELVGKNSIIVYAKK 63

Query: 94  VGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRT 153
            G A  IL   D   M+   I++   I      ++    DSN+ +  + ++ +L G   +
Sbjct: 64  EGTAEFILFNKDNHPMIKTTIMVNDIITSAYQRIKIEYPDSNVEINKIGNSYLLTGKAES 123

Query: 154 IQDSQRAVELSETFLSQSGRNQYANSSSKK-----VMNLLNIAGEDQVTLKVTIAEVRRD 208
            +       +    +++       +          V+N + +   +QV +K+TIAEV +D
Sbjct: 124 EEAKDTIAAIIGEAINKKREQNREDQHFNNPNYLGVINKIKLPESNQVNVKLTIAEVTKD 183

Query: 209 ILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATA 268
             + IG   S    +S  S  F                     +     T++HA+   + 
Sbjct: 184 FSENIGVDWSSISEASVGSFKFL------------------KFNATGISTLVHAINDDSI 225

Query: 269 IRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRI 328
            R LAEP L+ +SG+SASF  GG+      + ++  T +    YG+ L+    V    RI
Sbjct: 226 ARVLAEPNLSVLSGESASFLVGGEIPMFNTNQNS--TIIKYKTYGIKLNIAAKVNEKNRI 283

Query: 329 GLRIQTEVSEPV---IGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGI 385
            + ++ EVS              PS R RKA TT+EL  G + +L GL+    ++  + I
Sbjct: 284 RISMEEEVSSVDKVFNVEGGNAYPSLRTRKAATTLELGDGESFILGGLISKSERESLKKI 343

Query: 386 PLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFF 445
           P +  IPILGA FRN++  +++TE+ + AT  LV PVA +D+  PD  +      +  F 
Sbjct: 344 PFIGDIPILGAFFRNAQTQKQQTELVVVATVSLVNPVAGKDVELPD--FMHTSTLERLFN 401


>gi|293391332|ref|ZP_06635666.1| type II/IV secretion system secretin RcpA/CpaC [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|32452623|gb|AAP43985.1| RcpA [Aggregatibacter actinomycetemcomitans]
 gi|290951866|gb|EFE01985.1| type II/IV secretion system secretin RcpA/CpaC [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 460

 Score =  260 bits (664), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 94/428 (21%), Positives = 180/428 (42%), Gaps = 25/428 (5%)

Query: 35  AVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNV 94
           AV+          +  S+      ++Q    +  + VS P  AD  +    +  ++ K  
Sbjct: 17  AVLGAMSSLNAYAQNFSLDKGATQLVQTKEKIDTIFVSSPNIADYEILDDNSFIIYAKEE 76

Query: 95  GQANVILIGHDGKQMLNLDILIERDIAHLE---MTLRRFIADSNIRVEMVSDTVVLHGMV 151
           G+  V   G DG+ + +  + ++  +  +      L+    ++N+ V+ V    V+ G  
Sbjct: 77  GRTEVTAFGVDGRPLTSDTVNVDSVVTSIADTNKQLKSHFPNTNLSVKKVGKAYVIEGKA 136

Query: 152 RTIQDSQRAVELSETFLSQSGRNQYANSSSK-----------KVMNLLNIAGEDQVTLKV 200
           R+ ++S     +    L    +                     V++  NIA   Q+ +K+
Sbjct: 137 RSQEESDEVRRIVGEALGNGRKITETKLGEDALPFLDKYHYDGVVDNANIADTTQINVKL 196

Query: 201 TIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVL 260
           ++ EV + + + +G   S    S           GG   ++G        LD       +
Sbjct: 197 SVVEVNKKLSEAMGINWSHVAGSGPLLGGNFGFGGGFNGNQG-----VLRLDAKGISAFI 251

Query: 261 HALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTP 320
           +AL+  +  + LAEP ++ +SG++A    GG+  +       G+ ++   ++G+ L    
Sbjct: 252 NALDNQSNGKVLAEPNISMLSGETADILVGGEIPFAQ-RDKDGSPTIIYKEFGIKLAVAA 310

Query: 321 TVLSPGRIGLRIQTEVSEPVIGVN---AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDD 377
            +    RI L +   VS      N    G++P +  RKA +  E+ +G + ++ GL   +
Sbjct: 311 KLQKNDRIRLALDQSVSTIAGNYNFEGVGNIPFFNTRKAKSLFEVANGESFIIGGLFSSN 370

Query: 378 IQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVE 437
             +    +PLL  IPILG+ FRN+   R++ E+ I AT  +VKPV  +D+  PD  +   
Sbjct: 371 DLEGINKVPLLGDIPILGSFFRNATTERDKKELVIVATVNVVKPVNEKDVVYPD--FEKT 428

Query: 438 DDAKAFFF 445
              + FF 
Sbjct: 429 GTMERFFH 436


>gi|26000712|gb|AAN75208.1| RcpA [Aggregatibacter actinomycetemcomitans]
          Length = 460

 Score =  260 bits (664), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 93/428 (21%), Positives = 179/428 (41%), Gaps = 25/428 (5%)

Query: 35  AVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNV 94
           AV+          +  S+      ++Q    +  + VS P  AD  +    T  ++ K  
Sbjct: 17  AVLGAVFSLNAYAQNFSLDKGATQLVQTKEKIDTIFVSSPNIADYEILDDNTFIIYAKEE 76

Query: 95  GQANVILIGHDGKQMLNLDILIERDIAHLE---MTLRRFIADSNIRVEMVSDTVVLHGMV 151
           G+  V   G DG+ + +  + ++  +  +      L+    ++N+ V+ V    V+ G  
Sbjct: 77  GRTEVTAFGADGRPLTSDTVNVDSVVTSIADTNKQLKSRFPNTNLSVKKVGKAYVIEGKA 136

Query: 152 RTIQDSQRAVELSETFLSQSGRNQYANSSSKK-----------VMNLLNIAGEDQVTLKV 200
           R+ ++S     +    L    +                     V++  NIA   Q+ +K+
Sbjct: 137 RSQEESDEVRRIVGEALGSGRKVTETKLGEDSLPFLDKYHYDDVVDNANIADTTQINVKL 196

Query: 201 TIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVL 260
           ++ EV + + + +G   S    S           GG   ++G        LD       +
Sbjct: 197 SVVEVNKKLSEAMGINWSHVAGSGPLVGGNFGFGGGFNGNQG-----VLRLDAKGISAFI 251

Query: 261 HALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTP 320
           +AL+  +  + L EP ++ +SG++A    GG+  +       G+ ++   ++G+ L    
Sbjct: 252 NALDNQSNGKVLPEPNISMLSGETADILVGGEIPFAQ-RDRDGSPTIIYKEFGIKLAVAA 310

Query: 321 TVLSPGRIGLRIQTEVSEPVIGVN---AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDD 377
            +    RI L +   VS      N    G++P +  RKA +  E+ +G + ++ GL   +
Sbjct: 311 KLQKNNRIRLALDQTVSTIAGNYNFDGIGNIPFFNTRKAKSLFEVANGESFIIGGLFSSN 370

Query: 378 IQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVE 437
             +    +PLL  IPILG+ FR++   R++ E+ I AT  +VKPV  +D+  PD  +   
Sbjct: 371 DLEGINKVPLLGDIPILGSFFRSATTERDKKELVIVATVNVVKPVNEKDVIYPD--FEKT 428

Query: 438 DDAKAFFF 445
              + FF 
Sbjct: 429 GTMERFFH 436


>gi|238782881|ref|ZP_04626910.1| Type II/III secretion system protein [Yersinia bercovieri ATCC
           43970]
 gi|238716304|gb|EEQ08287.1| Type II/III secretion system protein [Yersinia bercovieri ATCC
           43970]
          Length = 426

 Score =  260 bits (664), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 104/409 (25%), Positives = 186/409 (45%), Gaps = 31/409 (7%)

Query: 45  GKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGH 104
              K + I   +  I++   ++  V VS    AD  + +  ++ ++ K+ G   +IL   
Sbjct: 17  ANAKSVYISPGESYIIKTEAEIDTVFVSSAAVADYELVNKNSIIVYAKSEGTTEIILFDD 76

Query: 105 DGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELS 164
             + +    IL+   I      +     DSNI ++ + D+ +L G+V + ++      + 
Sbjct: 77  KHQVLAKKTILVNNIINAANKRVLIEYPDSNIDIDKIGDSYILTGIVESEEEKDTLATIV 136

Query: 165 ETFLSQSGRNQY-----ANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSI 219
              +             +      ++N L +   +QV +K+TIAEV +D  + +G   S 
Sbjct: 137 GEAIGSQKEKTSERQYLSTPDYAHIVNKLKLPQANQVNVKLTIAEVTKDFTENVGVDWST 196

Query: 220 TGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTA 279
            G + G  +    +  G                     T++HA+   +  R LAEP L+ 
Sbjct: 197 MGDAIGSFQFVKFNANG-------------------ISTLVHAINDESIARVLAEPNLSV 237

Query: 280 ISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEP 339
           +SG+SASF  GG+      S++  + +VT  ++G+ L+    V    RI + +  EVS  
Sbjct: 238 LSGESASFLVGGEIPI--ASNTENSQTVTYKEFGIKLNIGAKVNEKKRIRILLNEEVSSI 295

Query: 340 VIG---VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGA 396
                       PS + RKA TT+EL  G + +L GL+ +  ++  + IP +  IPILGA
Sbjct: 296 GKSFSMEGGDSYPSLKTRKAATTLELGDGESFILGGLISNSERESLKKIPFIGDIPILGA 355

Query: 397 LFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFF 445
           LFRN++  + +TE+ + AT  LVKPV+ +++  PD  +      +  F 
Sbjct: 356 LFRNAQTEQSQTELVVIATVNLVKPVSRKEIELPD--FMHTSTLERLFN 402


>gi|312116090|ref|YP_004013686.1| type II and III secretion system protein [Rhodomicrobium vannielii
           ATCC 17100]
 gi|311221219|gb|ADP72587.1| type II and III secretion system protein [Rhodomicrobium vannielii
           ATCC 17100]
          Length = 519

 Score =  260 bits (664), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 119/494 (24%), Positives = 209/494 (42%), Gaps = 55/494 (11%)

Query: 5   QRTFFTMMSIFLFSSNPSVAKLPP--------------IKEANAAVINISDVEIGKGKKI 50
            RT   ++         S                    ++   AA          +   +
Sbjct: 15  SRTLKLLICTIFLGLGASAYATEKPPSPVPPSKQPVKKVQGFGAAAPLYHLNTQNERIDV 74

Query: 51  SIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQML 110
            + LN+   ++V     + LV++   ADVV  +  ++ + GK +G   + L+  D + + 
Sbjct: 75  RVVLNRSENVKVEYPFTEALVTNSDIADVVPLTNASINILGKKIGNTRLSLLDQDKRVIG 134

Query: 111 NLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQ 170
            +DI +  D+  L   +R   + SN+RV  V+  +++ G         RA+ L+E F   
Sbjct: 135 IVDIEVSHDVDMLRRVMRDNPSFSNLRVAAVNGRIMIAGQASDAVALSRALALAEQF--- 191

Query: 171 SGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILK------------------- 211
                    +  +V N + +A   QV L+V   E  R++ +                   
Sbjct: 192 ---------APGQVTNAMTVASPQQVMLEVRFIEASRNLARGVGVNVSGGGRYAGGTTGV 242

Query: 212 -QIGFQHSITGSSSGPSKSFAADFGGKFVSEG---GDFSVKGVLDRFSFETVLHALERAT 267
             +  + SIT  S+G + +  +D      S     G  + + +      +  + ALE   
Sbjct: 243 ETLKEKSSITSDSTGITTNLISDLAAGLGSNLVPFGAMTGRVIGGSAPIDVTIRALESQG 302

Query: 268 AIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGR 327
             R LAEP L A+SG +ASF +GG+  +  V+ +    +     +G+ L FTPTVL+  +
Sbjct: 303 LARRLAEPNLVALSGDTASFLAGGEFPFP-VAGTNNTITTEFKKFGIGLAFTPTVLARRQ 361

Query: 328 IGLRIQTEVSEPVIG----VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKE 383
           I L+I+ EVSE        +   ++P   VR+A TTVEL  G +  +AGL++        
Sbjct: 362 INLKIEPEVSEIDYSAAVKIGNVEVPGLSVRRASTTVELRDGQSFAIAGLMQGFHNADTR 421

Query: 384 GIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLS-RPDDHYSVEDDAKA 442
            +P +  +PILGAL R++ F ++ET++ I  TP LV+P+   D    P  +    +D + 
Sbjct: 422 QLPWIGDVPILGALTRSTSFQKKETDLVIIVTPCLVQPMVPGDAQGSPLANRRPGNDEEF 481

Query: 443 FFFNRVNKIYGPKE 456
           F   +         
Sbjct: 482 FIAGKQEVQTSRPR 495


>gi|323495637|ref|ZP_08100708.1| type ii/iv secretion system secretin rcpa/cpac,associated with flp
           pilus assembly [Vibrio sinaloensis DSM 21326]
 gi|323319272|gb|EGA72212.1| type ii/iv secretion system secretin rcpa/cpac,associated with flp
           pilus assembly [Vibrio sinaloensis DSM 21326]
          Length = 440

 Score =  259 bits (661), Expect = 8e-67,   Method: Composition-based stats.
 Identities = 103/413 (24%), Positives = 181/413 (43%), Gaps = 38/413 (9%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           +++G  +   +    ++  V +S+P  AD  V     + +FGK VG  +++    +   +
Sbjct: 25  VNLGEGEAKAITTKQEIASVFISNPEIADYQVVDKNKLVVFGKKVGSVSLLAFDDNSNTI 84

Query: 110 LNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLS 169
           ++  +++ + + H++  ++    + +I +  + + VVL G V + +       L    L 
Sbjct: 85  VSRKLVVNKSLIHIQQQIQLRYPNISISLYNLEEQVVLAGKVPSEKIRDEINILVGELLE 144

Query: 170 QSGRNQY---------------ANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIG 214
           +   +                        ++N + +A   QV +K++IAEV +  L++ G
Sbjct: 145 KEYEDHKIEWKIGTETYEMEFMTRRHYLGIVNNIEVATTKQVNVKLSIAEVSQSFLEEFG 204

Query: 215 FQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAE 274
            Q+  +G  +G       +F                       +V+ AL   T  + LAE
Sbjct: 205 VQYGSSGQGAGTFVDQLVNFSAS-----------------DIVSVITALGDDTVGQVLAE 247

Query: 275 PTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQT 334
           P L+ ISG+SA F  GG+    T+    G T+V   ++G+ L     VL   +I L +  
Sbjct: 248 PNLSVISGESAHFLVGGELPVVTII--DGGTNVLYKEFGIRLEMMAKVLEDDKIKLSLLP 305

Query: 335 EVSEPVIGVNAG--DMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIP 392
           EVS            +P+ + R+A TTVEL  G + VL GLL  + ++    +P +  +P
Sbjct: 306 EVSSIDSQYQNERYSLPALKTRRARTTVELGDGQSFVLGGLLSTEDRESLRRVPFIGDVP 365

Query: 393 ILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFF 445
           ILGALFR+S   R  TE+ I AT  LV PV    +  P          + FF 
Sbjct: 366 ILGALFRHSETVRNRTELVIVATVNLVNPVNPSQIQLPT--MKRTTTMQRFFN 416


>gi|85707702|ref|ZP_01038768.1| type II secretion system protein [Erythrobacter sp. NAP1]
 gi|85689236|gb|EAQ29239.1| type II secretion system protein [Erythrobacter sp. NAP1]
          Length = 576

 Score =  259 bits (661), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 126/484 (26%), Positives = 213/484 (44%), Gaps = 67/484 (13%)

Query: 41  DVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVI 100
              +    +I I + +  ++QVP  + DV V++   ADV + S R +Y+FG++ G+  + 
Sbjct: 59  QQVVSPSDEIVISIGRGELVQVPGTMTDVFVANENVADVQIKSQRQLYVFGRSGGETTIY 118

Query: 101 LIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVS-DTVVLHGMVRTIQDSQR 159
                G+ + + ++ +  +I  ++  L   + ++ + V  +  +TV+L G V   +D+  
Sbjct: 119 ASDARGEVIFSANVRVGSNIGSIDQMLALAMPEAQVNVATMGTNTVLLTGTVAAPEDAAE 178

Query: 160 AVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQ------- 212
           A  L   FL +             V+  L  A   QV L+V  AEV R +++        
Sbjct: 179 AERLVTAFLGEQA----------NVITRLKTATPLQVNLQVKFAEVSRSLVRAVSGNLTT 228

Query: 213 -----------------------------IGFQHSITGSSSGPSKSFAADF--------- 234
                                        +G    +     GP                 
Sbjct: 229 FDASTGGFRGAVGTGRTLGAGEFDFRNGPLGVGSGVQNPVVGPFIDPTTGLPILDANGNP 288

Query: 235 ----GGKFVSEGGDFSVKGVLDRFSFETV--LHALERATAIRTLAEPTLTAISGQSASFT 288
               G    S     ++ G+   F  + +  L   ER   I T+++P LTA+SG++A+F 
Sbjct: 289 LTFTGPGIDSGTAGTTIAGLGRLFGLDALGALDLSERLGLITTISQPNLTALSGETATFL 348

Query: 289 SGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPV----IGVN 344
           +GG+          G  ++   ++GV L +TPTVLS GRI +R++ EVSE      + +N
Sbjct: 349 AGGEFPIPIS-QGLGNVAIEYRNFGVSLAYTPTVLSNGRISIRVRPEVSELSSQGAVTLN 407

Query: 345 AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFN 404
              +P+  +R+ +TTVEL SG + ++AGLL ++ Q   +  P L  +PILG LFR+  F 
Sbjct: 408 GFQVPALTIRRTETTVELGSGQSFMIAGLLSNNAQNALDKAPGLGDVPILGNLFRSRDFR 467

Query: 405 REETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQN 464
           R ETE+ I  TP+LVKPV   D++ P D Y   ++ + F   R N     +         
Sbjct: 468 RGETELVIVVTPYLVKPVNASDIALPTDGYHSANELEQFIGFRDNDGVSGERRPGPTAAE 527

Query: 465 YKGA 468
               
Sbjct: 528 PDAP 531


>gi|86147184|ref|ZP_01065500.1| general secretion pathway protein D [Vibrio sp. MED222]
 gi|85835068|gb|EAQ53210.1| general secretion pathway protein D [Vibrio sp. MED222]
          Length = 439

 Score =  259 bits (661), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 109/404 (26%), Positives = 178/404 (44%), Gaps = 38/404 (9%)

Query: 46  KGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHD 105
                ++   +     +  ++  V +S    AD  V     + +FGKN+G A+ I     
Sbjct: 20  AQGSTNLAQGEAKTFSIRGEIASVFISGKNIADYQVIDSNKVVVFGKNIGSASFIAFDAK 79

Query: 106 GKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSE 165
           G+++ N  +L+ +    +E  +     D+ + V  + + VVL G+V   Q+     +L  
Sbjct: 80  GRELFNRLLLVNKSYREIEQQIDVLFPDAEVFVAGIGENVVLSGVVANEQEKDNIHQLVG 139

Query: 166 TFLSQSGRNQYANSSSK----------------KVMNLLNIAGEDQVTLKVTIAEVRRDI 209
             L ++  +     S +                 V+N + I+   QV +K+TIAEV    
Sbjct: 140 ELLGKTANSTSFQMSDEESDDIDVGFMTQLNYAGVVNNIEISATKQVNVKLTIAEVSHSF 199

Query: 210 LKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAI 269
           ++  G +    G                  + G               +V+ AL   +  
Sbjct: 200 MQDFGIKMGSNG------------------TPGIFVDQLTHFSASDIVSVISALGTDSVG 241

Query: 270 RTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIG 329
           + LAEP L+ ISG+ ASF  GG+    TV    GAT+V   ++GV L     VL   +I 
Sbjct: 242 QVLAEPNLSVISGEKASFLVGGELPVVTVI--DGATNVEYKEFGVRLELLAKVLRDDKIK 299

Query: 330 LRIQTEVSEPVIGVNAGD--MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPL 387
           L +  EVS      ++ +  +P+ R R+A TTVEL  G + VL GLL  + ++    IP 
Sbjct: 300 LALTPEVSSLDGSYSSDNFDLPALRTRRAQTTVELGDGQSFVLGGLLNSEEKESLTRIPY 359

Query: 388 LSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPD 431
           +  IPI+GALFR++   R +TE+ I AT  LV+PV    +  P 
Sbjct: 360 IGDIPIIGALFRHTGTERSKTELVIVATVNLVQPVKAEQIQLPT 403


>gi|218708107|ref|YP_002415728.1| putative bacterial type II secretion system protein D; rcpA, CpaC
           [Vibrio splendidus LGP32]
 gi|218321126|emb|CAV17076.1| putative bacterial type II secretion system protein D; rcpA, CpaC
           [Vibrio splendidus LGP32]
          Length = 435

 Score =  258 bits (660), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 109/404 (26%), Positives = 178/404 (44%), Gaps = 38/404 (9%)

Query: 46  KGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHD 105
                ++   +     +  ++  V +S    AD  V     + +FGKN+G A+ I     
Sbjct: 16  AQGSTNLAQGEAKTFSIRGEIASVFISGKNIADYQVIDSNKVVVFGKNIGSASFIAFDAK 75

Query: 106 GKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSE 165
           G+++ N  +L+ +    +E  +     D+ + V  + + VVL G+V   Q+     +L  
Sbjct: 76  GRELFNRLLLVNKSYREIEQQIDVLFPDAEVFVAGIGENVVLSGVVANEQEKDNIHQLVG 135

Query: 166 TFLSQSGRNQYANSSSK----------------KVMNLLNIAGEDQVTLKVTIAEVRRDI 209
             L ++  +     S +                 V+N + I+   QV +K+TIAEV    
Sbjct: 136 ELLGKTANSTSFQMSDEESDDIDVGFMTQLNYAGVVNNIEISATKQVNVKLTIAEVSHSF 195

Query: 210 LKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAI 269
           ++  G +    G                  + G               +V+ AL   +  
Sbjct: 196 MQDFGIKMGSNG------------------TPGIFVDQLTHFSASDIVSVISALGTDSVG 237

Query: 270 RTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIG 329
           + LAEP L+ ISG+ ASF  GG+    TV    GAT+V   ++GV L     VL   +I 
Sbjct: 238 QVLAEPNLSVISGEKASFLVGGELPVVTVI--DGATNVEYKEFGVRLELLAKVLRDDKIK 295

Query: 330 LRIQTEVSEPVIGVNAGD--MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPL 387
           L +  EVS      ++ +  +P+ R R+A TTVEL  G + VL GLL  + ++    IP 
Sbjct: 296 LALTPEVSSLDGSYSSDNFDLPALRTRRAQTTVELGDGQSFVLGGLLNSEEKESLTRIPY 355

Query: 388 LSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPD 431
           +  IPI+GALFR++   R +TE+ I AT  LV+PV    +  P 
Sbjct: 356 IGDIPIIGALFRHTGTERSKTELVIVATVNLVQPVKAEQIQLPT 399


>gi|302391029|ref|YP_003826849.1| type II and III secretion system protein [Acetohalobium arabaticum
           DSM 5501]
 gi|302203106|gb|ADL11784.1| type II and III secretion system protein [Acetohalobium arabaticum
           DSM 5501]
          Length = 414

 Score =  258 bits (659), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 97/375 (25%), Positives = 169/375 (45%), Gaps = 27/375 (7%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           + +G  K  +L+V VD++   V+DP  AD+V  S   + + GK+ G   + L    G + 
Sbjct: 34  LQLGTGKSELLKV-VDLERAAVADPEVADIVTISQEELLINGKSEGTTTLHLWDQKGHR- 91

Query: 110 LNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLS 169
            +  + + ++ A +   ++  I    ++V  V + ++L G VR     QR  +++  F  
Sbjct: 92  -SYQVEVYKEEARVIKQIKELIGTDTVKVAKVEENIILSGKVRDQTQLQRVKKIAGVF-- 148

Query: 170 QSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKS 229
                       +KV+N L +    QV L   + E+ + + +++GF           S  
Sbjct: 149 -----------GEKVINELQVTNSLQVLLAAQVFEIDKAVSEELGFDWYS-----TNSGG 192

Query: 230 FAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTS 289
             +       +    F +      +   T L AL      + LA+P L   SGQ ASF  
Sbjct: 193 VESGTATLGETTTSRFGIGHYERLYQLRTKLKALIEDGKAKLLAKPKLVTKSGQKASFNV 252

Query: 290 GGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGV-----N 344
           GG+    T  SS   T V   +YGV     PTV   G++   +  +VS+          N
Sbjct: 253 GGEIPVVTADSSGEQTVV-WKNYGVQFEVEPTVTPTGKLETYLHPKVSQLDWANAVDYGN 311

Query: 345 AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFN 404
           +G +P+ +  +  T V +  G  + + GLL+    +  + IPLLS++PILG LF++  F 
Sbjct: 312 SGQLPAIKSSEVKTQVVIKDGAALAIGGLLQQYRSEDIKRIPLLSQLPILGELFKSKSFR 371

Query: 405 REETEIFIAATPFLV 419
            E++E+ I  TP ++
Sbjct: 372 EEKSELIILVTPKII 386


>gi|294102189|ref|YP_003554047.1| type II and III secretion system protein [Aminobacterium
           colombiense DSM 12261]
 gi|293617169|gb|ADE57323.1| type II and III secretion system protein [Aminobacterium
           colombiense DSM 12261]
          Length = 384

 Score =  258 bits (659), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 102/423 (24%), Positives = 168/423 (39%), Gaps = 45/423 (10%)

Query: 1   MRYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIIL 60
           M  L+R  +   ++   +       +                         + +    +L
Sbjct: 1   MACLKRKLWVFFAVVFLTVVVGALPVLAA-------------------TYHLDVGDSAVL 41

Query: 61  QVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDI 120
           +   +V+ + V +P   D +      + L GK  G A +I+    G  M  + +    + 
Sbjct: 42  KY-QNVKRMSVGNPDVLDAIPLDNNQVLLTGKVEGGAALIVWDAAGMHMEKILVHPSIEA 100

Query: 121 AHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSS 180
              E  L+  +   NI V +    VVL G V+T +D  RAV ++  F             
Sbjct: 101 PSWE--LKELLQAENIDVTVRGGAVVLEGKVKTPRDRLRAVAIAGAF------------- 145

Query: 181 SKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVS 240
            +KV+NLL +    Q+ L+  + EV++     +G          G   +F   F     +
Sbjct: 146 GEKVINLLEVDSAPQIKLRAVVMEVKKKDGDALG-----MKRLEGQEGTFWGIFDLTPDT 200

Query: 241 EGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSS 300
                  KG          ++AL      + L+ P LT +SG+ AS   GG+        
Sbjct: 201 GHMLDYTKGAHYSAKINAWINALVENKEAKILSRPYLTTLSGEEASLNVGGEIPVPVGVD 260

Query: 301 STGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPV----IGVNAGDMPSYRVRKA 356
           +     +    YGV++ FTP +   G I L  + EVSE      I      +P+ R RK 
Sbjct: 261 NN-EIKIEWKPYGVIMKFTPELDGIGEIWLTFEAEVSEIDWENAIETQGIKIPAIRTRKI 319

Query: 357 DTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATP 416
              V L    ++V+ GLL +   +L + IPLL  IPI+G LF++  F  +ETE+ I  TP
Sbjct: 320 ANKVRLGHNESLVVGGLLDNKQSKLVKKIPLLGDIPIIGELFKSREFTNDETELVITVTP 379

Query: 417 FLV 419
            +V
Sbjct: 380 EVV 382


>gi|239814526|ref|YP_002943436.1| type II and III secretion system protein [Variovorax paradoxus
           S110]
 gi|239801103|gb|ACS18170.1| type II and III secretion system protein [Variovorax paradoxus
           S110]
          Length = 504

 Score =  258 bits (659), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 123/453 (27%), Positives = 204/453 (45%), Gaps = 59/453 (13%)

Query: 54  LNKVIILQVPVDVQDVLVSD----------------------------PTKADVVV--HS 83
           L K +++ +   V  ++VS                                ADV V   S
Sbjct: 68  LGKSVVIPLKARVARIVVSGQPPSRAPAAAPAAAGQPAPAPATAANAGDGIADVDVTLLS 127

Query: 84  PRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSN-IRVEMVS 142
           P  ++  G+  G  NV+L   DG      D+++  D   L+  L   + + N IRV    
Sbjct: 128 PTDLFFRGRQAGSMNVVLQSVDGTC-YIKDVIVTIDPGALQSKLAELMPEENHIRVRSAE 186

Query: 143 DTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTI 202
            ++VL G +         + L+  +           +  KKV+NLL +    QV L+V I
Sbjct: 187 KSIVLTGEISDALKLDDVMSLAMAY----------GADGKKVVNLLRVTAPQQVMLEVKI 236

Query: 203 AEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHA 262
           AEV + +L ++G +  +  S +G     +      F+S GG       + R S    +  
Sbjct: 237 AEVSKTLLDRLGARVGL--SRTGGGGRDSYSLISSFLSGGGGLLEAIRIGRTSVG--IDG 292

Query: 263 LERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSS----STGATSVTTHDYGVVLHF 318
            +    +R LAEP + AISGQ ASF SGG+       S         ++   ++G+ + F
Sbjct: 293 QKDDGLVRILAEPNIMAISGQQASFLSGGKIFIPVAQSAAGGGGTNITLEEKEFGIGVKF 352

Query: 319 TPTVLSPGRIGLRIQTEVSEPVIGVNAGD--------MPSYRVRKADTTVELPSGGTIVL 370
           TPTVL+ GR+ L++ +EVS+     +           +PS  VR+ADTTV+L  G + V+
Sbjct: 353 TPTVLNGGRVNLKMISEVSDLSQTGSPFTTVTGVTAVLPSLTVRRADTTVQLNDGQSFVI 412

Query: 371 AGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRP 430
           AGL+K ++ +  +  P L ++P++GALFR++ F  ++TE+    TP LV+P+A      P
Sbjct: 413 AGLIKSNVTESIKRYPGLGEVPVMGALFRSTEFQNDQTELMFVITPRLVRPLA-EAPRVP 471

Query: 431 DDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQ 463
            D++ V   A+ +    +        A   + Q
Sbjct: 472 TDNHVVPSRAEVYLNGSLESATPAPVAPAGQPQ 504


>gi|171921001|gb|ACB59184.1| RcpA [Actinobacillus suis ATCC 33415]
          Length = 460

 Score =  258 bits (658), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 92/424 (21%), Positives = 176/424 (41%), Gaps = 25/424 (5%)

Query: 40  SDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANV 99
           +       K  ++   +  +++    +  V VS P  AD  +    T  L+ K  G+A +
Sbjct: 20  AFSHTAAAKTFTLEQGQSQLIKTDAKIDTVFVSSPDIADYEILDDNTFMLYAKAEGRAEI 79

Query: 100 ILIGHDGKQML---NLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQD 156
           +    DG  +            +IA     ++    +SN+ V+ +    V+ G  +   +
Sbjct: 80  VAFDVDGTPLTEDFINVNNAINNIAATNEQIQTRFPNSNLSVKKIGKAYVIEGKAKNAAE 139

Query: 157 SQRAVELSETFLSQSGRNQYANSSS-------------KKVMNLLNIAGEDQVTLKVTIA 203
           S+    +    L    +   A                 + ++N  N     Q+ +K+T+A
Sbjct: 140 SEEINRIVGESLGAGKKVVEAKVEGSEDAIPFLDKYQYEGIINNANEEDATQINVKLTVA 199

Query: 204 EVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHAL 263
           EV +    +IG   +    +   +   AA  GG   S G       +++  +   +L AL
Sbjct: 200 EVNKTFSDEIGINWNNLSGNFFRNLGSAAINGGFGKSGGQ----LALVNSNNLNVLLSAL 255

Query: 264 ERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVL 323
           +     + LAEP ++ +SG++A    GG+  +    +  G  +V   ++G+ L     V 
Sbjct: 256 DNQNNGKILAEPNISMLSGETADILVGGEVPFVQ-RNRDGELNVLYKEFGIKLAVGAKVQ 314

Query: 324 SPGRIGLRIQTEVSEPVIG--VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQL 381
              RI L +   VS       ++   +P +  R++ +T E+ +G + +++GLL     + 
Sbjct: 315 KSDRIRLLLSQSVSTIAGNYEIDDNHIPIFNTRRSKSTFEVGNGESFIISGLLNKQDIEG 374

Query: 382 KEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAK 441
            + +P L  +PILGA FR++  +RE  E+ + AT  LVKPV    +  P   +      +
Sbjct: 375 IKKVPFLGDVPILGAFFRSANSSRESKELVVVATVNLVKPVDGSQILYPT--FENTGTME 432

Query: 442 AFFF 445
            FF 
Sbjct: 433 RFFN 436


>gi|320158383|ref|YP_004190761.1| type II/IV secretion system secretin RcpA/CpaC, associated with Flp
           pilus assembly [Vibrio vulnificus MO6-24/O]
 gi|319933695|gb|ADV88558.1| type II/IV secretion system secretin RcpA/CpaC, associated with Flp
           pilus assembly [Vibrio vulnificus MO6-24/O]
          Length = 441

 Score =  257 bits (657), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 104/448 (23%), Positives = 187/448 (41%), Gaps = 43/448 (9%)

Query: 40  SDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANV 99
           + + +   + +++       + +   +  V V DP  AD  +     + ++G   G  +V
Sbjct: 16  ASLSVNSNELMNLNQGSAKTISLKRQISTVFVGDPEIADYKIIDETKVVVYGVGQGATSV 75

Query: 100 ILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQR 159
           I+    G ++ N ++++ + +  ++ TL     D +I +  V + VVL G+V + +   +
Sbjct: 76  IVYDRAGNELYNAEVVVNKSLRLVKQTLIARFPDESINITNVGEQVVLDGVVSSDEIKTQ 135

Query: 160 AVELSETFLSQSGR-----------------NQYANSSSKKVMNLLNIAGEDQVTLKVTI 202
                   L ++                   +  A      ++N L +   +Q+ +K+T+
Sbjct: 136 IYRTVGEMLKKNSTRDTFTLKDANGDEVDSLDYTATYIYDNIINNLKVLTTEQINVKLTV 195

Query: 203 AEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHA 262
           AEV    L ++G  +S +G                    G   +            V+ A
Sbjct: 196 AEVSSSFLSELGVSYSDSGQ------------------AGRFVNKLLDFTAQDIVAVITA 237

Query: 263 LERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTV 322
                  R LAEP L+ ISG++ASF  GG+             +++  +YGV L     V
Sbjct: 238 SGDDQIGRVLAEPNLSVISGETASFLVGGEIPIAIRDEDG--ITISYKEYGVKLSMVAKV 295

Query: 323 LSPGRIGLRIQTEVSEPV----IGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDI 378
                I L +  EVS             ++P+ R RKA TTV+L  G + VLAGLL  + 
Sbjct: 296 TDSENIRLSLLPEVSSIDEENKTANGLINVPALRTRKAQTTVQLKDGQSFVLAGLLTSEE 355

Query: 379 QQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVED 438
           ++    IP+L  IPILGALF +++ N+ +TE+ I AT  LV PV   D+  P   +    
Sbjct: 356 RESLSKIPVLGDIPILGALFSHTKSNQTKTELIIVATVNLVDPVKAEDIKLP--SFRRTS 413

Query: 439 DAKAFFFNRVNKIYGPKEASEVEGQNYK 466
           D +      ++ +  P+    +    + 
Sbjct: 414 DIERLLRIDLSSMNEPELEDTLNKGGFN 441


>gi|296121060|ref|YP_003628838.1| type II and III secretion system protein [Planctomyces limnophilus
           DSM 3776]
 gi|296013400|gb|ADG66639.1| type II and III secretion system protein [Planctomyces limnophilus
           DSM 3776]
          Length = 622

 Score =  257 bits (656), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 111/495 (22%), Positives = 195/495 (39%), Gaps = 41/495 (8%)

Query: 2   RYLQRTFFTMMSIFLFSSNPSVAK---LPPIKEANAAVINISDVEIGKGKKISIGLNKVI 58
           R+     + +     F S P +     +   +  NA V            K+ I      
Sbjct: 9   RWRAALVWGLCLCQSFLSYPGLTSSSGMAFAQNGNAPVAGEVVQITASRTKLEIAERFAR 68

Query: 59  ILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIER 118
           ++Q P  +  V   DP    V   +   + + G   G   +++   +G  +  +D+++  
Sbjct: 69  VVQFPRKILRVDGFDPAVLSVTALAHDQLRVQGITEGITTMVITDENGA-ITTIDVMVAG 127

Query: 119 DIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYAN 178
           D   L+  L R   ++++ V  + D V+L G V   Q     V++++ +           
Sbjct: 128 DARLLQAVLSREYPNTSVTVTKLKDNVLLRGWVVEPQQITEIVDIAKLYYP--------- 178

Query: 179 SSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAA------ 232
                V+N + + G  QV L+  + EV+R  L+ +G   +  G +   S +  A      
Sbjct: 179 ----NVLNQMKMGGPQQVQLRCKVMEVQRSKLRSLGLNFTYLGRNVAFSSTPGAISPLDA 234

Query: 233 ------DFGGKFVSEGG----DFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISG 282
                    G  +++ G      S+  V D F+F  +L AL     ++  AEPT+   SG
Sbjct: 235 FTVPIGGPPGVGLAQSGFRNATMSLGIVGDDFAFGGLLEALREEGLLKIQAEPTIVTRSG 294

Query: 283 QSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE---- 338
           + A   SGG+     V    G  ++   ++GV L   P +LSP R+   I  EVSE    
Sbjct: 295 EPAKIVSGGEFPIP-VPQGLGTIAIEWREFGVRLESVPMILSPNRLKQTIIAEVSERDLT 353

Query: 339 PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALF 398
             + +N+  +P    R  +T VE+  G T+ + GL+          IP L ++P +GA F
Sbjct: 354 NAVTLNSTTVPGLTKRTVETQVEMNFGQTLAIGGLISSRKTAQTSKIPFLGELPYVGAAF 413

Query: 399 RNSRFNREETEIFIAATPFLVKPVAMRDLS--RPDDHYSVEDDAKAFFFNRVNKI-YGPK 455
           R   ++  ETE+ +  TP  V  +    +    P    +V  D + F    +    YG  
Sbjct: 414 RRVNYDEAETELLVLITPEFVSAMDPAQVPDRLPGTASAVPTDRELFGQGIIEVPNYGDP 473

Query: 456 EASEVEGQNYKGAIG 470
             +           G
Sbjct: 474 CPNCGPRGGSSTPSG 488


>gi|33152386|ref|NP_873739.1| rough colony protein A [Haemophilus ducreyi 35000HP]
 gi|21326707|gb|AAL92467.1| RcpA [Haemophilus ducreyi]
 gi|33148609|gb|AAP96128.1| rough colony protein A [Haemophilus ducreyi 35000HP]
          Length = 456

 Score =  256 bits (654), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 84/418 (20%), Positives = 183/418 (43%), Gaps = 24/418 (5%)

Query: 44  IGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIG 103
               K  ++   +  +++    +  + VS P  AD  +    +  L+ K  G+  +++  
Sbjct: 23  PSLAKTFNLEQGQTKLIKTKTKIDTIFVSSPEVADYQILDDNSFMLYAKGEGKTEIVVFD 82

Query: 104 HDGKQMLNLDILIER---DIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRA 160
            +G  +    + +     +I+     ++    +SN+ V+ +    V+ G  +   +++  
Sbjct: 83  FEGNALTEDVVSVNNMINNISETNQQIQTRFPNSNLTVKKIGKAYVVEGKAKNEAETEDV 142

Query: 161 VELSETFLSQSGRNQYANSSSKKV-----------MNLLNIAGEDQVTLKVTIAEVRRDI 209
           + +    L         N + ++V           +N    +   Q+ +K+T+AEV +  
Sbjct: 143 IRVVGEALGAGKNVTSKNLAGEQVPFLNNYQYEGIINNTTASDATQINVKLTVAEVNKKF 202

Query: 210 LKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAI 269
             +IG   S    +   + +  A  GG     G +     ++++ + + ++ AL+  +  
Sbjct: 203 SDEIGIHWSNLSGNFFKNLTNLAIQGG----FGPEGGKLALVNQDNLQMLVTALDNQSNG 258

Query: 270 RTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIG 329
           + LAEP ++ +SG++A    GG+     +    G+ +V   ++G+ L     +    RI 
Sbjct: 259 KILAEPNISMLSGETADILVGGEVPI--IERKDGSPTVKYKEFGIKLAVGAKLQKNDRIR 316

Query: 330 LRIQTEVSEPVIG--VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPL 387
           L +  EVS       ++   +P +  R++ +T E+ +G + +++GLL  +  +    +P 
Sbjct: 317 LALSQEVSTIAGSFKLDQDSLPIFNTRRSKSTFEVGNGESFIVSGLLNKEDIESITKVPG 376

Query: 388 LSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFF 445
           L  IPILGA FR++  +R   E+ + AT  LVKPV   ++  P   +      + FF 
Sbjct: 377 LGDIPILGAFFRSANTSRGSKELVVIATVNLVKPVDGSEILYPT--FENTGTMERFFN 432


>gi|15602717|ref|NP_245789.1| RcpA [Pasteurella multocida subsp. multocida str. Pm70]
 gi|12721161|gb|AAK02936.1| RcpA [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 470

 Score =  255 bits (652), Expect = 9e-66,   Method: Composition-based stats.
 Identities = 95/424 (22%), Positives = 174/424 (41%), Gaps = 30/424 (7%)

Query: 47  GKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDG 106
            K  ++      +++    +  + VS P+ AD  +    +  ++ K  G+A V   G DG
Sbjct: 28  SKTFNLEQGGTKLVRTDEKIDTIFVSSPSVADYEILDDNSFIIYAKEEGRAEVTAFGQDG 87

Query: 107 KQMLNLDILIERDIAHLE------MTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRA 160
           K +    I +   I+++         ++    +SN+ V+ V    V+ G  RT ++S+ A
Sbjct: 88  KPLTTDFINVNPLISNINDISDTNRQIKARFPNSNLSVKKVGKAYVIEGKARTQEESEEA 147

Query: 161 VELSETFLSQSGRNQYANSSS----------------KKVMNLLNIAGEDQVTLKVTIAE 204
             +    L  S +    + +                   V+N  ++A   Q+ +K+++ E
Sbjct: 148 HRIVGEALGNSKKVTETSFNRSEGVKEYIPFLDKYQFDGVINNASVADSTQINVKLSVVE 207

Query: 205 VRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALE 264
           V + + + +G            S               G       ++       ++AL 
Sbjct: 208 VNKKLTEALGINWGRVVGVH--SGPLLGGSVSLSGGFSGSGGSTLNINATGVSAFINALN 265

Query: 265 RATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLS 324
                + LAEP+++ +SG++A    GG+  +        AT +   ++GV L     V  
Sbjct: 266 NQDNGKILAEPSISLLSGETADILVGGELPFAQKDKEGSATII-YKEFGVKLIVGAKVQK 324

Query: 325 PGRIGLRIQTEVSEPVIG---VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQL 381
             RI L +   VS         N G +P +  R+A +  E+  G + ++ GL      + 
Sbjct: 325 NKRIRLALDQSVSTIAGSYAYDNVGTVPYFNTRRAKSIFEVADGESFIIGGLFSSQDAEG 384

Query: 382 KEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAK 441
              +PLL  IPILG+ FRN+R +RE+ E+ I AT  +VKPV   D+  P   +      +
Sbjct: 385 INKVPLLGDIPILGSFFRNARTDREDKELVIVATVNVVKPVHESDIVYPT--FEQTGTME 442

Query: 442 AFFF 445
            FF 
Sbjct: 443 RFFN 446


>gi|328470518|gb|EGF41429.1| rough colony protein RcpA [Vibrio parahaemolyticus 10329]
          Length = 447

 Score =  254 bits (648), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 111/452 (24%), Positives = 189/452 (41%), Gaps = 38/452 (8%)

Query: 36  VINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVG 95
           V  +    +  G+ +S+       + V  ++  V V+D   AD  V +   + ++G   G
Sbjct: 13  VALLLPASVSAGELLSLDKGAAKTINVKRNIDTVFVADTQIADYKVIANGKLVIYGIGRG 72

Query: 96  QANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQ 155
             ++I     G ++ N ++++ + +  L+ T+     D +I++  + + +V+ G+V + +
Sbjct: 73  ATSIIAYDRAGNEIYNAEVVVNKSLRLLKQTIIARYPDEDIKLTNIGEQIVIDGVVSSEE 132

Query: 156 DSQRAVELSETFLSQSGR-----------------NQYANSSSKKVMNLLNIAGEDQVTL 198
              +        L +S +                 +  A    + ++N L +   DQ+ +
Sbjct: 133 IKDKVYRHVGEMLKKSKQRNTFELSGANGESVDPLDYTATYVFEDIINNLKVLTTDQINV 192

Query: 199 KVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFET 258
           K+T+AEV    L ++G  +             A   G      G   +            
Sbjct: 193 KLTVAEVSSSFLTELGVSY-------------AETNGKSIGGAGQFVNKILDFTAEDIVA 239

Query: 259 VLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHF 318
           V+ A    +  + LAEP L+ ISG+SASF  GG+             SVT  +YGV L  
Sbjct: 240 VISASGNDSIGQVLAEPNLSVISGESASFLVGGEIPITV--RDNDGISVTYKEYGVKLSM 297

Query: 319 TPTVLSPGRIGLRIQTEVSEPVIGVNAGD----MPSYRVRKADTTVELPSGGTIVLAGLL 374
              V     I L +  EVS              +PS R RKA TTV+L  G + VLAGLL
Sbjct: 298 VAKVTDSENIRLSLLPEVSSIDKTNGVNSGLVSVPSLRTRKAQTTVQLKDGQSFVLAGLL 357

Query: 375 KDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHY 434
             + Q+    IP L  IPILGALF  +   R +TE+ I AT  LV PV   D+  P   +
Sbjct: 358 TSEEQESLAKIPYLGDIPILGALFSKTNTERRKTELIIVATVNLVDPVKETDIKLP--KF 415

Query: 435 SVEDDAKAFFFNRVNKIYGPKEASEVEGQNYK 466
               D +      ++K+   +  + ++   + 
Sbjct: 416 KRTSDLERLLKLDLSKVDDEELENTIKAGGFN 447


>gi|327538064|gb|EGF24754.1| bacterial type II/III secretion system protein [Rhodopirellula
           baltica WH47]
          Length = 758

 Score =  254 bits (648), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 109/496 (21%), Positives = 186/496 (37%), Gaps = 62/496 (12%)

Query: 18  SSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKA 77
                +   PP   A        + EI     +S+ L +  IL++      + V D    
Sbjct: 164 GLPAELILPPPSDAAKQRASRFVESEIDPEIPLSLVLGRPKILRLADTPTRIYVPDEDTI 223

Query: 78  DVVVH---SPRTMYLFGKNVGQANVILIGHD-----GKQMLNLDILIER------DIAHL 123
              +    S R + + G   G   ++L   D     G+ +++  + +         +  L
Sbjct: 224 RTEIIDQESGRELAVTGVQPGTTTLMLWFKDSGAPSGQSVVSYLVRVYEDPILAKPVGDL 283

Query: 124 EMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVEL-------------------- 163
           E  L     +S + ++ ++D +++ G      +  + +++                    
Sbjct: 284 ETELNEKFPNSFVELDEIADRLIVRGQAPDAIEMSQILQILTGARGVRAGLTRPANPVTV 343

Query: 164 --SETFLSQSGRNQYANSSSKK-------------VMNLLNIAGEDQVTLKVTIAEVRRD 208
             +  F+          +++++             ++N + I GE QV LKVT+AEV R 
Sbjct: 344 AAAYDFVGAVDPLTSEEAAAERRRNLDPIALSQAGIINQMKIVGEQQVMLKVTVAEVNRS 403

Query: 209 ILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATA 268
             + IG    +   + G +   +              ++   LD       + AL R   
Sbjct: 404 AARSIGLNFGVDNDN-GLTVFQSLTGNLANTQNQSGANILASLDMGQVRLAIEALRRLNL 462

Query: 269 IRTLAEPTLTAISGQSASFTSGGQHLYKTVSSS---TGATSVTTHDYGVVLHFTPTVLSP 325
            RTLAEP L A++GQ A F +GGQ     +SS         V+   +GV L FTP +   
Sbjct: 463 SRTLAEPNLVAMNGQPADFQAGGQFPIPIISSGGVGNNLQGVSFVPFGVQLQFTPFIQDR 522

Query: 326 GRIGLRIQTEVSEPVIGVNAG--------DMPSYRVRKADTTVELPSGGTIVLAGLLKDD 377
             I L++  EVS     +            +     R   TTV+L SG TI +AGLL+ +
Sbjct: 523 DVIRLQMNAEVSTRDESLGTSIGGGGGGTQVSGLNSRNFSTTVQLRSGQTIAVAGLLQTN 582

Query: 378 IQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLS-RPDDHYSV 436
                +  P    +PI+GA    +R +  E E+ I  TP LV PV   +    P      
Sbjct: 583 YGASSDRTPFWGDLPIIGATGGVNRSSSGEQELVILVTPHLVAPVDACETPALPGSDVYE 642

Query: 437 EDDAKAFFFNRVNKIY 452
             D + F  NR+    
Sbjct: 643 PSDIEFFIANRLESRR 658


>gi|238789148|ref|ZP_04632936.1| Type II/III secretion system protein [Yersinia frederiksenii ATCC
           33641]
 gi|238722680|gb|EEQ14332.1| Type II/III secretion system protein [Yersinia frederiksenii ATCC
           33641]
          Length = 415

 Score =  254 bits (648), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 111/441 (25%), Positives = 197/441 (44%), Gaps = 34/441 (7%)

Query: 39  ISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQAN 98
           +   +    K + +   +  I+    ++  V VS    AD  +    ++ ++ KN G A 
Sbjct: 1   MITAQGANAKPVYLSAGESYIINTQDEINTVFVSAAAIADYELIGKNSIIVYAKNEGVAE 60

Query: 99  VILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQ 158
             L  HD K +    +L+   I  +   ++    +SNI +  +  + +L G+V + +   
Sbjct: 61  FTLFNHDHKAITKSVVLVNNIIPSVHRRIQAEYPESNIDINKIGSSYILTGLVESEEVRD 120

Query: 159 RAVELSETFLSQSGRNQY----ANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIG 214
             V +    +     N       N++   ++N + ++  +QV +K+TIAEV +D  + IG
Sbjct: 121 TVVNIIGEAIGSKRINNDRHPVGNTNHTNIINKIKLSQSNQVNVKLTIAEVTKDFTENIG 180

Query: 215 FQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAE 274
              S  G S G  + F                     +     T++HA+      R LAE
Sbjct: 181 INWSTIGESVGSFQLF-------------------KFNAKGISTLVHAINDNAIARVLAE 221

Query: 275 PTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQT 334
           P L+ +SG+ ASF  GG+      + +   ++V+  ++G+ L+    V    RI + +  
Sbjct: 222 PNLSVLSGEDASFLVGGEIPIVNTTQNG--SAVSYKEFGIKLNIGAKVNDKKRIRIILNE 279

Query: 335 EVSEPVIG---VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKI 391
           EVS              PS R RKA TT+EL  G + +L GL+  + ++  + IPL+  I
Sbjct: 280 EVSSIGKTFNINGGDSYPSIRTRKAATTLELGDGESFILGGLISRNERESLKKIPLMGDI 339

Query: 392 PILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKI 451
           P+LGA FRN++  + +TE+ + AT  LV PVA +++  PD  +      + FF    N  
Sbjct: 340 PLLGAFFRNAQTEQSQTELVVIATVNLVNPVAEKEVELPD--FMQTSTLERFF----NFT 393

Query: 452 YGPKEASEVEGQNYKGAIGFI 472
           +  +   E   + +    GFI
Sbjct: 394 HIMEIKREKAARAFLRKGGFI 414


>gi|225872754|ref|YP_002754211.1| type II/III secretion system protein [Acidobacterium capsulatum
           ATCC 51196]
 gi|225792181|gb|ACO32271.1| type II/III secretion system protein [Acidobacterium capsulatum
           ATCC 51196]
          Length = 480

 Score =  253 bits (647), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 106/481 (22%), Positives = 187/481 (38%), Gaps = 32/481 (6%)

Query: 3   YLQRTFFTMMSIFLFSSNPSVAKLPP---IKEANAAVINISDVEIGKGKKISIGLNKVII 59
             +      M++ L +  P     P         A               + + + + + 
Sbjct: 7   TRRNLLHRAMTVALIAVLPLAGARPVNAAAAAETAQGPVDFVQLNNSNFMLHLLVGRSMF 66

Query: 60  LQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERD 119
           L     ++ V VSDP   +    SP  + +  K  G +++++    G+      +  + D
Sbjct: 67  LDTATPLKRVYVSDPAVLNSFTASPHQVLITAKAPGISSLVVWDESGRS-NVYTVSSDID 125

Query: 120 IAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANS 179
           ++ L+  +        I    + D V L G V T  ++  A +L++ +      +     
Sbjct: 126 VSGLQAAINAAFPHDMIHASALQDRVTLTGEVATESEAAAAEKLAQGYAKTVENSIDLAP 185

Query: 180 SSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKS---------- 229
                          QV LKV  AEV R   +Q+GF     G ++  + +          
Sbjct: 186 Q-----------RVQQVQLKVRFAEVDRTRAQQLGFNFISAGRNAAVTGTQQFPSFSNYT 234

Query: 230 FAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTS 289
              +     ++      +       +    + ALE    ++ LAEPT+T+ISG  ASF S
Sbjct: 235 LGGNSTANPITVSNPLDLLLYSSDLNLGATIQALENDQVLQILAEPTITSISGVEASFLS 294

Query: 290 GGQHLYKTVSSSTG---ATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPV----IG 342
           GGQ  +  V   T    + +V    YGV L FTP V   G I L++  EVS       + 
Sbjct: 295 GGQFPFPVVQGGTTGFTSVTVQFRPYGVKLDFTPYVNPDGTIRLKVAPEVSALDYTNEVQ 354

Query: 343 VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSR 402
           ++   +P+   R+A T V L +G +  ++GLL   +    E +P +S+IPILG LFR+ +
Sbjct: 355 ISGYSIPAIDTRRAKTEVVLKNGQSFAISGLLDHRLTNDYERMPGISRIPILGQLFRSYQ 414

Query: 403 FNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEG 462
                T++ +  TP +V P+    ++      +        F  R+ K    K+      
Sbjct: 415 KQASTTDLIVIVTPTIVDPLHEPTVAPKLPALAKPYLDNKLFDQRLKKHPRHKKQKGNPP 474

Query: 463 Q 463
            
Sbjct: 475 P 475


>gi|28900576|ref|NP_800231.1| rough colony protein RcpA [Vibrio parahaemolyticus RIMD 2210633]
 gi|153836379|ref|ZP_01989046.1| rough colony protein RcpA [Vibrio parahaemolyticus AQ3810]
 gi|260877521|ref|ZP_05889876.1| rough colony protein RcpA [Vibrio parahaemolyticus AN-5034]
 gi|260901740|ref|ZP_05910135.1| rough colony protein RcpA [Vibrio parahaemolyticus AQ4037]
 gi|308095456|ref|ZP_05906034.2| rough colony protein RcpA [Vibrio parahaemolyticus Peru-466]
 gi|308125917|ref|ZP_05777993.2| rough colony protein RcpA [Vibrio parahaemolyticus K5030]
 gi|28808956|dbj|BAC62064.1| rough colony protein RcpA [Vibrio parahaemolyticus RIMD 2210633]
 gi|149750281|gb|EDM61026.1| rough colony protein RcpA [Vibrio parahaemolyticus AQ3810]
 gi|308087133|gb|EFO36828.1| rough colony protein RcpA [Vibrio parahaemolyticus Peru-466]
 gi|308090527|gb|EFO40222.1| rough colony protein RcpA [Vibrio parahaemolyticus AN-5034]
 gi|308108872|gb|EFO46412.1| rough colony protein RcpA [Vibrio parahaemolyticus AQ4037]
 gi|308114419|gb|EFO51959.1| rough colony protein RcpA [Vibrio parahaemolyticus K5030]
          Length = 447

 Score =  253 bits (646), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 111/452 (24%), Positives = 189/452 (41%), Gaps = 38/452 (8%)

Query: 36  VINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVG 95
           V  +    +  G+ +S+       + V  ++  V V+D   AD  V +   + ++G   G
Sbjct: 13  VALLLPASVSAGELLSLDKGAAKTINVKRNIDTVFVADTQIADYKVIANGKLVIYGIGRG 72

Query: 96  QANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQ 155
             ++I     G ++ N ++++ + +  L+ T+     D +I++  + + +V+ G+V + +
Sbjct: 73  ATSIIAYDRAGNEIYNAEVVVNKSLRLLKQTIIARYPDEDIKLTNIGEQIVIDGVVSSEE 132

Query: 156 DSQRAVELSETFLSQSGR-----------------NQYANSSSKKVMNLLNIAGEDQVTL 198
              +        L +S +                 +  A    + ++N L +   DQ+ +
Sbjct: 133 IKDKVYRHVGEMLKKSKQRNTFELSGANGESVDPLDYTATYVFEDIINNLKVLTTDQINV 192

Query: 199 KVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFET 258
           K+T+AEV    L ++G  +             A   G      G   +            
Sbjct: 193 KLTVAEVSSSFLTELGVSY-------------AETNGKSIGGAGQFVNKILDFTAEDIVA 239

Query: 259 VLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHF 318
           V+ A    +  + LAEP L+ ISG+SASF  GG+             SVT  +YGV L  
Sbjct: 240 VISASGNDSIGQVLAEPNLSVISGESASFLVGGEIPITV--RDNDGISVTYKEYGVKLSM 297

Query: 319 TPTVLSPGRIGLRIQTEVSEPVIGVNAGD----MPSYRVRKADTTVELPSGGTIVLAGLL 374
              V     I L +  EVS              +PS R RKA TTV+L  G + VLAGLL
Sbjct: 298 VAKVTDSENIRLSLLPEVSSIDKTNGVNSGLVSVPSLRTRKAQTTVQLKDGQSFVLAGLL 357

Query: 375 KDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHY 434
             + Q+    IP L  IPILGALF  +   R +TE+ I AT  LV PV   D+  P   +
Sbjct: 358 TSEEQESLAKIPYLGDIPILGALFSKTNTERRKTELIIVATVNLVDPVKETDIKLP--KF 415

Query: 435 SVEDDAKAFFFNRVNKIYGPKEASEVEGQNYK 466
               D +      ++K+   +  + ++   + 
Sbjct: 416 ERTSDLERLLKLDLSKVDDEELENTIKAGGFN 447


>gi|299532592|ref|ZP_07045981.1| type II and III secretion system protein [Comamonas testosteroni
           S44]
 gi|298719395|gb|EFI60363.1| type II and III secretion system protein [Comamonas testosteroni
           S44]
          Length = 520

 Score =  253 bits (646), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 125/495 (25%), Positives = 208/495 (42%), Gaps = 50/495 (10%)

Query: 4   LQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVP 63
           L  +   +       + P              +   +   I      ++ L K +++ + 
Sbjct: 3   LASSVPVLAQSAGTPAQPGPVAAAAPAAPRTTLPARNCTAIHTEDPTTVTLGKSVVIPLN 62

Query: 64  VDVQDVLVS--DPTK-------------------ADVVVHSPRTMYLFGKNVGQANVILI 102
             +  +LVS   P                      +V + SPR ++  G+  G  NVIL 
Sbjct: 63  SPMARILVSGQTPGVGQAAANGQPQMQVQNGMGDIEVQLLSPRDLFFRGRKSGSMNVILQ 122

Query: 103 GHDGKQMLNLDILIERDIAHLEMTLRRFIADSN-IRVEMVSDTVVLHGMVRTIQDSQRAV 161
              G      D+++  D   L+  L   + +   IRV+   + +VL G +         V
Sbjct: 123 NAQGAC-FIKDVIVTMDPGPLQTKLSELMPEERGIRVQGADNALVLSGEISNPLRLDDVV 181

Query: 162 ELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITG 221
            L+  +           S SKK++NLL      QV L+V IAEV + +L ++G   S+ G
Sbjct: 182 TLAGAY-----------SDSKKIVNLLRTTSPHQVMLEVKIAEVSKTLLDKLGA--SLAG 228

Query: 222 SSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAIS 281
                +          F+S GG       + + S    +   +    +R LAEP + AIS
Sbjct: 229 QRITSNGMNTFSIASNFLSGGGGLLSAMRIGKGSIS--IDGQKDDGLVRILAEPNIMAIS 286

Query: 282 GQSASFTSGGQHLYKTVSSSTGATSV---TTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE 338
           GQ ASF SGG+       S+T    V      ++G+ + FTPTVL   R+ L++ +EVS+
Sbjct: 287 GQQASFLSGGKIFIPVSQSNTNGVPVMTLEEKEFGIGVKFTPTVLGSSRVNLKLVSEVSD 346

Query: 339 PVIGVNAGD--------MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSK 390
                +           +PS  VR+ADTTV+L  G ++V+AGL+K++I +  +  P L +
Sbjct: 347 LSQTGSPFTAINGVTSVIPSLSVRRADTTVQLNDGQSLVIAGLIKNNITEAVKRFPGLGE 406

Query: 391 IPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNK 450
           IP+LGAL R++ F  ++TE+    TP LV+ +A      P D++     A+ +    +  
Sbjct: 407 IPVLGALARSTEFQTDQTELMFIITPRLVQALA-EAPRVPTDNHVPPSRAEVYLNGALES 465

Query: 451 IYGPKEASEVEGQNY 465
                    V     
Sbjct: 466 SKPASAVKTVPAATM 480


>gi|317491683|ref|ZP_07950118.1| type II and III secretion system protein [Enterobacteriaceae
           bacterium 9_2_54FAA]
 gi|316920117|gb|EFV41441.1| type II and III secretion system protein [Enterobacteriaceae
           bacterium 9_2_54FAA]
          Length = 467

 Score =  253 bits (646), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 99/424 (23%), Positives = 193/424 (45%), Gaps = 42/424 (9%)

Query: 46  KGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHD 105
           + +++ +   +  ++QV  ++  + +S P  AD  +   R + ++ K+ G+ ++I    +
Sbjct: 38  RAQELYMDAGESQVIQVNGNIDTIFISAPKVADYEIIGERGVMVYAKSEGKTDLIAFDKN 97

Query: 106 GKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSE 165
           G Q++   ++++  ++ L+  +   + DS I ++ +  T +L G V T +D  R  ++  
Sbjct: 98  GDQLVKTTLVVDPILSSLQKKVSSLVPDSQITLQKMGKTYILSGSVATEEDRDRVYQIVG 157

Query: 166 TFLSQSGRNQYANSSS---------------------KKVMNLLNIAGEDQVTLKVTIAE 204
             +  +        ++                     ++V+N L +   +QV +K+++ E
Sbjct: 158 EGVGATRTTNKKEVANTNGGSGGNGENSNSWLDEVVYQEVINQLKLPMTNQVNVKLSVVE 217

Query: 205 VRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALE 264
           V +     +G                     G   +           +  +  +++HA+ 
Sbjct: 218 VTKTFSDNVGIDWG--------------TISGSGGNITPGTFRFVKFNADTLSSLVHAIS 263

Query: 265 RATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLS 324
             +  R LAEP L+ +SG+SA F  GG+     V+SS   ++V   D+G+ L+    V S
Sbjct: 264 NDSVARVLAEPNLSVLSGESAEFLVGGEVPV--VTSSANGSNVQYKDFGIKLNVGAKVSS 321

Query: 325 PGRIGLRIQTEVSEPVIG---VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQL 381
             RI + +  EVS              P+++ R+A TTVEL  G + +L GL+ ++ ++ 
Sbjct: 322 NKRIRVTLGEEVSNVDSTYSTNAGDSFPAFQTRRAKTTVELADGESFLLGGLISNNEREE 381

Query: 382 KEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAK 441
              +P +  +PILGALFRN++  R   E+ + AT  LVKPV MRD+  PD  +       
Sbjct: 382 LSRLPFIGDVPILGALFRNAKTERSRGELVVVATVNLVKPVTMRDIVMPD--FQRTSTLS 439

Query: 442 AFFF 445
            F  
Sbjct: 440 RFLN 443


>gi|149188863|ref|ZP_01867153.1| hypothetical Flp pilus assembly protein [Vibrio shilonii AK1]
 gi|148837283|gb|EDL54230.1| hypothetical Flp pilus assembly protein [Vibrio shilonii AK1]
          Length = 456

 Score =  253 bits (646), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 113/448 (25%), Positives = 197/448 (43%), Gaps = 52/448 (11%)

Query: 51  SIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQML 110
           SI LN    +Q+ + +  V +S+P  AD  + +  T+ +F   VGQ+ +I+ G +   +L
Sbjct: 34  SITLNDGQHIQLKMPIGKVFISNPAIADYKIINDNTLVVFANGVGQSRLIVYGTNNDVLL 93

Query: 111 NLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQ 170
           +  I+++ D++ +   L+    D+ ++V+ V + V + G+V + Q       L  T L +
Sbjct: 94  SDRIIVDLDLSEVRRQLKFHFPDAKVKVQSVGEQVAVSGVVDSEQTRDDIYRLVATLLGR 153

Query: 171 SGRNQYANSSS------------------------KKVMNLLNIAGEDQVTLKVTIAEVR 206
               ++  +                          + ++  + +A   QV +K+++A+V 
Sbjct: 154 EKIKKWDKTEKLEFKSEHMERKEPESMVFARNMTWEGILERIEVATTQQVNVKISVAQVT 213

Query: 207 RDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERA 266
               K +G   S  GSS G                     V    D  +  T++ AL   
Sbjct: 214 ESFGKTVGVDWSSVGSSVGEF-------------------VFDQFDAANLSTLITALGND 254

Query: 267 TAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPG 326
           +    LAEP LT +SG+SASF  GG+      +S+    ++T  ++G+ L  T  VLS  
Sbjct: 255 SIAEVLAEPNLTVLSGESASFLVGGEVPVIVSTSNN--VNITFKEFGIKLDLTAKVLSQD 312

Query: 327 RIGLRIQTEVSEPV--IGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEG 384
           +I +++  EVSE    +      +P    R+A TTVEL  G + +L GL+     +  + 
Sbjct: 313 KIRMQLSPEVSEVESYVEAAGVKVPQLASRRAMTTVELADGDSFILGGLMSSSDLEKMQK 372

Query: 385 IPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFF 444
           IP +  +P+LGA FR +   R+ TE+ I AT  LV+P+  +D+  P  +         + 
Sbjct: 373 IPFIGDVPVLGAAFRKATTQRKRTELIIVATVNLVEPMKPKDIQLP--YIKKTSTLSRWL 430

Query: 445 FNRVNKIYGPKEASEVEGQNYKGAIGFI 472
                   G   AS           GFI
Sbjct: 431 N---VDADGKPVASSDATIRLLSQGGFI 455


>gi|52425834|ref|YP_088971.1| GspD protein [Mannheimia succiniciproducens MBEL55E]
 gi|52307886|gb|AAU38386.1| GspD protein [Mannheimia succiniciproducens MBEL55E]
          Length = 458

 Score =  253 bits (645), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 89/423 (21%), Positives = 173/423 (40%), Gaps = 30/423 (7%)

Query: 47  GKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDG 106
            K + +       +++   +  + VS    AD  +    +  ++GK  G  +V     +G
Sbjct: 18  AKPMYLEQGTSKYIELDKKIDTIFVSSSEVADYEIVDDYSFMVYGKQEGTTDVTAFDANG 77

Query: 107 KQMLNLDILIERDIAHL---EMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVEL 163
             +    + +   I ++      ++    +SN++V+ +    V+ G   T  +S+    +
Sbjct: 78  NILYTDTLNVNALINNIVDTNKQIKARFPNSNLQVKKLGKAYVIEGKANTQHESEEVNRI 137

Query: 164 SETFLSQSGRNQYANSSSKK-----------------VMNLLNIAGEDQVTLKVTIAEVR 206
               +  + +                           V+N  NI    Q+ +K+T+AEV 
Sbjct: 138 VGEAIGVAPKVTETTLKRGNGMSDEKIPFLDKYEYNGVINNTNIDKTKQINVKLTVAEVN 197

Query: 207 RDILKQIGFQHSITGSSSGPSKSFAADF-GGKFVSEGGDFSVKGVLDRFSFETVLHALER 265
           ++    +G +      S   + +  A+   G F    G  ++   ++       + A+  
Sbjct: 198 KNFSDSLGIKWEHLSGSVLENWTSGANGYSGGFDGTTGSIAL---INANRLSAFITAVNN 254

Query: 266 ATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSP 325
           A   + LAEP ++ +SG++A    GG+  +     S G TS+   D+GV L     V   
Sbjct: 255 ANNGKILAEPNISMLSGETADILVGGEVPFAQ-RDSDGNTSIIYKDFGVKLMVGAKVQKN 313

Query: 326 GRIGLRIQTEVSEPVIG---VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLK 382
            ++ + +  EVS         + GD+P ++ R+A +T E+ +G + ++ GLL     +  
Sbjct: 314 DQVRIVLAQEVSTLAGNYTYTSVGDIPYFQTRRAKSTFEVGNGESFIIGGLLSSSDLEGV 373

Query: 383 EGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKA 442
             +PL   IPILGA FR+   +RE  E+ + AT  LV P     +  P   +      + 
Sbjct: 374 SKVPLFGDIPILGAFFRSVTTSRETKELVVVATVNLVTPNDAEKVIYP--SFEQTGTLER 431

Query: 443 FFF 445
           FF 
Sbjct: 432 FFN 434


>gi|37676253|ref|NP_936649.1| rough colony protein RcpA [Vibrio vulnificus YJ016]
 gi|326424174|ref|NP_762071.2| type II/IV secretion system secretin RcpA/CpaC [Vibrio vulnificus
           CMCP6]
 gi|37200794|dbj|BAC96619.1| rough colony protein RcpA [Vibrio vulnificus YJ016]
 gi|319999557|gb|AAO07061.2| Type II/IV secretion system secretin RcpA/CpaC, associated with Flp
           pilus assembly [Vibrio vulnificus CMCP6]
          Length = 441

 Score =  253 bits (645), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 108/453 (23%), Positives = 189/453 (41%), Gaps = 43/453 (9%)

Query: 35  AVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNV 94
             I +  + +   + +++       + +   +  V V  P  AD  +     + ++G  +
Sbjct: 11  TTIGVVSLSVNSNELMNLNQGSAKTISLKRQISTVFVGAPEIADYKIIDETKVVVYGVGL 70

Query: 95  GQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTI 154
           G  +VI+    G ++ N ++++ + +  ++ TL     D +I +  V + VVL G+V + 
Sbjct: 71  GATSVIVYDRAGNELYNAEVVVNKSLRLVKQTLIARFPDESINITNVGEQVVLDGVVSSE 130

Query: 155 QDSQRAVELSETFLSQSGR-----------------NQYANSSSKKVMNLLNIAGEDQVT 197
           +   +        L +S                   +  A      ++N L +   +Q+ 
Sbjct: 131 EVKTQIYRTVGEMLKKSVTRNTLTLQDTSGGQVDSLDYTATYIYDNIINNLKVLTTEQIN 190

Query: 198 LKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFE 257
           +K+T+AEV    L ++G  +S +G                    G   +           
Sbjct: 191 VKLTVAEVSSSFLSELGVSYSDSGQ------------------AGRFVNKLLDFTAQDIV 232

Query: 258 TVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLH 317
            V+ A       R LAEP L+ ISG++ASF  GG+        S    SV+  +YGV L 
Sbjct: 233 AVITASGDDQIGRVLAEPNLSVISGETASFLVGGELPIAIRDESG--ISVSYKEYGVKLS 290

Query: 318 FTPTVLSPGRIGLRIQTEVSEPV----IGVNAGDMPSYRVRKADTTVELPSGGTIVLAGL 373
               V     I L +  EVS             ++P+ R RKA TTV+L  G + VLAGL
Sbjct: 291 MVAKVTDSENIRLSLLPEVSSIDEENKTANGLINVPALRTRKAQTTVQLKDGQSFVLAGL 350

Query: 374 LKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDH 433
           L  + ++    IP+L  IPILGALF +++ N+ +TE+ I AT  LV PV   D+  P   
Sbjct: 351 LTSEERESLSKIPVLGDIPILGALFSHTKSNQTKTELIIVATVNLVDPVKAEDIKLP--S 408

Query: 434 YSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYK 466
           +    D +      ++ +  P+    +    + 
Sbjct: 409 FRRTSDIERLLRIDLSSMNEPELEDTLNKGGFN 441


>gi|152981036|ref|YP_001355006.1| pilus assembly protein CpaC [Janthinobacterium sp. Marseille]
 gi|151281113|gb|ABR89523.1| pilus assembly protein CpaC [Janthinobacterium sp. Marseille]
          Length = 429

 Score =  252 bits (644), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 100/424 (23%), Positives = 182/424 (42%), Gaps = 36/424 (8%)

Query: 39  ISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVH-----SPRTMYLFGKN 93
            S   + +   +++ + + + L+ P D++ + V+DP  AD+++       P ++ L GK 
Sbjct: 14  TSFPALAEEMNLTVRVREQLQLKTPADLERIAVADPEVADILIIKGSNKRPGSIMLVGKK 73

Query: 94  VGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRT 153
            G  +V     +G       +        ++  L+  + +    +++ SD+  L G   +
Sbjct: 74  PGSTSVTAWQRNG-PTKVWQV-------SVQSALQGLLPEEGAELQINSDSASLRGQSPS 125

Query: 154 IQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQI 213
           +      V      + +           +K ++   +A    V + V I E  R++LK+ 
Sbjct: 126 LLSHANTVAAGTQAVGK-----------EKFLDTSTVATSGMVQIDVQIVEFSRNVLKEA 174

Query: 214 GFQHSITGSSSGPSKSFAADFGGKFVSE--GGDFSVKGVLDRFSFETVLHALERATAIRT 271
           GF      +          +F     S           +L   S    +  +E+    R 
Sbjct: 175 GFDFIFNQNRGATFSFGLNNFSTILSSTVQTPVSQAFNLLGSTSVNARVKLIEQNGLARV 234

Query: 272 LAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLR 331
           LA P+L A+SGQSASF +GG+          G T++    +G+ L  TPTVLS  RI L+
Sbjct: 235 LARPSLIALSGQSASFLAGGELPVPQS-GGLGTTTIIYKAFGIGLTVTPTVLSANRIALK 293

Query: 332 IQTEVSEPVIGVNAGD----MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPL 387
           +  E S+             +P+   R+ +TT+EL  G + V+ GL+    +     +P 
Sbjct: 294 VAPEASDLDYANAIVTNNMMIPAISTRRTETTLELGDGESFVIGGLVSRTTKSNVNKVPF 353

Query: 388 LSKIPILGALFRNSRFNREETEIFIAATPFLVKPVA-MRDLSRPDD----HYSVEDDAKA 442
           L  +PILG  FR+ +++++E E+ I ATP LVKP+A    L  P D      +  +   +
Sbjct: 354 LGDLPILGPFFRSMQYSQDEKELVIIATPHLVKPIAKGAQLPLPGDDKERRDTPANAWSS 413

Query: 443 FFFN 446
           +   
Sbjct: 414 YVMG 417


>gi|32477871|ref|NP_870865.1| type II secretion system protein [Rhodopirellula baltica SH 1]
 gi|32448428|emb|CAD77943.1| probable type II secretion system protein [Rhodopirellula baltica
           SH 1]
          Length = 704

 Score =  252 bits (644), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 110/496 (22%), Positives = 186/496 (37%), Gaps = 62/496 (12%)

Query: 18  SSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKA 77
                +   PP   A        + EI     +S+ L +  IL++      + V D    
Sbjct: 110 GLPAELILPPPSDAAKQRASRFVESEIDPEIPLSLVLGRPKILRLADTPTRIYVPDEDTI 169

Query: 78  DVVVH---SPRTMYLFGKNVGQANVILIGHD-----GKQMLNLDILIER------DIAHL 123
              +    S R + + G   G   ++L   D     G+ +++  + +         +  L
Sbjct: 170 RTEIIDQESGRELAVTGVQPGTTTLMLWFKDSGAPSGQSVVSYLVRVYEDPILAKPVGDL 229

Query: 124 EMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVEL-------------------- 163
           E  L     +S + ++ ++D +++ G      +  + +++                    
Sbjct: 230 ETELNEKFPNSFVELDEIADRLIVRGQAPDAIEMSQILQILTGARGVRAGLTRPANPVTV 289

Query: 164 --SETFLSQSGRNQYANSSSKK-------------VMNLLNIAGEDQVTLKVTIAEVRRD 208
             +  F+          +++++             ++N + I GE QV LKVT+AEV R 
Sbjct: 290 AAAYDFVGAVDPLTSEEAAAERRRNLDPIALSQAGIINQMKIVGEQQVMLKVTVAEVNRS 349

Query: 209 ILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATA 268
             + IG    +   +                S+ G  ++   LD       + AL R   
Sbjct: 350 AARSIGLNFGVDNDNGLTVFQSLTGNLASTQSQSGA-NILASLDMGQVRLAIEALRRLNL 408

Query: 269 IRTLAEPTLTAISGQSASFTSGGQHLYKTVSSS---TGATSVTTHDYGVVLHFTPTVLSP 325
            RTLAEP L A++GQ A F +GGQ     +SS         V+   +GV L FTP +   
Sbjct: 409 SRTLAEPNLVAMNGQPADFQAGGQFPIPIISSGGVGNNLQGVSFVPFGVQLQFTPFIQDR 468

Query: 326 GRIGLRIQTEVSEPVIGVNAG--------DMPSYRVRKADTTVELPSGGTIVLAGLLKDD 377
             I L++  EVS     +            +     R   TTV+L SG TI +AGLL+ +
Sbjct: 469 DVIRLQMNAEVSTRDESLGTSIGGGGGGTQVSGLNSRNFSTTVQLRSGQTIAVAGLLQTN 528

Query: 378 IQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLS-RPDDHYSV 436
                +  P    +PI+GA    +R +  E E+ I  TP LV PV   +    P      
Sbjct: 529 YGASSDRTPFWGDLPIIGATGGVNRSSSGEQELVILVTPHLVAPVDACETPALPGSDVYE 588

Query: 437 EDDAKAFFFNRVNKIY 452
             D + F  NR+    
Sbjct: 589 PSDIEFFIANRLESRR 604


>gi|10956078|ref|NP_052165.1| exporter protein [Chlorobium limicola]
 gi|1688247|gb|AAB36938.1| exporter protein [Chlorobium limicola]
          Length = 461

 Score =  252 bits (643), Expect = 9e-65,   Method: Composition-based stats.
 Identities = 93/461 (20%), Positives = 166/461 (36%), Gaps = 68/461 (14%)

Query: 51  SIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQML 110
            + L +  I +    ++ V V DP  AD ++ +   +YL GK +G  N+++    G  + 
Sbjct: 8   RVPLGESRIYRFAQPIKRVAVGDPQVADYIMMNRSEIYLLGKKLGSTNLVVWDQKGN-VT 66

Query: 111 NLDILIERDIAHLEMTLRRFIADSN-IRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLS 169
           +  + + R    L+  L+      N I ++ +   +VL G V     ++  + L   +  
Sbjct: 67  STPVQVSRGTTALQAFLKALFPKENDIHIDALGPALVLSGSVSDALVAESVIRLVTAYFG 126

Query: 170 Q---------------------------------------------------SGRNQYAN 178
                                                                       
Sbjct: 127 GSVSKSSPESALIGTDAKALTGVIGELNKSTTASNAESFAFFKKTLMMGDEKGASGSAGR 186

Query: 179 SSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKF 238
            S++ V+NLL +    QV L+V IA+V R  L+ +G   +                 GK 
Sbjct: 187 DSTRGVINLLKVRDPQQVRLEVRIAQVSRSYLESLGLSVTKL-------TGDLTGSLGKL 239

Query: 239 VSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTV 298
            +     +   +L +  ++  + A  + + ++ LAEPT+  +SG+   F  GG+    + 
Sbjct: 240 STGFVSDATLDLLLKPDYDIKMGAKRKPSLLKILAEPTIVTMSGKEGYFLVGGKIYTPSR 299

Query: 299 SSSTGAT---SVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGDMPSYRVRK 355
             S   T   +        V    P+         R+           +   +     R 
Sbjct: 300 VESQLDTAKLNTKNTPTAWVYVLRPSCWMQAVFHSRLYPRFLNLTRNHSLLGLQKIGHRL 359

Query: 356 ----ADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIF 411
                 T VE+  G  +V+ GL  D++    + +PLL +IPILGALFRN+  N E+TE+ 
Sbjct: 360 NSAPVSTAVEMNEGENLVIGGLKLDNLTNAIDSVPLLGEIPILGALFRNTDKNAEKTELM 419

Query: 412 IAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIY 452
           +   P LVK         P D +      + FF  ++    
Sbjct: 420 VIVRPTLVKASNTPP-ELPTDKFVPPTRGELFFGGKLEGSR 459


>gi|319940440|ref|ZP_08014785.1| type II and III secretion system protein [Sutterella wadsworthensis
           3_1_45B]
 gi|319806066|gb|EFW02815.1| type II and III secretion system protein [Sutterella wadsworthensis
           3_1_45B]
          Length = 530

 Score =  251 bits (641), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 121/498 (24%), Positives = 205/498 (41%), Gaps = 65/498 (13%)

Query: 2   RYLQRTFFTMMSI-FLFSSN--PSVAKLPPIKEANAAVINISDVE-----IGKGKKISIG 53
           R   RT F    +  L      P+ A L      +  V+  +              + + 
Sbjct: 20  RKPSRTVFAAACLGALLGLAVSPASAALKAQVPTDVKVLEGASSLKNLKLAKPTSSLRVF 79

Query: 54  LNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLD 113
           L +  +LQ+P     VLV+ P  A   + SP  ++ FG   G      +   G  +  + 
Sbjct: 80  LKEGALLQLPSAAAKVLVATPGIASYQMPSPDQVFFFGTAAGSTTFYALDEAGAVIAAVQ 139

Query: 114 ILIERDIAHLEMTLRRFIADSNIR-VEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSG 172
           + +E ++  L+  ++R +  ++I  V  +++ +++ G V+T  DS+R  +L E++L  S 
Sbjct: 140 VTVEHNLEKLKADIKRAVPSASIELVPALNNRMIVRGKVKTALDSRRVTQLVESYLVSSA 199

Query: 173 RNQYANSSSK------------------KVMNLLNIAGEDQVTLKVTIAEVRRDILKQIG 214
                   S+                   V+N L +    QV ++V + EV R +   +G
Sbjct: 200 AAGGPGQGSQQGGQDGGGQGGSAGGQSSPVINQLKVEVSQQVNIQVRVVEVSRSLTHSLG 259

Query: 215 FQHSI-------------------------------TGSSSGPSKSFAADFGGKFVSEGG 243
           F                                      S     +          + G 
Sbjct: 260 FNWGAVLNTGRGPLFLGNGTSQGLFSTHAANNSHFNPNDSFADGNANIPGLMPDSNTAGA 319

Query: 244 DFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTG 303
                  + R S   +++A+  +     LAEP LTA+SGQ A+F SGG+     +  +  
Sbjct: 320 ALGGIFNMGRMSLGVLINAMSESGFASLLAEPNLTAMSGQPAAFASGGEVPIVII--TGN 377

Query: 304 ATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVN-----AGDMPSYRVRKADT 358
           + ++    +GV+L  TPTVLSP RI + +  EVSE              +P+ RVR+A+T
Sbjct: 378 SITIDYKSWGVILRMTPTVLSPNRIAIHVAPEVSELTSEGQVILSEGSVIPAVRVRRAET 437

Query: 359 TVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFL 418
           TVEL SG +  LAG+L+ +  Q   G+P L  +P +G LF   +   E++E+ I  T  +
Sbjct: 438 TVELASGQSFALAGMLRSESSQTVNGVPGLRNLPFVGRLFEYEQTQVEDSELVILLTANI 497

Query: 419 VKPVAMRDLSRPDDHYSV 436
           V PV+  DL  P    + 
Sbjct: 498 VDPVSSGDLRVPGRGINA 515


>gi|260914312|ref|ZP_05920781.1| type II/IV secretion system secretin RcpA/CpaC [Pasteurella
           dagmatis ATCC 43325]
 gi|260631413|gb|EEX49595.1| type II/IV secretion system secretin RcpA/CpaC [Pasteurella
           dagmatis ATCC 43325]
          Length = 465

 Score =  251 bits (640), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 87/429 (20%), Positives = 171/429 (39%), Gaps = 29/429 (6%)

Query: 36  VINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVG 95
            I +    +   K  ++      ++Q    +  + VS P  AD  +    +  ++ K  G
Sbjct: 19  AILVLSPGVMFAKTFNLEQGGTQLIQTKEKIDTIFVSSPAIADYEILDDNSFIIYAKEQG 78

Query: 96  QANVILIGHDGKQMLNLDILIE---RDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVR 152
           +A +     +GK + N  + ++     I+     ++    ++N+ V+ V    V+ G  R
Sbjct: 79  RAEISAFDANGKTLTNDVVNVDSLFTGISDTNQQIKARFPNTNLSVKKVGKAYVIEGKAR 138

Query: 153 TIQDSQRAVELSETFLSQSGRNQYANSSS---------------KKVMNLLNIAGEDQVT 197
           + ++S     +    L    +       +                 V+N +N+    Q+ 
Sbjct: 139 SQEESDEVHRIVGEALGNGKKVTETKFKAGESEESLPFLDKYQFDGVVNNVNVDETTQIN 198

Query: 198 LKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFE 257
           +K+T+ EV + + + +G   S                G   V+          +D     
Sbjct: 199 VKLTVVEVNKKLSEAVGINWS-----RLSGGVPDLLGGVSRVTGFDGIQGLLKIDASGVS 253

Query: 258 TVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLH 317
             ++AL+     R LAEP ++ +SG++A    GG+  +         T +   D+G+ L 
Sbjct: 254 AFINALDNQNNGRILAEPNISMLSGETADILVGGEIPFAQRDKEGAPTII-YKDFGIRLA 312

Query: 318 FTPTVLSPGRIGLRIQTEVSEPVIG---VNAGDMPSYRVRKADTTVELPSGGTIVLAGLL 374
               +    RI L +   VS         + G++P +  R++ +  E+  G + ++ GL 
Sbjct: 313 VAAKLQKNNRIRLALDQRVSTIAGNYSFESVGEIPFFNTRRSKSVFEVADGESFIIGGLF 372

Query: 375 KDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHY 434
                +    +P+L  IPILGA FRN++ +RE+ E+ I AT   VKPV   ++  P   +
Sbjct: 373 NSSDLEGINKVPVLGDIPILGAFFRNAKTDREDRELVIVATVNTVKPVQEDEIVYPT--F 430

Query: 435 SVEDDAKAF 443
                 + F
Sbjct: 431 ERTGTMERF 439


>gi|59711120|ref|YP_203896.1| general secretion pathway protein D [Vibrio fischeri ES114]
 gi|59479221|gb|AAW85008.1| general secretion pathway protein D [Vibrio fischeri ES114]
          Length = 436

 Score =  251 bits (640), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 108/409 (26%), Positives = 181/409 (44%), Gaps = 33/409 (8%)

Query: 36  VINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVG 95
           +++I  + +   +  ++       +    ++  V +S+P  AD  +     + LFG+ VG
Sbjct: 12  LLSIVSLNVRAKEIENLSAGDAKSITTTTEIGSVFISNPKVADYKIIDKYKVVLFGREVG 71

Query: 96  QANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQ 155
            +  I     G+++LN  I++ ++ + +E  ++     S+I +  +    V+ G V   +
Sbjct: 72  DSVFIAFDVQGRELLNKKIIVSKNYSGIEQQVKLRFPTSDIDIFAIGTNAVVSGTVLNEE 131

Query: 156 DSQRAVELSETFLSQSGRNQYANSSS-----------KKVMNLLNIAGEDQVTLKVTIAE 204
           D  +  E+  T L     +  A               + V+N + +A   QV +K+TIAE
Sbjct: 132 DRDQIYEMVATLLFDDNADNNAQDDRTELTYMDKLNFEGVVNQIEVARTKQVNVKLTIAE 191

Query: 205 VRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALE 264
           V    ++  G +    G                    G               +V+ A+ 
Sbjct: 192 VSHSFMQDFGIKVGSNGQ------------------AGIFVDQLVHFSASDIVSVITAVG 233

Query: 265 RATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLS 324
             +  + LAEP L+ ISG+ ASF  GG+    TV    GAT+V   ++GV L  T  V  
Sbjct: 234 TDSVGQVLAEPNLSVISGEDASFLVGGELPVVTVI--DGATNVQYKEFGVKLDLTAKVER 291

Query: 325 PGRIGLRIQTEVSEPVIG--VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLK 382
             +I L +   VS        +  ++PS + R A TTVEL  G + VL GLL  + ++  
Sbjct: 292 DDKIKLALAPSVSSLDTQYANDNYNLPSLKTRSARTTVELGDGQSFVLGGLLNSEEKESL 351

Query: 383 EGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPD 431
             IP +  IPILGALFR++   R +TE+ I AT  LV+PV    +  P 
Sbjct: 352 TRIPFVGDIPILGALFRHTGTERNKTELIIVATVNLVQPVKANQIQLPT 400


>gi|261867455|ref|YP_003255377.1| RcpA [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|261412787|gb|ACX82158.1| RcpA [Aggregatibacter actinomycetemcomitans D11S-1]
          Length = 420

 Score =  250 bits (639), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 91/404 (22%), Positives = 174/404 (43%), Gaps = 25/404 (6%)

Query: 59  ILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIER 118
           ++Q    +  + VS P  AD  +    T  ++ K  G+  V   G DG+ + +  + ++ 
Sbjct: 1   MVQTKEKIDTIFVSSPNIADYEILDDNTFIIYAKEEGRTEVTAFGADGRPLTSDTVNVDS 60

Query: 119 DIAHLE---MTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQ 175
            +  +      L+    ++N+ V+ V    V+ G  R+ ++S     +    L    +  
Sbjct: 61  VVTSIADTNKQLKSRFPNTNLSVKKVGKAYVIEGKARSQEESDEVRRIVGEALGSGRKVT 120

Query: 176 YANSSSK-----------KVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSS 224
                              V++  NIA   Q+ +K+++ EV + + + +G   S    S 
Sbjct: 121 ETKLGEDSLPFLDKYHYDGVVDNANIADTTQINVKLSVVEVNKKLSEAMGINWSHVAGSG 180

Query: 225 GPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQS 284
                     GG   ++G        LD       ++AL+  +  + LAEP ++ +SG++
Sbjct: 181 PLVGGNFGFGGGFNGNQG-----VLRLDAKGISAFINALDNQSNGKVLAEPNISMLSGET 235

Query: 285 ASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVN 344
           A    GG+  +       G+ ++   ++G+ L     +    RI L +   VS      N
Sbjct: 236 ADILVGGEIPFAQ-RDRDGSPTIIYKEFGIKLAVAAKLQKNNRIRLALDQTVSTIAGNYN 294

Query: 345 ---AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNS 401
               G++P +  RKA +  E+ +G + ++ GL   +  +    +PLL  IPILG+ FR++
Sbjct: 295 FDGIGNIPFFNTRKAKSLFEVANGESFIIGGLFSSNDLEGINKVPLLGDIPILGSFFRSA 354

Query: 402 RFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFF 445
              R++ E+ I AT  +VKPV  +D+  PD  +      + FF 
Sbjct: 355 TTERDKKELVIVATVNVVKPVNEKDVVYPD--FEKTGTMERFFH 396


>gi|197335194|ref|YP_002155269.1| general secretion pathway protein D [Vibrio fischeri MJ11]
 gi|197316684|gb|ACH66131.1| general secretion pathway protein D [Vibrio fischeri MJ11]
          Length = 436

 Score =  250 bits (639), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 109/409 (26%), Positives = 181/409 (44%), Gaps = 33/409 (8%)

Query: 36  VINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVG 95
           +++I  + +   +  ++       +    ++  V +S+P  AD  +     + LFG+ VG
Sbjct: 12  LLSIVSLNVRAKEIENLSAGDAKSITTTTEIGSVFISNPKVADYKIIDKYKVVLFGREVG 71

Query: 96  QANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQ 155
            +  I     G+++LN  I++ R+ + +E  ++     S+I +  +    V+ G V   +
Sbjct: 72  DSVFIAFDVQGRELLNKKIIVSRNYSGIEQQVKLRFPTSDIDIFAIGTNAVVSGTVLNEE 131

Query: 156 DSQRAVELSETFLSQSGRNQYANSSS-----------KKVMNLLNIAGEDQVTLKVTIAE 204
           D  +  E+  T L     +  A               + V+N + +A   QV +K+TIAE
Sbjct: 132 DRDQIYEMVATLLFDDNADNNAQDDRTELTYMDKLNFEGVVNQIEVARTKQVNVKLTIAE 191

Query: 205 VRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALE 264
           V    ++  G +    G                    G               +V+ A+ 
Sbjct: 192 VSHSFMQDFGIKVGSNGQ------------------AGIFVDQLVHFSASDIVSVITAVG 233

Query: 265 RATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLS 324
             +  + LAEP L+ ISG+ ASF  GG+    TV    GAT+V   ++GV L  T  V  
Sbjct: 234 TDSVGQVLAEPNLSVISGEDASFLVGGELPVVTVI--DGATNVQYKEFGVKLDLTAKVER 291

Query: 325 PGRIGLRIQTEVSEPVIG--VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLK 382
             +I L +   VS        +  ++PS + R A TTVEL  G + VL GLL  + ++  
Sbjct: 292 DDKIKLALAPSVSSLDTQYANDNYNLPSLKTRSARTTVELGDGQSFVLGGLLNSEEKESL 351

Query: 383 EGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPD 431
             IP +  IPILGALFR++   R +TE+ I AT  LV+PV    +  P 
Sbjct: 352 TRIPFVGDIPILGALFRHTGTERNKTELIIVATVNLVQPVKANQIQLPT 400


>gi|221067360|ref|ZP_03543465.1| type II and III secretion system protein [Comamonas testosteroni
           KF-1]
 gi|220712383|gb|EED67751.1| type II and III secretion system protein [Comamonas testosteroni
           KF-1]
          Length = 520

 Score =  250 bits (639), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 126/492 (25%), Positives = 209/492 (42%), Gaps = 64/492 (13%)

Query: 14  IFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKI--------------SIGLNKVII 59
           + L SS P +A+              +         +              ++ L K ++
Sbjct: 1   MLLASSAPVLAQSAGTAAQPGPAAAAAPAPAAPRTTLPARNCTAIHTEDPTTVTLGKSVV 60

Query: 60  LQVPVDVQDVLV-------------SDPTK--------ADVVVHSPRTMYLFGKNVGQAN 98
           + +   +  +LV               P           +V + SPR ++  G+  G  N
Sbjct: 61  IPLNSPMARILVSGQTPGAGQAAANGQPQMQVQNGMGDIEVQLLSPRDLFFRGRKSGSMN 120

Query: 99  VILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSN-IRVEMVSDTVVLHGMVRTIQDS 157
           VIL    G      D+++  D   L+  L   + +   IRV+   + +VL G +      
Sbjct: 121 VILQNAQGAC-FIKDVIVTMDPGPLQAKLSELMPEERSIRVQGADNALVLSGEISNPLRL 179

Query: 158 QRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQH 217
              V L+  +           S SKK++NLL      QV L+V IAE+ + +L ++G   
Sbjct: 180 DDVVTLAGAY-----------SDSKKIVNLLRTTSPHQVMLEVKIAEISKTLLDKLGSSL 228

Query: 218 SITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTL 277
           S  G     +   +      F+S GG       L R S    +   +    +R LAEP +
Sbjct: 229 S--GQRVTSNGQNSYTVLSNFLSGGGGLLNAMRLGRGSIS--IDGQKDDGLVRILAEPNI 284

Query: 278 TAISGQSASFTSGGQHLYKTVSSSTGATSV---TTHDYGVVLHFTPTVLSPGRIGLRIQT 334
            AISGQ ASF SGG+       ++T    V      ++G+ + FTPTVL   R+ L++ +
Sbjct: 285 MAISGQQASFLSGGKIFIPVAQTNTNGVPVMTLEEKEFGIGVKFTPTVLGNSRVNLKLVS 344

Query: 335 EVSEPVIGVNAGD--------MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIP 386
           EVS+     +           +PS  VR+ADTTV+L  G ++V+AGL+K++I +  +  P
Sbjct: 345 EVSDLSQTGSPFTSINGVTSVIPSLTVRRADTTVQLNDGQSLVIAGLIKNNITEAIKRFP 404

Query: 387 LLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFN 446
            L +IP+LGAL R++ F  ++TE+    TP LV+ +A      P D++ V   A+ +   
Sbjct: 405 GLGEIPVLGALARSTEFQTDQTELMFVITPRLVQALA-EAPRVPTDNHVVPSRAEVYLNG 463

Query: 447 RVNKIYGPKEAS 458
            +          
Sbjct: 464 ALESSKPAPAEK 475


>gi|170724970|ref|YP_001758996.1| type II and III secretion system protein [Shewanella woodyi ATCC
           51908]
 gi|169810317|gb|ACA84901.1| type II and III secretion system protein [Shewanella woodyi ATCC
           51908]
          Length = 446

 Score =  250 bits (639), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 100/417 (23%), Positives = 189/417 (45%), Gaps = 46/417 (11%)

Query: 52  IGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLN 111
           + LN    +++  ++  V +S P  AD  +     + ++G+ +GQA + +     + +L+
Sbjct: 29  VTLNDASSIELKQEIGTVFISQPEVADYKITGNNKLVIYGRQLGQARLFVYNKANEVILS 88

Query: 112 LDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQS 171
             + ++ +++ +   L+ F  D ++ +  V D V + G+V + +          TFL + 
Sbjct: 89  QLLHVDINLSQIRRQLKLFYPDLDLTLTSVGDKVAVRGIVYSEEQRNDIYRQVATFLGRE 148

Query: 172 GRNQYANSSS---------------------KKVMNLLNIAGEDQVTLKVTIAEVRRDIL 210
              ++  S                       + ++  L ++   QV +K+++A+V ++  
Sbjct: 149 KVERFDESELVEFKDSFTEANWLAYERNFIWQGIIEGLRLSQTQQVNVKISVAQVTKEFN 208

Query: 211 KQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIR 270
           + +G   S  G S G                                T+++AL + +   
Sbjct: 209 ETLGVSWSTVGRSVGEFSFLD-------------------FKASDLSTIINALGKDSIAE 249

Query: 271 TLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGL 330
            LAEP L+ +SG+SASF  GG+     + S+   T++T  ++G+ L  +  VL+  +I L
Sbjct: 250 VLAEPNLSVMSGESASFLVGGEIPV--IFSNNNTTNITYKEFGIRLDLSAKVLNNEKIKL 307

Query: 331 RIQTEVS--EPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLL 388
           ++  EVS  E  +      +P    R+A TT+EL  G + +L GL+  D  +    IPLL
Sbjct: 308 QMMPEVSAVEGFVEAAGIKIPQLTTRRAMTTIELGDGDSFLLGGLMSSDELENVSKIPLL 367

Query: 389 SKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFF 445
             IP+ GALFR +   R++TE+ I AT  LVKP++  ++  P    +       FF 
Sbjct: 368 GDIPVFGALFRQAGTTRKKTELVIVATVNLVKPLSPTEVRLP--KMTPTKSLARFFN 422


>gi|255658704|ref|ZP_05404113.1| putative type II/III secretion system protein [Mitsuokella
           multacida DSM 20544]
 gi|260849091|gb|EEX69098.1| putative type II/III secretion system protein [Mitsuokella
           multacida DSM 20544]
          Length = 548

 Score =  250 bits (637), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 95/443 (21%), Positives = 177/443 (39%), Gaps = 57/443 (12%)

Query: 41  DVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVI 100
                +   +SI LN+   L    ++  V +++P  ADV +    ++ + G + G   + 
Sbjct: 22  APAYAQFTPLSIDLNQSYYLNTGRNITRVAIANPKIADVSLLDGTSLNVIGISPGTTTLN 81

Query: 101 LIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRA 160
           +   +G       I +    + L   ++  I   ++RV+M+   ++L G V+   +   A
Sbjct: 82  VWASNG-YRYEYRITVSDQDSGLAKIVQDAIGLPDVRVQMIGGKILLRGTVKNQYERNLA 140

Query: 161 VELSETFLSQSGRNQ---------------------------------------YANSSS 181
             +++ +   S  +                                         + S+ 
Sbjct: 141 YTIAKLYAKGSNSSPSQDQGQYVSTTESKSSMTPDGRYENKTVTNDSYQRTPRDTSGSTG 200

Query: 182 KKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSE 241
             V+NLL +   DQ+ ++    E+     K +G  ++    S   S     +  G + + 
Sbjct: 201 DSVVNLLEMTNPDQINIEAMFVELGTSDAKNLGINYASQDMSDTDSSGIKMNDVGTYYAG 260

Query: 242 GGDFSVKGVLD-----------RFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSG 290
                 +   +                  +HAL      R ++ P +T +SG++AS   G
Sbjct: 261 ESYGRQRSGGNHWYNSNWLFTHFSKINAEIHALIENGKARVISRPNVTTMSGKNASILIG 320

Query: 291 GQHLYKTVSSSTGATSVTTHDYGVVLHF-TPTVLSPGRIGLRIQTEVS----EPVIGVNA 345
           G+  Y+   +  G+T+ +   YG+ +    PTV   G I   ++T+VS       +  + 
Sbjct: 321 GEVPYQES-NGFGSTTTSYKTYGIGIQLWKPTVDQDGNITTELETQVSRLDWNNAVTKDG 379

Query: 346 GDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNR 405
             MP    R A TTV +PSG T+V+ GLL  +     + +PLL  IPILG LF+    +R
Sbjct: 380 YRMPGIATRSAYTTVNIPSGMTMVIGGLLNSNDANTIQKVPLLGNIPILGELFKYHNKSR 439

Query: 406 EETEIFIAATPFLVKPVAMRDLS 428
           ++TEI +  TP +V       +S
Sbjct: 440 QKTEIVVLITPRVVSEETPARMS 462


>gi|165975974|ref|YP_001651567.1| Flp pilus assembly protein, secretin [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|165876075|gb|ABY69123.1| Flp pilus assembly protein, secretin [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
          Length = 462

 Score =  250 bits (637), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 93/422 (22%), Positives = 171/422 (40%), Gaps = 27/422 (6%)

Query: 44  IGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIG 103
               K  ++   +  +++    +  + VS    AD  +    +  L+ K  G++ VI   
Sbjct: 24  SAMAKTFTLEQGQSQLIKTNAKIDTIFVSSSEVADYEILDDNSFMLYAKAEGRSEVIAFD 83

Query: 104 HDGKQML---NLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRA 160
            +G  +            +IA     ++    +SN+ V+ V    VL G  +   +S   
Sbjct: 84  ANGTPLTEDFVNVNNAINNIAATNQQIQTRFPNSNLTVKKVGKAYVLEGKAKNAAESDEI 143

Query: 161 VELSETFLSQSGRNQYANSSS---------------KKVMNLLNIAGEDQVTLKVTIAEV 205
             +    L    +                       + V+N  N     Q+ +K+T+AEV
Sbjct: 144 NRIVGESLGAGKKVIETKLKHNNSEENVPFLDKYQYEGVINNANEENATQINVKLTVAEV 203

Query: 206 RRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALER 265
            +    +IG   S    +   +    A   G F   GG  ++   ++  +   ++ AL+ 
Sbjct: 204 NKTFSDEIGINWSNLSGNFFRNLG-NAGIQGNFNKNGGQLAL---VNSNNLNVLISALDN 259

Query: 266 ATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSP 325
               + LAEP ++ +SG++A    GG+  +       G  SV   ++G+ L     V   
Sbjct: 260 QNNGKILAEPNISMLSGETADILVGGEVPFVQ-RDKDGELSVLYKEFGIKLAVGAKVQKS 318

Query: 326 GRIGLRIQTEVSEPVIGVNAGD--MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKE 383
            RI L +   VS         +  +P +  R++ +T E+ +G + +++GLL     +  +
Sbjct: 319 DRIRLVLSQSVSTIAGNYEIVNSRIPIFNTRRSKSTFEVGNGESFIISGLLNKQDIEGIK 378

Query: 384 GIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAF 443
            +P+L  IPILGA FRN+  +RE  E+ + AT  LVKPV    +  P   +      + F
Sbjct: 379 KVPVLGDIPILGAFFRNASSSRESKELVVVATVNLVKPVDGSQVLYPT--FENTGTMERF 436

Query: 444 FF 445
           F 
Sbjct: 437 FN 438


>gi|54309660|ref|YP_130680.1| Flp pilus assembly protein [Photobacterium profundum SS9]
 gi|46914098|emb|CAG20878.1| hypothetical Flp pilus assembly protein [Photobacterium profundum
           SS9]
          Length = 461

 Score =  249 bits (636), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 112/403 (27%), Positives = 181/403 (44%), Gaps = 45/403 (11%)

Query: 52  IGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLN 111
           I LN    L+ P ++  V VS P   D  V   R + +F   +GQA VI+ G + + +L+
Sbjct: 34  ITLNDANNLEFPQEIGTVFVSQPDILDYKVIDNRKLVIFSNKIGQAKVIVYGKENQVLLS 93

Query: 112 LDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQS 171
               ++ +++ +   L+ +  D NI V  V + V + G V   +       +  T L + 
Sbjct: 94  QRYHVDINLSQVRRQLKLYYPDLNISVSSVGEQVAVRGTVNNEKQRDDIYRMVATLLGKK 153

Query: 172 GRNQYANSSS----------------------KKVMNLLNIAGEDQVTLKVTIAEVRRDI 209
              +Y  +                        + ++  L IA   QV +K+++A+V ++ 
Sbjct: 154 EIERYNEAEKLKFVESGFEEANWVRYSKNYIWEGIVEGLVIAQAQQVNVKISVAQVTKEF 213

Query: 210 LKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAI 269
            + IG   S  G S G                                TV++A+      
Sbjct: 214 NETIGVDWSTVGRSVGEFSFL-------------------KFKANDLSTVINAIGNDNIA 254

Query: 270 RTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIG 329
             LAEP LT +SG+SASF  GG+        +  +T+++  ++G+ L  +  VLS   I 
Sbjct: 255 EILAEPNLTVLSGESASFLVGGEVPVIVT--NDNSTNISFKEFGIKLELSAKVLSNKSIK 312

Query: 330 LRIQTEVS--EPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPL 387
           L++  EVS  E  +     ++P    R+A TT++L  G + +L GL+  D  +    IPL
Sbjct: 313 LQLAPEVSAVEGYVKAAGIEVPQLSSRRAMTTIQLADGDSFMLGGLMSSDDIEEISKIPL 372

Query: 388 LSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRP 430
           L  IPILGA FR S   R++TE+ I AT  LVKPV+  D+  P
Sbjct: 373 LGDIPILGAAFRKSSTTRKKTELVIVATVNLVKPVSPTDVRLP 415


>gi|46143341|ref|ZP_00204447.1| COG4964: Flp pilus assembly protein, secretin CpaC [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|126208037|ref|YP_001053262.1| rough colony protein A [Actinobacillus pleuropneumoniae L20]
 gi|126096829|gb|ABN73657.1| rough colony protein A [Actinobacillus pleuropneumoniae serovar 5b
           str. L20]
          Length = 462

 Score =  249 bits (635), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 92/422 (21%), Positives = 170/422 (40%), Gaps = 27/422 (6%)

Query: 44  IGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIG 103
               K  ++   +  +++    +  + VS    AD  +    +  L+ K  G++ VI   
Sbjct: 24  SAMAKTFTLEQGQSQLIKTNAKIDTIFVSSSEVADYEILDDNSFMLYAKAEGRSEVIAFD 83

Query: 104 HDGKQML---NLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRA 160
            +G  +            +IA     ++    +SN+ V+ V    VL G  +   +S   
Sbjct: 84  ANGTPLTEDFVNVNNAINNIAATNQQIQTRFPNSNLTVKKVGKAYVLEGKAKNAAESDEI 143

Query: 161 VELSETFLSQSGRNQYANSSS---------------KKVMNLLNIAGEDQVTLKVTIAEV 205
             +    L    +                       + V+N  N     Q+ +K+T+AEV
Sbjct: 144 NRIVGESLGAGKKVIETKLKHNDSEENVPFLDKYQYEGVINNANEENATQINVKLTVAEV 203

Query: 206 RRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALER 265
            +    +IG   S    +   +   AA  G    + G       +++  +   ++ AL+ 
Sbjct: 204 NKTFSDEIGINWSNLSGNFFRNLGNAAIQGNFNKNGGQ----LALVNSNNLNVLISALDN 259

Query: 266 ATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSP 325
               + LAEP ++ +SG++A    GG+  +       G  SV   ++G+ L     V   
Sbjct: 260 QNNGKILAEPNISMLSGETADILVGGEVPFVQ-RDKDGELSVLYKEFGIKLAVGAKVQKS 318

Query: 326 GRIGLRIQTEVSEPVIGVNAGD--MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKE 383
            RI L +   VS         +  +P +  R++ +T E+ +G + +++GLL     +  +
Sbjct: 319 DRIRLVLSQSVSTIAGNYEIVNSRIPIFNTRRSKSTFEVGNGESFIISGLLNKQDIEGIK 378

Query: 384 GIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAF 443
            +P+L  IPILGA FRN+  +RE  E+ + AT  LVKPV    +  P   +      + F
Sbjct: 379 KVPVLGDIPILGAFFRNASSSRESKELVVVATVNLVKPVDGSQVLYPT--FENTGTMERF 436

Query: 444 FF 445
           F 
Sbjct: 437 FN 438


>gi|307245412|ref|ZP_07527500.1| Flp pilus assembly protein, secretin [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|307254367|ref|ZP_07536205.1| Flp pilus assembly protein, secretin [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|307258825|ref|ZP_07540557.1| Flp pilus assembly protein, secretin [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|307261005|ref|ZP_07542687.1| Flp pilus assembly protein, secretin [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|306853753|gb|EFM85970.1| Flp pilus assembly protein, secretin [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|306862666|gb|EFM94622.1| Flp pilus assembly protein, secretin [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|306867176|gb|EFM99032.1| Flp pilus assembly protein, secretin [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|306869307|gb|EFN01102.1| Flp pilus assembly protein, secretin [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
          Length = 462

 Score =  249 bits (635), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 92/422 (21%), Positives = 170/422 (40%), Gaps = 27/422 (6%)

Query: 44  IGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIG 103
               K  ++   +  +++    +  + VS    AD  +    +  L+ K  G++ VI   
Sbjct: 24  SAMAKTFTLEQGQSQLIKTNAKIDTIFVSSSEVADYEILDDNSFMLYAKAEGRSEVIAFD 83

Query: 104 HDGKQML---NLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRA 160
            +G  +            +IA     ++    +SN+ V+ V    VL G  +   +S   
Sbjct: 84  ANGTPLTEDFVNVNNAINNIAATNQQIQTRFPNSNLTVKKVGKAYVLEGKAKNAAESDEI 143

Query: 161 VELSETFLSQSGRNQYANSSS---------------KKVMNLLNIAGEDQVTLKVTIAEV 205
             +    L    +                       + V+N  N     Q+ +K+T+AEV
Sbjct: 144 NRIVGESLGAGKKVIETKLKHNDGEENVPFLDKYQYEGVINNANEENATQINVKLTVAEV 203

Query: 206 RRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALER 265
            +    +IG   S    +   +   AA  G    + G       +++  +   ++ AL+ 
Sbjct: 204 NKTFSDEIGINWSNLSGNFFRNLGNAAIQGNFNKNGGQ----LALVNSNNLNVLISALDN 259

Query: 266 ATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSP 325
               + LAEP ++ +SG++A    GG+  +       G  SV   ++G+ L     V   
Sbjct: 260 QNNGKILAEPNISMLSGETADILVGGEVPFVQ-RDKDGELSVLYKEFGIKLAVGAKVQKS 318

Query: 326 GRIGLRIQTEVSEPVIGVNAGD--MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKE 383
            RI L +   VS         +  +P +  R++ +T E+ +G + +++GLL     +  +
Sbjct: 319 DRIRLVLSQSVSTIAGNYEIVNSRIPIFNTRRSKSTFEVGNGESFIISGLLNKQDIEGIK 378

Query: 384 GIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAF 443
            +P+L  IPILGA FRN+  +RE  E+ + AT  LVKPV    +  P   +      + F
Sbjct: 379 KVPVLGDIPILGAFFRNASSSRESKELVVVATVNLVKPVDGSQVLYPT--FENTGTMERF 436

Query: 444 FF 445
           F 
Sbjct: 437 FN 438


>gi|190149865|ref|YP_001968390.1| rough colony protein A [Actinobacillus pleuropneumoniae serovar 7
           str. AP76]
 gi|307249759|ref|ZP_07531737.1| Flp pilus assembly protein, secretin [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
 gi|307256574|ref|ZP_07538355.1| Flp pilus assembly protein, secretin [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|307263189|ref|ZP_07544810.1| Flp pilus assembly protein, secretin [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
 gi|189914996|gb|ACE61248.1| rough colony protein A [Actinobacillus pleuropneumoniae serovar 7
           str. AP76]
 gi|306858174|gb|EFM90252.1| Flp pilus assembly protein, secretin [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
 gi|306864984|gb|EFM96886.1| Flp pilus assembly protein, secretin [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|306871551|gb|EFN03274.1| Flp pilus assembly protein, secretin [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
          Length = 462

 Score =  249 bits (635), Expect = 9e-64,   Method: Composition-based stats.
 Identities = 92/422 (21%), Positives = 170/422 (40%), Gaps = 27/422 (6%)

Query: 44  IGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIG 103
               K  ++   +  +++    +  + VS    AD  +    +  L+ K  G++ VI   
Sbjct: 24  SAMAKTFTLEQGQSQLIKTNAKIDTIFVSSSEVADYEILDDNSFMLYAKAEGRSEVIAFD 83

Query: 104 HDGKQML---NLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRA 160
            +G  +            +IA     ++    +SN+ V+ V    VL G  +   +S   
Sbjct: 84  ANGTPLTEDFVNVNNAINNIAATNQQIQTRFPNSNLTVKKVGKAYVLEGKAKNAAESDEI 143

Query: 161 VELSETFLSQSGRNQYANSSS---------------KKVMNLLNIAGEDQVTLKVTIAEV 205
             +    L    +                       + V+N  N     Q+ +K+T+AEV
Sbjct: 144 NRIVGESLGAGKKVIETKLKHNNSEENVPFLDKYQYEGVINNANEENATQINVKLTVAEV 203

Query: 206 RRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALER 265
            +    +IG   S    +   +   AA  G    + G       +++  +   ++ AL+ 
Sbjct: 204 NKTFSDEIGINWSNLSGNFFRNLGNAAIQGNFNKNGGQ----LALVNSNNLNVLISALDN 259

Query: 266 ATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSP 325
               + LAEP ++ +SG++A    GG+  +       G  SV   ++G+ L     V   
Sbjct: 260 QNNGKILAEPNISMLSGETADILVGGEVPFVQ-RDKDGELSVLYKEFGIKLAVGAKVQKS 318

Query: 326 GRIGLRIQTEVSEPVIGVNAGD--MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKE 383
            RI L +   VS         +  +P +  R++ +T E+ +G + +++GLL     +  +
Sbjct: 319 DRIRLVLSQSVSTIAGNYEIVNSRIPIFNTRRSKSTFEVGNGESFIISGLLNKQDIEGIK 378

Query: 384 GIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAF 443
            +P+L  IPILGA FRN+  +RE  E+ + AT  LVKPV    +  P   +      + F
Sbjct: 379 KVPVLGDIPILGAFFRNASSSRESKELVVVATVNLVKPVDGSQVLYPT--FENTGTMERF 436

Query: 444 FF 445
           F 
Sbjct: 437 FN 438


>gi|90412176|ref|ZP_01220182.1| hypothetical Flp pilus assembly protein [Photobacterium profundum
           3TCK]
 gi|90326900|gb|EAS43285.1| hypothetical Flp pilus assembly protein [Photobacterium profundum
           3TCK]
          Length = 461

 Score =  248 bits (633), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 109/403 (27%), Positives = 182/403 (45%), Gaps = 45/403 (11%)

Query: 52  IGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLN 111
           + LN    L+   ++  V VS P   D  V   R + +F   +GQA VI+ G D + +L+
Sbjct: 34  VTLNDANNLEFSQEIGTVFVSQPDILDYKVIDSRKLVIFSNKIGQAKVIVYGKDNQVLLS 93

Query: 112 LDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQS 171
               ++ +++ +   L+ +  D +I V  V + V + G V   +       +  T LS+ 
Sbjct: 94  QRYHVDINLSQVRRQLKLYYPDLSISVTSVGEQVAIRGTVNNEKQRDDIYRMVATLLSKK 153

Query: 172 GRNQYANSSS----------------------KKVMNLLNIAGEDQVTLKVTIAEVRRDI 209
              +Y  +                        + ++  L +A   QV +K+++A+V ++ 
Sbjct: 154 EIERYNEAEKLKFVESGFEEANWVRYSKNYTWEGIIEGLVVAQAQQVNVKISVAQVTKEF 213

Query: 210 LKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAI 269
            + IG   S  G S G                                TV++A+      
Sbjct: 214 NETIGVDWSTVGRSVGEFSFLE-------------------FKANDLSTVINAIGNDNIA 254

Query: 270 RTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIG 329
             LAEP LT +SG+SASF  GG+        +  +T+++  ++G+ L  +  VLS  +I 
Sbjct: 255 EILAEPNLTVLSGESASFLVGGEVPVIVT--NDNSTNISFKEFGIKLELSAKVLSNKKIK 312

Query: 330 LRIQTEVS--EPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPL 387
           L++  EVS  +  +     ++P    R+A TT++L  G + +L GL+  D  +    IPL
Sbjct: 313 LQLAPEVSAVDGYVKAAGIEVPQLSSRRAMTTIQLADGDSFMLGGLMSSDDIEEISKIPL 372

Query: 388 LSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRP 430
           L  IPILGA FR S   R++TE+ I AT  LVKPV+  D+  P
Sbjct: 373 LGDIPILGAAFRKSSTTRKKTELVIVATVNLVKPVSPTDVRLP 415


>gi|134295595|ref|YP_001119330.1| type II and III secretion system protein [Burkholderia
           vietnamiensis G4]
 gi|134138752|gb|ABO54495.1| type II and III secretion system protein [Burkholderia
           vietnamiensis G4]
          Length = 443

 Score =  248 bits (633), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 109/462 (23%), Positives = 175/462 (37%), Gaps = 45/462 (9%)

Query: 27  PPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRT 86
                A A               I + +     +     +Q V V DP  ADV++     
Sbjct: 4   TLTAFAMALWALTFASMASASGTIELAVGAQRQIAAGRALQRVAVGDPAIADVLIMKGSR 63

Query: 87  ---MYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSD 143
              + L  K  G  NV++      +    ++ +      ++   +  +  S  +V+    
Sbjct: 64  AGSVLLTAKAPGTTNVMVWERGHDEPTVWNVEV------VDAAAQAVLDASTPQVKAYGG 117

Query: 144 TVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIA 203
           T VL G   ++   +RAV +++    +      +  + K V+ +                
Sbjct: 118 TSVLRGTAGSLDAHERAVAVAKNMSPKGAVIDRSTLAGKNVVQVDVRVV----------- 166

Query: 204 EVRRDILKQIGFQH---------------SITGSSSGPSKSFAADFGGKFVSEGGDFSVK 248
           E  R +LKQ+GF                  +   + G     AA            F++ 
Sbjct: 167 EFSRSVLKQVGFNFFKQSNGFSFGSFSPGGVQSYNGGSGPGTAAYIPTLGAPVASAFNLV 226

Query: 249 GVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVT 308
                      L  LE     R LAEPTL A+SGQSASF +GG+          G+T++ 
Sbjct: 227 VNAAGHGIFADLSLLEANNLARVLAEPTLVALSGQSASFLAGGEIPVP-SPQGLGSTAIQ 285

Query: 309 THDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKADTTVELPS 364
              YGV L  TPTVLSP RI L++  E S+      + ++   +P    R+ADTTVEL  
Sbjct: 286 WKQYGVGLSLTPTVLSPNRIALKVAPESSQLDFVNSVTISGVAVPGITTRRADTTVELGD 345

Query: 365 GGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAM 424
           G + V+ GL+          +PLL  +PI+G  F+N  + + + E+ I  TP LV P+A 
Sbjct: 346 GESFVIGGLIDRQTMSNVSKVPLLGDLPIIGTFFKNLNYQQNDKELLIIVTPHLVAPIAK 405

Query: 425 RDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYK 466
             +           +        V + Y    AS      + 
Sbjct: 406 GAVLPAT-----PGELAEQHDGPVWRSYLGGAASPDAAPGFS 442


>gi|319941902|ref|ZP_08016223.1| hypothetical protein HMPREF9464_01442 [Sutterella wadsworthensis
           3_1_45B]
 gi|319804555|gb|EFW01425.1| hypothetical protein HMPREF9464_01442 [Sutterella wadsworthensis
           3_1_45B]
          Length = 485

 Score =  248 bits (632), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 119/450 (26%), Positives = 211/450 (46%), Gaps = 36/450 (8%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           +S+ L +   L     +  V V+ P+ A   V   R + +FG   G+ +++++G DG+ +
Sbjct: 1   MSVSLYQGKALSFNEQIGAVFVAQPSIASYQVVGNRKVVVFGSYPGKTSLMVLGTDGRTL 60

Query: 110 LNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDS------------ 157
            N  + +  D++ +EM L+       +++  ++D V + G V T Q++            
Sbjct: 61  YNGLVEVAYDVSSMEMALKSSFPKLKLQLVALNDGVAVRGKVETAQEAANVVAFLDAMLQ 120

Query: 158 ---QRAVELSETFLSQSGRNQYANSSS-----------KKVMNLLNIAGEDQVTLKVTIA 203
              Q+A   +    +     Q   S +            K++N L +   +QVT++V  A
Sbjct: 121 VNPQQAQMAAADVSAAGQEGQQEKSGAATGTGTLGARIGKIINQLTVTTPNQVTVRVRFA 180

Query: 204 EVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFS----VKGVLDRFSFETV 259
           EV R +  Q+GF+   + S S    +F +       +             +  RF+F ++
Sbjct: 181 EVNRKLSDQLGFKWKGSYSGSRGGITFGSADNPIISNPNNSLGHLFDPATMAARFTFGSL 240

Query: 260 LHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFT 319
             A+     +  LAEP LT +SG++ASF +GGQ  +++     G   +   DYGV+L  T
Sbjct: 241 FDAMASEELVSILAEPNLTVVSGETASFLAGGQIPFQSS-DGDGGFDIEFKDYGVLLSIT 299

Query: 320 PTVLSPGRIGLRIQTEVSEPVIGVN----AGDMPSYRVRKADTTVELPSGGTIVLAGLLK 375
           PT+LS  RI LR++ EVSE              P + VR+A++T+EL SG +  +AGLLK
Sbjct: 300 PTILSGNRISLRLRPEVSERSDSNGIQFMGSTQPGFIVRRAESTIELASGQSFAIAGLLK 359

Query: 376 DDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYS 435
           +D       IP ++ +PI+GAL R+  F R ETE+ I AT ++  P +    + P++   
Sbjct: 360 NDFSNTVNKIPGIADLPIIGALARSKAFERGETELVIVATAYISTP-SGEPYTIPNEEMY 418

Query: 436 VEDDAKAFFFNRVNKIYGPKEASEVEGQNY 465
           V    + +F +   ++            ++
Sbjct: 419 VPTIFERYFMDADPQVSSGTALKTARKPSF 448


>gi|264678238|ref|YP_003278145.1| type II and III secretion system protein [Comamonas testosteroni
           CNB-2]
 gi|262208751|gb|ACY32849.1| type II and III secretion system protein [Comamonas testosteroni
           CNB-2]
          Length = 523

 Score =  247 bits (631), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 121/444 (27%), Positives = 199/444 (44%), Gaps = 54/444 (12%)

Query: 42  VEIGKGKKISIGLNKVIILQVPVDVQDVLV------------------------SDPTKA 77
             I      ++ L K +++ +   +  +LV                              
Sbjct: 42  TAIRTEDPTTVTLGKSVVIPLSSPMARILVSGQTPGAGQAAAPMAANAQPQMQNGMGDI- 100

Query: 78  DVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSN-I 136
           +V + SPR ++  G+  G  NVIL    G      D+++  D   L+  L   + +   I
Sbjct: 101 EVQLLSPRDLFFRGRKSGSMNVILQNAQGAC-FIKDVIVTMDPGPLQAKLSELMPEERSI 159

Query: 137 RVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQV 196
           RV+   + +VL G +         V L+  +           S SKK++NLL      QV
Sbjct: 160 RVQGADNALVLSGEISNPLRLDDVVTLAGAY-----------SDSKKIVNLLRTTSPHQV 208

Query: 197 TLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSF 256
            L+V IAEV + +L ++G   S+ G     +          F+S GG       + + S 
Sbjct: 209 MLEVKIAEVSKTLLDKLGA--SLAGQRITSNGMNTFSIASNFLSGGGGLLSAMRIGKGSI 266

Query: 257 ETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSV---TTHDYG 313
              +   +    +R LAEP + AISGQ ASF SGG+       S+T    V      ++G
Sbjct: 267 S--IDGQKDDGLVRILAEPNIMAISGQQASFLSGGKIFIPVAQSNTTGVPVMTLEEKEFG 324

Query: 314 VVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGD--------MPSYRVRKADTTVELPSG 365
           + + FTPTVL   R+ L++ +EVS+     +           +PS  VR+ADTTV+L  G
Sbjct: 325 IGVKFTPTVLGGSRVNLKLVSEVSDLSQTGSPFTAINGVTSVIPSLSVRRADTTVQLNDG 384

Query: 366 GTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMR 425
            ++V+AGL+K++I +  +  P L +IP+LGAL R++ F  ++TE+    TP LV+ +A  
Sbjct: 385 QSLVIAGLIKNNITEAVKRFPGLGEIPVLGALARSTEFQTDQTELMFIITPRLVQALA-E 443

Query: 426 DLSRPDDHYSVEDDAKAFFFNRVN 449
               P D++ V   A+ +    + 
Sbjct: 444 APRVPTDNHVVPSRAEVYLNGALE 467


>gi|84385704|ref|ZP_00988735.1| rough colony protein RcpA [Vibrio splendidus 12B01]
 gi|84379684|gb|EAP96536.1| rough colony protein RcpA [Vibrio splendidus 12B01]
          Length = 447

 Score =  246 bits (629), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 106/406 (26%), Positives = 171/406 (42%), Gaps = 36/406 (8%)

Query: 46  KGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHD 105
             + +S+       + +  ++  V V++   AD  + +   + ++G   G  ++I     
Sbjct: 23  ASELLSLDQGGAKTINIKRNIDTVFVANSQIADYKIIANGKLVIYGIGRGATSIIAYDRA 82

Query: 106 GKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSE 165
           G ++ N ++++ + +  L+ TL     D NI++  + + VVL G+V + +       L  
Sbjct: 83  GNEIYNAEVVVNKSLRLLKQTLVARYPDENIKLTNIGEQVVLDGVVSSEEVKANVYRLVG 142

Query: 166 TFLSQ-----------------SGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRD 208
             + +                    +  A    + ++N L +   +Q+ +K+T+AEV   
Sbjct: 143 EMMKKSKERHTFELSGANGESVDALDFTATYVFQDIINNLKVLTTEQINVKLTVAEVSSS 202

Query: 209 ILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATA 268
            L ++G  +             A   G      G   +            V+ A      
Sbjct: 203 FLTELGVSY-------------AESNGKSIGGAGTFVNKILDFTAQDIVAVISASGNDNI 249

Query: 269 IRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRI 328
            R LAEP L+ ISG+SASF  GG+             S+T  +YGV L     V     I
Sbjct: 250 GRVLAEPNLSVISGESASFLVGGEIPI--AVRDNDGVSITYKEYGVKLSMVAKVTDSENI 307

Query: 329 GLRIQTEVSEPVIGVNAGD----MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEG 384
            L +  EVS              +PS R RKA TTV+L  G + VLAGLL  + Q+    
Sbjct: 308 RLSLLPEVSSIDKANGVNSGLISVPSLRTRKAQTTVQLKDGQSFVLAGLLTTEEQESLSR 367

Query: 385 IPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRP 430
           IPLL  IPILGALF  +   R +TE+ I AT  LV PV   ++  P
Sbjct: 368 IPLLGDIPILGALFSKTNTERRKTELIIVATVNLVDPVKEDEIKLP 413


>gi|167587316|ref|ZP_02379704.1| type II and III secretion system protein [Burkholderia ubonensis
           Bu]
          Length = 477

 Score =  246 bits (627), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 106/460 (23%), Positives = 176/460 (38%), Gaps = 54/460 (11%)

Query: 49  KISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRT---MYLFGKNVGQANVILIGHD 105
            I + +     +     +Q V V DP+ ADV++        + L  K  G  NV+L    
Sbjct: 29  SIDLAVGSQRQIAAGRALQRVAVGDPSVADVLIMKGSRAGAVLLVAKAPGSTNVMLWERG 88

Query: 106 GKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSE 165
             + +  ++        ++      +  S    +   D  VL G   ++   +RA  + +
Sbjct: 89  RDEPMVWNV------NVVDAAAHAVLDSSTPDAKAYGDVAVLSGSAASLDAHERAAAIGQ 142

Query: 166 TFL-----------------------SQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTI 202
                                       +            V++   + G + V + V +
Sbjct: 143 HMADKGGAAAGGNWGAGDAGATGKRGGGASGTLGKAGKGGAVIDASTVGGRNTVQVDVRV 202

Query: 203 AEVRRDILKQIGFQHSITGSSSGPSKSFAADF------------GGKFVSEGGDFSVKGV 250
            E  R +LK+ G       +        A                   +     F++   
Sbjct: 203 VEFSRSVLKEAGLNFFKQSNGFAFGAFTAGGLQSITGAATSAFQATAGIPVASAFNLVAN 262

Query: 251 LDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTH 310
                    L  LE     R LA+PTL A+SGQSASF +GG+     V  + G+T++   
Sbjct: 263 SAGRGIFANLSILEANNLARVLAQPTLVALSGQSASFLAGGEIPVP-VPQALGSTAIQWK 321

Query: 311 DYGVVLHFTPTVLSPGRIGLRIQTEVSEPV----IGVNAGDMPSYRVRKADTTVELPSGG 366
            YGV L  TPTVLSP RI L++  E S+      + +N+  +P+   R+ADTTVEL  G 
Sbjct: 322 QYGVGLTLTPTVLSPRRIALKVAPESSQLDFLHGVTINSVAVPAITTRRADTTVELGDGE 381

Query: 367 TIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRD 426
           + V+ GL+  +       +P+L  +PI+GA F+   + + + E+ I  TP LV P+A   
Sbjct: 382 SFVIGGLIDRETMSNVNKVPVLGDLPIIGAFFKTLNYQQNDKELVIIVTPHLVAPIAKGA 441

Query: 427 LSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYK 466
            S P    +   +        V + Y    AS      + 
Sbjct: 442 -SLP----ATPGELSEQRDGPVWRSYLGGIASPDAAPGFS 476


>gi|121607248|ref|YP_995055.1| type II and III secretion system protein [Verminephrobacter
           eiseniae EF01-2]
 gi|121551888|gb|ABM56037.1| type II and III secretion system protein [Verminephrobacter
           eiseniae EF01-2]
          Length = 714

 Score =  246 bits (627), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 88/438 (20%), Positives = 172/438 (39%), Gaps = 41/438 (9%)

Query: 22  SVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVV 81
             A+ P    +   +      +  +  +I + + +  +   P  V  + V +        
Sbjct: 60  LQARKPAPTPSQPYLPIRKQDDQAQVPEIEMFVGESRVFPSPG-VARIAVGNGKVLTAAA 118

Query: 82  HSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIAD-SNIRVEM 140
              R + +F   VG +++ +   DG+       ++  D +     +  F++  +N +  +
Sbjct: 119 LDEREVIVFANEVGTSSLFVWNEDGRYQRVKINVVPGDTSRYAREIAAFLSTIANTKASI 178

Query: 141 VSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLL-NIAGEDQVTLK 199
           + D V++ G   +  D ++  +L + +               +++N    I  E  V + 
Sbjct: 179 IGDKVIVEGDNLSDIDLRKIEDLRKHY--------------PQIVNFTNQIGWEQMVLMD 224

Query: 200 VTIAEVRRDILKQIGFQHSITGSSSGPS------------------KSFAADFGGKFVSE 241
           V + E   + L+++G + +  G +S                             G  +  
Sbjct: 225 VKVVEFPVNELRELGLRWAAKGGASIGGIWSPIRRVHQDGLRIDVESPPITAADGDLIPL 284

Query: 242 GGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSS 301
               ++   L+       L  L        LA+P L+A +G  A F +GG++ Y   S +
Sbjct: 285 PKGLNILSALN-MGLGAKLDLLASQGKASILAQPQLSARNGAKAEFLAGGEYPYVASSIN 343

Query: 302 TGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGDMPSYRVRKADTTVE 361
                V    YG+ L  TP V   G I   I +EVS     ++    P+  VR+  T   
Sbjct: 344 GPT--VMFKPYGIRLKITPRVDRNGVIRAEIDSEVSNIDPSISTAAGPALSVRRTFTEFN 401

Query: 362 LPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKP 421
           + +G T+VL+GL+     Q  + +P L  +P+LGALFR+ RF  +ETE+ +  TP ++  
Sbjct: 402 VQNGETMVLSGLMSRKTSQNIDKVPFLGDLPVLGALFRSKRFQNDETELVVFVTPTVINS 461

Query: 422 VAM---RDLSRPDDHYSV 436
            +    + + R  D    
Sbjct: 462 QSPGLVQRIERITDDLRQ 479


>gi|198284413|ref|YP_002220734.1| type II and III secretion system protein [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218666419|ref|YP_002427081.1| bacterial type II/III secretion system protein [Acidithiobacillus
           ferrooxidans ATCC 23270]
 gi|198248934|gb|ACH84527.1| type II and III secretion system protein [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218518632|gb|ACK79218.1| bacterial type II/III secretion system protein [Acidithiobacillus
           ferrooxidans ATCC 23270]
          Length = 478

 Score =  246 bits (627), Expect = 8e-63,   Method: Composition-based stats.
 Identities = 114/487 (23%), Positives = 189/487 (38%), Gaps = 43/487 (8%)

Query: 8   FFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQ 67
             ++    L +     A          A  + +  + G  + ++I +     L       
Sbjct: 6   MSSLAVATLAALGSQGAWAEGPAAEGGAHPSWAAHQSGGYRALNIPVGTQQTLSFTEPAY 65

Query: 68  DVLVSDPTKADVVVH---SPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLE 124
            V V +P  A V        R   + G + G  ++++     K      + +   +    
Sbjct: 66  RVAVGNPKTASVAPLPRSGGRQFLITGLSTGTTSLLVWNLGHKTPKVWQLQVSVPVPGAP 125

Query: 125 MTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKV 184
           +            V    D V L G V                 +       A   + KV
Sbjct: 126 LAAPAPGMPE---VRAQGDAVTLSGAVADQVKH----------EAALEAAALAAGKTGKV 172

Query: 185 MNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQH-----SITGSSSGPSKSFAADFGGKFV 239
           ++   I  +D+V + V + E  +  LK +G          +  + GPS   +A++     
Sbjct: 173 IDQSVIPVDDEVQVGVKVVEFSKAQLKNVGINIFSSTGGFSLGTFGPSTLTSANYPVSLA 232

Query: 240 SEGGD-------------FSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSAS 286
           S G               F++ G +      + L  LE    +R LAEPTL A++GQ AS
Sbjct: 233 SGGPGALAITGVAPFTQAFNLVGGVGNSGLSSYLSLLEGNNILRVLAEPTLVAMNGQQAS 292

Query: 287 FTSGGQHLYKTVSSS---TGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPV--- 340
           F +GG+       SS   T   ++    YGV L  TPT+LS  RI L +   VS      
Sbjct: 293 FLAGGEIPIPVPQSSGVGTPTITIQYKKYGVQLDLTPTILSAHRIALHVAPSVSSLDYTN 352

Query: 341 -IGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFR 399
            I +N   +P+  VR+ADTTV L +G ++V+ GL+   +QQ    +P+L  +PILGA FR
Sbjct: 353 AITLNGYSVPALLVRQADTTVTLGNGESLVIGGLVDRQMQQNISKVPILGDLPILGAFFR 412

Query: 400 NSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASE 459
           + ++++++ E+ I  TP LV+P+A      P    +       F   +   + G      
Sbjct: 413 SIQYSKQDMELAIIVTPRLVRPIAAGAKLPPLPGAAFA--HSRFNLGKAVLLPGSDYNQP 470

Query: 460 VEGQNYK 466
             G  Y 
Sbjct: 471 DNGPGYS 477


>gi|84385684|ref|ZP_00988715.1| hypothetical Flp pilus assembly protein [Vibrio splendidus 12B01]
 gi|84379664|gb|EAP96516.1| hypothetical Flp pilus assembly protein [Vibrio splendidus 12B01]
          Length = 456

 Score =  245 bits (626), Expect = 9e-63,   Method: Composition-based stats.
 Identities = 106/423 (25%), Positives = 189/423 (44%), Gaps = 47/423 (11%)

Query: 34  AAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKN 93
           A +I +  +        SI LN    +Q+   +  V +++P   D  + +  T+ +F   
Sbjct: 17  APLIGLLSITNAFAADRSITLNDGQHIQLKSPIGQVFINNPDIVDYKIINDNTIVVFANA 76

Query: 94  VGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRT 153
           +GQ+ +I+ G DG  +L+  I+++ D+  +   L+    ++ ++++ V + V + G+V +
Sbjct: 77  IGQSRLIVYGIDGDVLLSDRIIVDLDLTDIRRQLKFHFPNAKVKIQSVGEQVAVSGLVDS 136

Query: 154 IQDSQRAVELSETFLSQSGRNQYANSSS------------------------KKVMNLLN 189
                    L  T L +    ++  +                          + ++  + 
Sbjct: 137 EATRDDIYRLVATLLGREKTEKWDKTVKLEFKSDSSNYEEPESFVFARNMTWEGIIERIE 196

Query: 190 IAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKG 249
           +A   QV +K+++A+V     + +G   S  GSS G                     V  
Sbjct: 197 VATTQQVNVKISVAQVTESFGQTVGVDWSSVGSSVGEF-------------------VFD 237

Query: 250 VLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTT 309
             D  +  T++ AL        LAEP LT +SG+SASF  GG+      +S+    +++ 
Sbjct: 238 QFDAANLSTLITALGNDQIAEVLAEPNLTVLSGESASFLVGGEVPVIVTTSNN--VNISF 295

Query: 310 HDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVI--GVNAGDMPSYRVRKADTTVELPSGGT 367
            ++G+ L  T  VLS  RI +++  EVSE           +P    R+A TTVEL  G +
Sbjct: 296 KEFGIKLDLTAKVLSQDRIRMQLAPEVSEVEGYIETAGIKVPQLASRRAMTTVELADGDS 355

Query: 368 IVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDL 427
            VL GL+     +  + IP +  IP+LGA FR +   R+ TE+ I AT  LV+P+  +D+
Sbjct: 356 FVLGGLMSSADLEKMQKIPFVGDIPVLGAAFRKATTERKRTELIIVATVNLVEPMKPKDI 415

Query: 428 SRP 430
             P
Sbjct: 416 QLP 418


>gi|238790280|ref|ZP_04634054.1| Flp pilus assembly protein, secretin CpaC [Yersinia frederiksenii
           ATCC 33641]
 gi|238721630|gb|EEQ13296.1| Flp pilus assembly protein, secretin CpaC [Yersinia frederiksenii
           ATCC 33641]
          Length = 463

 Score =  245 bits (624), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 107/440 (24%), Positives = 191/440 (43%), Gaps = 48/440 (10%)

Query: 33  NAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGK 92
            A +     +     + I +   +   L+V   V  V +S+P  AD  V   + + +F +
Sbjct: 21  AAFIAMALMIGSAFSQDIYMEKGEARTLKVNAAVDTVFISNPDVADYEVIDEKQVVIFAR 80

Query: 93  NVGQANVILIGHDGK-QMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMV 151
             G+A++ + G D    ++ + I+++  + +++  +      S+I ++   +  VL G V
Sbjct: 81  ENGRASLEIYGGDNNATLMTMSIIVDPLLGNIKKEMAEEYPGSDIDIKKYGEGYVLTGTV 140

Query: 152 RTIQDSQRAVELSETFLSQSGRNQYANSSSKKV------------------------MNL 187
                 +         L    +          V                        +N 
Sbjct: 141 PDEDAREGIYMTVGQALGLKRKETELKIKPGSVNSIGGDDSNDTPIDFMQKVVFEGLVNR 200

Query: 188 LNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSV 247
           L +   +QV +K+T+ EV +  +  +G   S                    +  G     
Sbjct: 201 LKLPTTNQVNVKLTVVEVTKTFMDNVGVDWS-----------------NAGLGAGQFNLT 243

Query: 248 KGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSV 307
           K   D  S  ++++A++  +  R LAEP L+ +SG++A F  GG+     V++S   +++
Sbjct: 244 KFRFDANSLNSLIYAIKNDSIARILAEPNLSVLSGETADFLVGGEIPI--VTTSMAGSTI 301

Query: 308 TTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIG--VNAGDMPSYRVRKADTTVELPSG 365
           T  ++GV L     V S  +I L +  E+S       +   ++P  R RKA TTVEL  G
Sbjct: 302 TYKEFGVKLVIAAKVESNNKIKLNLSEEISSLDGQYALGDLNIPKLRSRKARTTVELGDG 361

Query: 366 GTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMR 425
            + VL GLL ++ ++   GIP +S IPILGALFR +   RE TE+ + AT  LVKP++  
Sbjct: 362 DSFVLGGLLNENEKESLSGIPFISDIPILGALFRRTGAERERTELVVVATVNLVKPISFN 421

Query: 426 DLSRPDDHYSVEDDAKAFFF 445
            +  P  ++   + A+ FF 
Sbjct: 422 KVVLP--NFVRSNLAERFFN 439


>gi|148975962|ref|ZP_01812751.1| hypothetical Flp pilus assembly protein [Vibrionales bacterium
           SWAT-3]
 gi|145964707|gb|EDK29960.1| hypothetical Flp pilus assembly protein [Vibrionales bacterium
           SWAT-3]
          Length = 456

 Score =  244 bits (623), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 109/456 (23%), Positives = 193/456 (42%), Gaps = 64/456 (14%)

Query: 1   MRYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIIL 60
           MR   R    +    L +    ++                          SI LN    +
Sbjct: 1   MRITHRVKRALFGSILVTLVGLLSTTNTFAADR-----------------SITLNDGQHI 43

Query: 61  QVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDI 120
           Q    +  V +++P+  D  + +  T+ +F  +VGQ+ +I+ G D   +L+  I+++ ++
Sbjct: 44  QFKSPIGQVFINNPSIVDYKIINDNTLVVFANSVGQSRLIVYGVDDDVLLSDRIIVDLNL 103

Query: 121 AHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSS 180
             +   L+    D+ ++V+ V + V + G+V +         L  T L +    ++  + 
Sbjct: 104 TDIRRQLKFHFPDAKVKVQSVGEQVAVSGVVDSEATRDDIYRLVATLLGRDKTEKWDKTQ 163

Query: 181 S------------------------KKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQ 216
                                    + ++  + +A   QV +K+++A+V     + +G  
Sbjct: 164 KLEFKSDSSDYEEPESMVFARNMTWEGIIERIEVATTQQVNVKISVAQVTESFGQTVGVD 223

Query: 217 HSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPT 276
            S  GSS G                     V    D  +  T++ AL        LAEP 
Sbjct: 224 WSTVGSSVGEF-------------------VFDQFDAANLSTLITALGNDQIAEVLAEPN 264

Query: 277 LTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEV 336
           LT +SG+SASF  GG+      +SS    +++  ++G+ L  T  VLS  +I +++  EV
Sbjct: 265 LTVLSGESASFLVGGEVPVIVSTSSN--VNISFKEFGIKLDLTAKVLSQDKIRMQLAPEV 322

Query: 337 SEPV--IGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPIL 394
           SE    +      +P    R+A TTVEL  G + VL GL+     +  + IP +  IP+L
Sbjct: 323 SEVEGYVEAAGIKVPQLASRRAMTTVELADGDSFVLGGLMSSADLEKMQKIPFVGDIPVL 382

Query: 395 GALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRP 430
           GA FR +   R+ TE+ I AT  LV+P+  +D+  P
Sbjct: 383 GAAFRKATTERKRTELIIVATVNLVEPMKPKDIQLP 418


>gi|322419944|ref|YP_004199167.1| type II and III secretion system protein [Geobacter sp. M18]
 gi|320126331|gb|ADW13891.1| type II and III secretion system protein [Geobacter sp. M18]
          Length = 493

 Score =  244 bits (622), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 108/388 (27%), Positives = 164/388 (42%), Gaps = 35/388 (9%)

Query: 80  VVHSPRTMYLFGKNVGQANVILIGHDGK----QMLNLDILIERDIAHLEMTLRRFIADSN 135
            + S   + L G  +G  ++I+               D+ +  D   +E  L+       
Sbjct: 115 EILSEYVLKLDGTAIGSTSMIIWTKGEGDERPAPTFFDLKVTGDREAIENQLKEMAPKET 174

Query: 136 IRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQ 195
           I V+  SDTVVL G V   Q   +A E+++ F               KV+N + +    Q
Sbjct: 175 IVVQYASDTVVLSGNVANDQTKTKAFEIAKAFAP-------------KVINNMTVNVPQQ 221

Query: 196 VTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRF- 254
           V L+V +A+V +  LK++G    I GS++    +  A   G     G   +         
Sbjct: 222 VLLQVKVAQVDKSSLKKLGISFLIKGSTAEGFSNLVAGPDGAVTGIGTGAATGIGDFPSL 281

Query: 255 ------------SFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSST 302
                           VL AL      + LAEP L   S Q   F +G +     + S+ 
Sbjct: 282 DSFQAGVSYFPAGIGAVLSALSSKGLAKVLAEPNLLVRSSQEGYFLAGSKIPIAILESTG 341

Query: 303 GA--TSVTTHDYGVVLHFTPTVLSPGRIGLRIQT-EVSEPVIGVNAGDMPSYRVRKADTT 359
           G   TS+     G+ L F P VL  G I L+I   EVS     +     P    R  +T+
Sbjct: 342 GQATTSIRYEPVGIKLKFKPEVLENGMISLKINPAEVSSIQGFLPVNGYPIIDTRTVETS 401

Query: 360 VELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLV 419
           VEL  G +++LAGLL++D  +    IPLL  IPILGALFR+S  + +E E+    TP +V
Sbjct: 402 VELKDGESLILAGLLQEDEIKNMSKIPLLGDIPILGALFRSSSSDIKEKELVFFITPKIV 461

Query: 420 KPVAMR-DLSRPDD-HYSVEDDAKAFFF 445
           +P A    +  P D   + E + +  + 
Sbjct: 462 QPTAPGVKVEMPTDKKLTPEQEKELSWM 489


>gi|320101627|ref|YP_004177218.1| type II and III secretion system protein [Isosphaera pallida ATCC
           43644]
 gi|319748909|gb|ADV60669.1| type II and III secretion system protein [Isosphaera pallida ATCC
           43644]
          Length = 712

 Score =  244 bits (622), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 101/536 (18%), Positives = 192/536 (35%), Gaps = 102/536 (19%)

Query: 27  PPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKA-------DV 79
           P  +     +  + ++      ++S+ + +  ++Q+       ++ +P  A       DV
Sbjct: 151 PNPRPITGQIAELFELIQDPSVELSVVVGRGKVIQLREQPLRFILGNPRIATLSFPPSDV 210

Query: 80  VVH-------SPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIA 132
                       R   ++G   G   + +   +        + +  D   ++  +R    
Sbjct: 211 QSLAQLDRPSDARLFVVYGIQAGTTTLTIWDKNN-VPTTFLVRVSVDTLDIQNQIRAVFP 269

Query: 133 DSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSE--------------------------- 165
            +++ V   ++ ++L G V   +     + L                             
Sbjct: 270 GTDVTVRQSANQIILEGQVPDTKTMNEVIRLVNGLLVSNQAGEVRAPTGAGGGGGGQSVG 329

Query: 166 --TFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQH------ 217
                 ++  ++  +  S +++N L + G  Q+ LKV +AE+ R  +++IG         
Sbjct: 330 AFAAAERALGDEAPSGISPQIINRLRVPGPRQILLKVKLAELNRTAIREIGANWLRGRNN 389

Query: 218 SITGSSSGPSKSFAADFGGKFVSEGGDFSVK----------------------------- 248
           S+ GS  G    F  +   +  +     S                               
Sbjct: 390 SLIGSQIGGIAGFTTETNTQMTAAFAAPSFGRPGIAGGQPIPGSVTGSLIQGIDTLLNAT 449

Query: 249 ------------GVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYK 296
                       G+     F+  L+AL        LAEP LTA+ GQ A   +GG+  + 
Sbjct: 450 AGSALQPSAQLFGIFRAGEFDLFLNALRTNNLATILAEPNLTALDGQPARVIAGGEIPFP 509

Query: 297 TVS------SSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIG----VNAG 346
                          ++    +G +L F P +L    I L ++   S P  G    +N  
Sbjct: 510 VPQLGAGGGGGGAVITIQFRPFGAILTFLPQILEDDLIRLDVEPVFSTPNQGLGTSINGT 569

Query: 347 DMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNRE 406
            +P +  R A T V+L  G T+ +AGL++ + Q     IPLL   PI+G LF  +RF   
Sbjct: 570 AVPGFNTRSARTVVQLREGETLAIAGLIQKNNQAATNRIPLLGDAPIVGPLFSRNRFETL 629

Query: 407 ETEIFIAATPFLVKPVAMRDLS-RPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVE 461
           ETE+ +  TP+L+ P+   ++   P D+    +D + F   R     G    S ++
Sbjct: 630 ETELIVIVTPYLIAPMGEGEVPKVPTDYVDEPNDIEFFILGRTEGKTGIPHRSTIQ 685


>gi|153833257|ref|ZP_01985924.1| general secretion pathway protein D [Vibrio harveyi HY01]
 gi|148870528|gb|EDL69443.1| general secretion pathway protein D [Vibrio harveyi HY01]
          Length = 456

 Score =  243 bits (621), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 109/406 (26%), Positives = 184/406 (45%), Gaps = 47/406 (11%)

Query: 51  SIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQML 110
           SI LN    + V   +  V +S+P  AD  V +  T+ +F   +GQ+ +I+ G D   +L
Sbjct: 34  SITLNDGQHISVKQPIGKVFISNPDVADYKVINDTTLVVFANGIGQSRLIVYGIDEDVLL 93

Query: 111 NLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQ 170
           +  I+++ D+  +   L+    D+ + V+ V + V + G+V + +       L  T L +
Sbjct: 94  SDRIIVDLDLTEIRRQLKFHFPDAKVTVQSVGEQVAVGGVVDSEETRDEIYRLVATLLGR 153

Query: 171 SGRNQYANSSS------------------------KKVMNLLNIAGEDQVTLKVTIAEVR 206
               ++  +                          K ++  + +A   QV +K+++A+V 
Sbjct: 154 EKTEKWDKTYKFEFKSDYAQYEEPEGMIFARNMTWKGIVERIQVATTQQVNVKISVAQVT 213

Query: 207 RDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERA 266
               K +G   S  GSS G                     V    D  +  T++ AL   
Sbjct: 214 ESFGKTVGVDWSSVGSSVGEF-------------------VFDQFDAANLSTLITALGND 254

Query: 267 TAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPG 326
                LAEP LT +SG+SASF  GG+     + S+    +++  ++G+ L  T  VLS  
Sbjct: 255 QVAEVLAEPNLTVLSGESASFLVGGEVPV--IVSTNNNVNISFKEFGIKLDLTAKVLSQD 312

Query: 327 RIGLRIQTEVSEPV--IGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEG 384
           +I +++  EVSE    +      +P    R+A TTVEL  G + +L GL+     +  + 
Sbjct: 313 KIRMQLAPEVSEVESYVEAAGVKVPQLASRRALTTVELADGDSFILGGLMSSADLEKMQK 372

Query: 385 IPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRP 430
           IP +  IPILGA FR +   R+ TE+ I AT  LV+P+  +D+  P
Sbjct: 373 IPFVGDIPILGAAFRKATTERKRTELIIVATVNLVEPIKPKDVQLP 418


>gi|188592032|ref|YP_001796630.1| type II secretion system protein; precursor [Cupriavidus
           taiwanensis LMG 19424]
 gi|170938406|emb|CAP63393.1| putative Type II secretion system protein; putative precursor
           [Cupriavidus taiwanensis LMG 19424]
          Length = 475

 Score =  243 bits (621), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 97/463 (20%), Positives = 181/463 (39%), Gaps = 45/463 (9%)

Query: 4   LQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVP 63
           +Q+T    +++       ++A +       A        +    +++ +       L+  
Sbjct: 8   IQKTSAHAVTLRRRLLQLTLAAMIATTAWCALAPRAQAQDAATARQLRLMAGAQKELRSA 67

Query: 64  VDVQDVLVSDPTKADVVVHSPR---TMYLFGKNVGQANVILIGHDGKQMLNLDILIERDI 120
             V+ V V +P  AD ++   R   ++ L  K  G  +V++    G +  N  +      
Sbjct: 68  QPVERVAVGNPAVADALILRTRGAPSVLLVAKQPGVTDVMVWTRGGAEPQNYSV------ 121

Query: 121 AHLEMTLRRFIADSN-IRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANS 179
                 +     D+N  ++   +  V + G       +           +++      + 
Sbjct: 122 -----QVDAIAPDANGAQLGYSAAGVTITGQSPDAYGAA-----RAQAAARAATAGKTDG 171

Query: 180 SSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFV 239
               V++   +     V + V + E+ + +LK++G       S         +       
Sbjct: 172 KPGLVVDRSTVPLSGTVQVDVKVVEISKTVLKEVGINFFRNNSGFAFGTFSPSTLNKFTF 231

Query: 240 SEGGDFSVKGVLDRF-----------------SFETVLHALERATAIRTLAEPTLTAISG 282
           + G   +                              +  LE     R LAEP+L A+SG
Sbjct: 232 TPGSGGAPGSFSADIASPMSNAFNLVAASLTHGIFANISLLEANGLARVLAEPSLVALSG 291

Query: 283 QSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIG 342
           QSASF +GG+     V  + G T++    +G+ L  +PTVLS  RI L++  E S+    
Sbjct: 292 QSASFLAGGEIPIP-VPQALGTTTIQFKPFGIGLTVSPTVLSADRIALKVAPEASDLDPS 350

Query: 343 ----VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALF 398
               +N   +P+   R+ADTTVEL  G + V+ GL+  +       +P+L  +P++GA F
Sbjct: 351 RGISINGAVVPAIVTRRADTTVELGDGESFVIGGLVSRNTVSNVNKVPVLGDLPVIGAFF 410

Query: 399 RNSRFNREETEIFIAATPFLVKPVA---MRDLSRPDDHYSVED 438
           +N  F++E+ E+ I  TP LVKP+A       +   D  +   
Sbjct: 411 KNLNFHQEDRELMIVVTPRLVKPMAKNSPAAQAVGADGRTSAS 453


>gi|149188846|ref|ZP_01867136.1| hypothetical Flp pilus assembly protein [Vibrio shilonii AK1]
 gi|148837266|gb|EDL54213.1| hypothetical Flp pilus assembly protein [Vibrio shilonii AK1]
          Length = 453

 Score =  243 bits (621), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 104/415 (25%), Positives = 186/415 (44%), Gaps = 47/415 (11%)

Query: 42  VEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVIL 101
             +    +  I +N    +++   +  V VSDP   D  V +  ++ +F K VGQA +++
Sbjct: 22  SSMAYSGETYITVNDAKNIELSERITKVFVSDPDIVDYNVINENSIVIFSKAVGQARLMI 81

Query: 102 IGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAV 161
            G   K + +  I+ + D++ +   +     D+++++E V + V + G+V + ++     
Sbjct: 82  YGESEKLLYSERIIADIDLSQVRRQVALLFPDTSVKIESVGNQVAVSGIVNSERERDDIY 141

Query: 162 ELSETFLSQSGRNQYANSSS------------------------KKVMNLLNIAGEDQVT 197
            L  T L +    ++                               ++  L +A   QV 
Sbjct: 142 RLVATLLGREKLEKWDKVQKLKFQNDNISIEEPESMIFERNMTWDGIIERLEVATVQQVN 201

Query: 198 LKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFE 257
           +K+++A+V     + +G   S  G++ G                     +    +     
Sbjct: 202 VKISVAQVTERFAETVGVDWSSFGANVGQF-------------------LFQQFEAADLT 242

Query: 258 TVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLH 317
           T++ AL      + LAEP LT ISG+SASF  GG+     + S+    ++T  ++G+ L 
Sbjct: 243 TLITALGNENVAQVLAEPNLTVISGESASFLVGGEVPV--IVSTNNNVNITFKEFGIKLD 300

Query: 318 FTPTVLSPGRIGLRIQTEVSEPV--IGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLK 375
            T  VL+  +I +++  EVSE    I     ++P    R+A TT+EL  G + VL GL+ 
Sbjct: 301 LTAKVLTEEKIRMQLFPEVSEIERYIRAAGIEVPQLATRRAMTTIELGDGDSFVLGGLMS 360

Query: 376 DDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRP 430
               +  +  PL+  IP+LGA FR S  +R  TE+ I AT  LVKP+  +D+  P
Sbjct: 361 SADFEEIQKTPLIGDIPVLGAAFRKSSTDRRRTELIIVATVNLVKPMKRKDIQLP 415


>gi|116620532|ref|YP_822688.1| type II and III secretion system protein [Candidatus Solibacter
           usitatus Ellin6076]
 gi|116223694|gb|ABJ82403.1| type II and III secretion system protein [Candidatus Solibacter
           usitatus Ellin6076]
          Length = 529

 Score =  243 bits (619), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 95/418 (22%), Positives = 178/418 (42%), Gaps = 32/418 (7%)

Query: 36  VINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVG 95
                    G GK + + + K +I+  P+++Q + V++    + V  +P+ + + GK  G
Sbjct: 50  ASQDVQPAPGPGK-LMVTVGKSLIIDSPMNIQRISVANGELIEAVAVNPKEVLINGKAAG 108

Query: 96  QANVILIGHDGKQMLN--LDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRT 153
           +  +I+    G ++L      +    +  +   L R   D  I V   ++   + G V+ 
Sbjct: 109 ETTLIIWQQGGNRLLYDLTVRISPVRLDVVRQQLARDFPDDEINVTYDNEVAFVRGRVKD 168

Query: 154 IQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGED---QVTLKVTIAEVRRDIL 210
           +  + R + ++ +                K +NLL +       Q+ L V  A V R   
Sbjct: 169 LSAADRVMAIAASL--------------GKTVNLLRVDVPPVETQILLHVRFANVDRGAS 214

Query: 211 KQIGFQHSITGSSSGPSKSFAADFGGKFVSEG-----GDFSVKGVLDRFSFETVLHALER 265
             +G   +    +   + +          ++G        ++       +    + ALE 
Sbjct: 215 TDLGVSLATGAFNQSTAITTGQYPPPTVGTDGRVSISDALNILLFRKDINLGATIKALES 274

Query: 266 ATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSST--GATSVTTHDYGVVLHFTPTVL 323
              + TLAEP + AI+G+ A+F +GG+     V      GA S+T  ++G+ ++F P + 
Sbjct: 275 KRMLETLAEPNVMAINGKPAAFIAGGEFPVPMVQGGGLAGAVSITFREFGIRINFLPKIT 334

Query: 324 SPGRIGLRIQTEVSEPV----IGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQ 379
             G I L +  EVS       +      +P+   R+  T VEL +G + V+AGLL +   
Sbjct: 335 PRGTIQLAVAPEVSSLDYSNAVTFQGYTIPALATRRIQTEVELETGQSFVIAGLLDNRTT 394

Query: 380 QLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVE 437
           +    IP LS IP+LG LF++    +  TE+ +  TP +V+P+       P  + +V 
Sbjct: 395 ETLNKIPGLSNIPLLGKLFQSRAVAKNNTELMVIVTPEIVRPIQAGQ-PLPSLNMTVP 451


>gi|172060495|ref|YP_001808147.1| type II and III secretion system protein [Burkholderia ambifaria
           MC40-6]
 gi|171993012|gb|ACB63931.1| type II and III secretion system protein [Burkholderia ambifaria
           MC40-6]
          Length = 461

 Score =  243 bits (619), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 108/448 (24%), Positives = 169/448 (37%), Gaps = 45/448 (10%)

Query: 41  DVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRT---MYLFGKNVGQA 97
                    I + +     +     +Q V V DPT ADV++        + L  K  G  
Sbjct: 36  ASIASASGTIELAVGAQRQISAGRALQRVAVGDPTIADVLIMKGSRSGSVLLTAKAPGAT 95

Query: 98  NVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDS 157
           NV+L      +     I +      ++      +  S  +V+    T VL G   T+   
Sbjct: 96  NVMLWERGHDEPTVWSIEV------VDAAAHAVLDGSMPQVKAYGGTSVLRGTSATLDAH 149

Query: 158 QRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQH 217
           +RA  +++    +      +  + K V+ +                E  R +LKQ+GF  
Sbjct: 150 ERAATVAKNMSPKGTVIDRSTLAGKSVVQVDVRVV-----------EFSRSVLKQVGFNF 198

Query: 218 ---------------SITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHA 262
                           +   + G     A             F++            L  
Sbjct: 199 FKQSNGFSFGSFSPGGVQSYNGGSGPGTAGYIPALGAPVASAFNLVVNAAGRGIFADLSL 258

Query: 263 LERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTV 322
           LE     R LAEPTL A+SGQSASF +GG+          G+T++    YGV L  TPTV
Sbjct: 259 LEANNMARVLAEPTLVALSGQSASFLAGGEIPVP-SPQGLGSTAIQWKQYGVGLSLTPTV 317

Query: 323 LSPGRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDI 378
           L P RI L++  E S+      + ++   +P    R+ADTTVEL  G + V+ GL+    
Sbjct: 318 LGPNRIALKVAPESSQLDFVNSVTISGVAVPGITTRRADTTVELGDGESFVIGGLIDRQT 377

Query: 379 QQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVED 438
                 +PLL  +PI+G  F+N  + + + E+ I  TP LV P+A   +           
Sbjct: 378 MSNVSKVPLLGDLPIIGTFFKNLNYQQNDKELLIIVTPHLVAPIAKGAVLPAT-----PG 432

Query: 439 DAKAFFFNRVNKIYGPKEASEVEGQNYK 466
           +        V + Y    AS      + 
Sbjct: 433 ELSEQRDGPVWRSYLGGAASPDAAPGFS 460


>gi|78066131|ref|YP_368900.1| Flp pilus assembly protein secretin CpaC [Burkholderia sp. 383]
 gi|77966876|gb|ABB08256.1| Flp pilus assembly protein secretin CpaC [Burkholderia sp. 383]
          Length = 443

 Score =  243 bits (619), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 121/469 (25%), Positives = 186/469 (39%), Gaps = 49/469 (10%)

Query: 16  LFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPT 75
           L     +++ L     + AA              IS+ +     L     +Q V V DP+
Sbjct: 5   LIGLAIALSALAMPPLSGAA---------DTSGTISLAVGAQRQLATGRALQRVAVGDPS 55

Query: 76  KADVVVHSPRT--MYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIAD 133
            ADV+V       + L  K+ G  NV++      +    ++ +    A      R  +  
Sbjct: 56  VADVMVVKGGRGGVLLIAKSAGATNVMIWERGHDEPTVYNVSVTSGAA------RALLDG 109

Query: 134 SNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGE 193
               V     T V+ G   ++   QRAV  ++T   + G    A++ S K +  +++   
Sbjct: 110 GTSSVNTYGGTTVIGGASGSLDGHQRAVHAAKTVSGKDGTTIDASTISGKNVVQVDVRVV 169

Query: 194 DQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGD--------- 244
                     E  R +LKQ G       +                 S GG          
Sbjct: 170 ----------EFSRSVLKQAGLNFFKQSNGFSFGAFAPTGLTSITGSPGGALTYNTNVPI 219

Query: 245 ---FSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSS 301
              F++            L  LE     R LA+PTL A+SGQSA+F +GG+     V  S
Sbjct: 220 SSAFNLVVNSVSHGLFADLSILEANNLARVLAQPTLVALSGQSANFLAGGEIPVP-VPQS 278

Query: 302 TGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEP----VIGVNAGDMPSYRVRKAD 357
            G  S+    YGV L  TPTVL+P RI L++  E S+      I +N   +P+   R+AD
Sbjct: 279 LGTISIEWKPYGVGLTVTPTVLNPRRIALKVAPESSQLDFVHSITINGVQVPALTTRRAD 338

Query: 358 TTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPF 417
           TTVEL  G + V+ GL+  +       +P L  +PI+GA F+N  + + + E+ I  TP 
Sbjct: 339 TTVELGDGESFVIGGLIDRETTSNVNKVPFLGDLPIIGAFFKNLSYQQSDKELVIIVTPH 398

Query: 418 LVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYK 466
           LV P+A    S P    +   +        V + Y    AS   G  + 
Sbjct: 399 LVAPIAQGA-SLP----ATPGELSEQRDGPVWRSYLGGMASPDAGPGFS 442


>gi|218459699|ref|ZP_03499790.1| cpaC pilus assembly Q protein [Rhizobium etli Kim 5]
          Length = 409

 Score =  243 bits (619), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 110/416 (26%), Positives = 187/416 (44%), Gaps = 32/416 (7%)

Query: 5   QRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPV 64
           +R   T     L +   +   L P     A+    S       + +++  N+ + L    
Sbjct: 6   RRIARTKSLAALAAVFSACVCLGPGFAGFASAQEKSVTLGKSVQHVTLPPNETLTLNTGQ 65

Query: 65  DVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLE 124
              D+++      DVV  S R++++ GK +G  N+ + G D   +  +DI +  D + + 
Sbjct: 66  PFGDLVIGSADMIDVVPLSDRSLFVRGKKIGATNISVYGDDKSLLGVIDIRVASDFSEVA 125

Query: 125 MTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKV 184
             +R     + +RV   +D + L G+VR   + QR +E+++++            S + V
Sbjct: 126 SAIRSAAPSARVRVVNSNDRIRLVGVVRDGIELQRVLEIAQSY------------SEQPV 173

Query: 185 MNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFG--------- 235
           +N L ++   QV L+V I E  R   + +G   S  GS+     + +             
Sbjct: 174 LNQLRVSDSQQVMLEVRIIEASRQTGRDLGIGWSGQGSNGIGKATTSQGITVNDDGNLAR 233

Query: 236 ---------GKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSAS 286
                       +  G   +    +   + + V++ALE+   +R LA+P L A+SG +AS
Sbjct: 234 TLLDPKGAATGMLPFGQLIAKVLQISGGNIDVVINALEQKGLVRRLAQPNLIAMSGSTAS 293

Query: 287 FTSGGQHL--YKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVN 344
           F +GG+      T + +T AT      +GV L F P VL  G I L I+ EVSE    +N
Sbjct: 294 FHAGGEVPILKTTNNGTTVATETDYRPFGVRLTFKPVVLDDGVINLEIEPEVSELDPAIN 353

Query: 345 AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRN 400
               P +  R A TTV L  G +  +AGLL+    +  + +P L +IP+LGALFR+
Sbjct: 354 VNGNPGFISRAASTTVALRDGQSFAMAGLLQSINAKDIQQLPGLGQIPVLGALFRS 409


>gi|163801677|ref|ZP_02195575.1| hypothetical Flp pilus assembly protein [Vibrio sp. AND4]
 gi|159174594|gb|EDP59396.1| hypothetical Flp pilus assembly protein [Vibrio sp. AND4]
          Length = 456

 Score =  242 bits (618), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 106/406 (26%), Positives = 184/406 (45%), Gaps = 47/406 (11%)

Query: 51  SIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQML 110
           SI LN    + V   +  V +S+P  AD  V +  T+ +F K VG + +++ G +   +L
Sbjct: 34  SITLNDGKHISVKQPIGKVFISNPDIADYKVINDTTLVVFAKGVGHSRLLVYGANEDVLL 93

Query: 111 NLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQ 170
           +  I+++ D+  +   L+    D+ + V+ V + V + G+V + +       L    L +
Sbjct: 94  SDRIIVDLDLTQIRRQLKFHFPDAKVTVQSVGEQVAVSGVVDSEETRDAIYRLVANLLGR 153

Query: 171 SGRNQYANSSS------------------------KKVMNLLNIAGEDQVTLKVTIAEVR 206
               ++ +SS                         + ++  + +A   QV +K+++A+V 
Sbjct: 154 EKTEKWESSSKRSFKSDHGTFEEPESMIFARNMTWEGIIEQIQVATTQQVNVKISVAQVT 213

Query: 207 RDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERA 266
               K +G   +  GSS G                     V    D  +  T++ AL   
Sbjct: 214 ESFGKTVGVDWNSVGSSVGGF-------------------VFDQFDAANLSTLITALGND 254

Query: 267 TAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPG 326
                LAEP LT +SG+SASF  GG+       ++   T+++  ++G+ L     VLS  
Sbjct: 255 QVAEVLAEPNLTVLSGESASFLVGGEVPVIISDANG--TNISFKEFGIKLDLAAKVLSQD 312

Query: 327 RIGLRIQTEVSEPV--IGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEG 384
           +I +++  EVSE    +      +P    R+A TTVEL  G + +L GL+     +  + 
Sbjct: 313 KIRMQLAPEVSEVESYVEAAGIKVPQLASRRALTTVELADGDSFILGGLMSSADLEKMQK 372

Query: 385 IPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRP 430
           IP +  IPILGA FR +   R+ TE+ I AT  LV+P+  +D+  P
Sbjct: 373 IPFIGDIPILGAAFRRATTERKRTELIIVATVNLVEPIKPKDVHLP 418


>gi|261856884|ref|YP_003264167.1| type II and III secretion system protein [Halothiobacillus
           neapolitanus c2]
 gi|261837353|gb|ACX97120.1| type II and III secretion system protein [Halothiobacillus
           neapolitanus c2]
          Length = 443

 Score =  241 bits (616), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 95/423 (22%), Positives = 159/423 (37%), Gaps = 30/423 (7%)

Query: 35  AVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNV 94
           +V   S         +++   + ++   P  +  V V +    +V V   R M +     
Sbjct: 22  SVPVFSADAPALPDAVTMYAGQALVRSAPGSLLRVAVGNGKLVEVRVLGRRQMVIIANQA 81

Query: 95  GQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSN-IRVEMVSDTVVLHGMVRT 153
           G  ++ L   DG +      ++  +   +   +R  +  S  + V  V   VVL G+  T
Sbjct: 82  GDTSLQLWMRDGSRRSIDLHIVSGNTDQVAELVRTLLKASKAVSVNTVGGNVVLSGVNLT 141

Query: 154 IQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQI 213
            +D  +   + + +       Q              +  +  V +KV I E  +  L QI
Sbjct: 142 QEDVAQIAAIKKVYPQVLDFTQANA-----------VQMKPMVMMKVRIMEFDKSALHQI 190

Query: 214 GFQHSITGSSSGP-----------------SKSFAADFGGKFVSEGGDFSVKGVLDRFSF 256
           G +        G                  S       G   +      +        S 
Sbjct: 191 GIKWDSVIDGPGGALAHDFASNSLYRMTPSSFGGIGANGAVNLPLSLSGTPAFFGLVTSI 250

Query: 257 ETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVL 316
            + ++ + +      LA P L A SG +A F  GG+          G TSV    YG+ L
Sbjct: 251 TSKINLMMQTGNAWELATPQLAARSGGTADFLVGGEVPIPIA-QGLGQTSVEYKPYGIKL 309

Query: 317 HFTPTVLSPGRIGLRIQTEVSEPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKD 376
           H  P V S G I   I+ E+S     V     P +  RKA T V +  G TIV++GL+  
Sbjct: 310 HIEPVVSSTGDISTTIKAEISHIDPSVTVQGYPGFLTRKASTEVNVHEGQTIVISGLVDS 369

Query: 377 DIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSV 436
              +  + +P L +IP+LG LFR+  F  + +++ I  TP+LV P A  + +       +
Sbjct: 370 SASKTIDKVPGLGQIPVLGELFRSRDFKSKRSDLVIFVTPYLVTPDAPLNKALISKSNKL 429

Query: 437 EDD 439
            D+
Sbjct: 430 ADE 432


>gi|322434104|ref|YP_004216316.1| type II and III secretion system protein [Acidobacterium sp.
           MP5ACTX9]
 gi|321161831|gb|ADW67536.1| type II and III secretion system protein [Acidobacterium sp.
           MP5ACTX9]
          Length = 484

 Score =  241 bits (616), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 111/503 (22%), Positives = 194/503 (38%), Gaps = 64/503 (12%)

Query: 1   MRYLQRTFFTMMSIFLFSSNPSVA------------KLPPIKEANAAVINISDVEIGKGK 48
           M   +R   T     L     ++                    A+ A   +   ++G  +
Sbjct: 1   MNVKKRIPLTSFVPALLLLAGTLPFNPCSAFAQSVQAPGDSPTAHEARKRMDMHDMGGDE 60

Query: 49  KISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQ 108
            + + +   ++L    +++ + V +PT        P  + L  K  G +++++    G+ 
Sbjct: 61  TLHLLVGHSMVLHSTSNIKRIFVGNPTVLQSYTGGPSEIVLTAKATGVSSLVVWDTQGQS 120

Query: 109 MLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFL 168
            L   I  + D   L+ ++      S I V      + L G V T + S  A +L+ ++ 
Sbjct: 121 CL-YTIAADMDPETLQRSMHDAYPKSQIDVGGHEGRIFLSGTVPTQEASDNAFKLASSYS 179

Query: 169 SQSGRNQYANSSSKKVMNLLNIAGE--DQVTLKVTIAEVRRDILKQIGFQHSITGSSSGP 226
                          V+N + +      QV LK+ I EV R  ++Q G       +S+  
Sbjct: 180 KD-------------VVNSIRVVTIHGKQVQLKLRIVEVDRTKMEQFGINLFRPTASNAV 226

Query: 227 SKSFAADFGG------------------KFVSEGGDFSVKGVLDRFSFETVLHALERATA 268
                  F                      ++     +             +  LE+   
Sbjct: 227 GGLTTGQFPSLATYATGTPATATAPAVPATINVNNPLNFFIYSFSHEIGATIQDLEQKQI 286

Query: 269 IRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGA----TSVTTHDYGVVLHFTPTVLS 324
           ++ LAEPTLTA+SGQSA F SGG+  +  V     A     +++   YGV + FTPTV  
Sbjct: 287 LQVLAEPTLTAMSGQSAKFLSGGEFPFPVVQGGGSAAGVAITISFRPYGVKVDFTPTVNE 346

Query: 325 PGRIGLRIQTEVS----EPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQ 380
            G I L++  EVS       + ++   +P+   R+A+T VE+ +G T  L GLL     +
Sbjct: 347 DGSIHLKVAPEVSTLDFSNAVTISGFTIPALSTRRAETEVEILNGQTFALTGLLDHRTTE 406

Query: 381 LKEGIPLLSKIPILGALF-RNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSV--- 436
               IP +S++PILG LF     +     E+ +  T  +V P     L++P D       
Sbjct: 407 SLSQIPGISRLPILGKLFATTKSYTHSVIELVVLVTANVVDP-----LTQPTDTTQPDMA 461

Query: 437 -EDDAKAFFFNRVNKIYGPKEAS 458
             +  K+ F N ++K     +  
Sbjct: 462 VPNLDKSVFDNDLSKEQKLPKKP 484


>gi|156977409|ref|YP_001448315.1| Flp pilus assembly protein, secretin CapC [Vibrio harveyi ATCC
           BAA-1116]
 gi|156529003|gb|ABU74088.1| hypothetical protein VIBHAR_06196 [Vibrio harveyi ATCC BAA-1116]
          Length = 456

 Score =  241 bits (614), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 105/406 (25%), Positives = 183/406 (45%), Gaps = 47/406 (11%)

Query: 51  SIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQML 110
           SI L+    + +   +  V +S+P  AD  V +  T+ +F   +GQA +I+ G D   +L
Sbjct: 34  SITLHDGQHISLKQPIGKVFISNPDVADYKVINDTTLVVFANGIGQARLIVYGIDEDVLL 93

Query: 111 NLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQ 170
           +  I+++ D+  +   ++    D+ + V+ + + V + G V + +       L  T L +
Sbjct: 94  SDRIIVDLDLTDVRRQIKFNFPDAKVTVQSIGEQVAVSGFVDSEETRDEIYRLVATLLGR 153

Query: 171 SGRNQYANSSS------------------------KKVMNLLNIAGEDQVTLKVTIAEVR 206
               ++  +                          + ++  + +A   QV +K+++A+V 
Sbjct: 154 EKIKKWDKADKFEFKSDYAQYEAPEGMIFARNMSWRGIVERIEVATTQQVNVKISVAQVT 213

Query: 207 RDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERA 266
               K +G   S  GSS G                     V    D  +  T++ AL   
Sbjct: 214 ESFGKTVGVDWSSVGSSVGEF-------------------VFDQFDAANLSTLITALGND 254

Query: 267 TAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPG 326
                LAEP LT +SG+SASF  GG+     + S+    +++  ++G+ L  T  VLS  
Sbjct: 255 QVAEVLAEPNLTVLSGESASFLVGGEVPV--IISTNNNVNISFKEFGIKLDLTAKVLSKD 312

Query: 327 RIGLRIQTEVSEPV--IGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEG 384
           +I +++  EVSE    +      +P    R+A TTVEL  G + +L GL+     +  + 
Sbjct: 313 KIRMQLAPEVSEVESYVEAAGIKVPQLASRRALTTVELADGDSFILGGLMSSADLEKMQK 372

Query: 385 IPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRP 430
           IP +  IPILGA FR +   R+ TE+ I AT  LV+P+  +D+  P
Sbjct: 373 IPFVGDIPILGAAFRKAMTERKRTELIIVATVNLVEPIKPKDVQLP 418


>gi|116626779|ref|YP_828935.1| type II and III secretion system protein [Candidatus Solibacter
           usitatus Ellin6076]
 gi|116229941|gb|ABJ88650.1| type II and III secretion system protein [Candidatus Solibacter
           usitatus Ellin6076]
          Length = 471

 Score =  241 bits (614), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 101/434 (23%), Positives = 183/434 (42%), Gaps = 42/434 (9%)

Query: 16  LFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPT 75
           L  +    A       A A    +        +  ++   +  +L    D+  V +S+P 
Sbjct: 7   LLRAALISAVWAAGCFAQATKPQV--------RDFTLLEGRGELLTFQNDITKVAISEPK 58

Query: 76  KADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSN 135
            AD VV SPR + +  K  G+A +++    G   +  +I + +D    +M  +  I  + 
Sbjct: 59  IADAVVISPREVMVNAKGPGRATLVVW-ETGLDPVRYEIAVTKDTTEWDMFTKSMIDSAG 117

Query: 136 --IRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGE 193
             I +    DT+VL G+V++  D++R   +++T          A   ++           
Sbjct: 118 VPIHITGSGDTIVLSGVVKSADDAKRLAGMAQTRAKTVINLLQAPPPAE----------P 167

Query: 194 DQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSF-----------AADFGGKFVSEG 242
            Q+ L+V  A + R  L QIGF    T      + S                 G+ V+  
Sbjct: 168 RQILLQVKFAAIDRVALTQIGFNLFSTNDKFIGASSTEQFSSPRFSQLQPTGTGQTVNFS 227

Query: 243 GDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSST 302
              ++       +    + ALE    ++ LAEP L  + G+ A+F +GG   Y T++++ 
Sbjct: 228 DLLNLFAFRPDLNIGATIKALEERNLLQILAEPNLLCLDGKEATFLAGGTFPYPTITTTP 287

Query: 303 GAT------SVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPV----IGVNAGDMPSYR 352
                    +V    +GV L F PTV   G I L++Q EVS       + +    +P+  
Sbjct: 288 TGGATAPVITVQFKPFGVKLDFQPTVTPQGSIDLKVQPEVSSLDYANAVTLQGFVIPALS 347

Query: 353 VRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFI 412
            R+A+T + L  G +  +AGL+ + + +    +P L  +P+LG +FR+    +   E+ +
Sbjct: 348 QRRAETEIILKDGESFAIAGLIDNRVIETLSKVPGLGDLPVLGKIFRSRSTQKSADELLV 407

Query: 413 AATPFLVKPVAMRD 426
             TP  VKP+   +
Sbjct: 408 VVTPHFVKPLTPEE 421


>gi|161524905|ref|YP_001579917.1| type II and III secretion system protein [Burkholderia multivorans
           ATCC 17616]
 gi|189350345|ref|YP_001945973.1| pilus assembly protein [Burkholderia multivorans ATCC 17616]
 gi|160342334|gb|ABX15420.1| type II and III secretion system protein [Burkholderia multivorans
           ATCC 17616]
 gi|189334367|dbj|BAG43437.1| pilus assembly protein [Burkholderia multivorans ATCC 17616]
          Length = 443

 Score =  240 bits (613), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 107/445 (24%), Positives = 167/445 (37%), Gaps = 45/445 (10%)

Query: 44  IGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVH---SPRTMYLFGKNVGQANVI 100
                 I + +     +     +Q V V DP  ADV++       ++ L  K  G  NV+
Sbjct: 21  ASASGTIELAVGAQRQISAGRPLQRVAVGDPAIADVLIMKGSRSSSVLLIAKAPGATNVM 80

Query: 101 LIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRA 160
           L      +     + +      ++      + DS  RV     T VL G   ++   +RA
Sbjct: 81  LWERGRDEPTVWSVEV------VDAAAHAVLDDSAPRVNAYGGTAVLRGTSASLDAHERA 134

Query: 161 VELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSIT 220
           V + +    +      +  + K V+ +                E  R +LKQ+GF     
Sbjct: 135 VAVGKNMAGKGAVIDRSTLAGKSVVQVDVRVV-----------EFSRSVLKQVGFNFFKQ 183

Query: 221 GSSSGPSKSFAAD---------------FGGKFVSEGGDFSVKGVLDRFSFETVLHALER 265
            +         +                           F++            L  LE 
Sbjct: 184 SNGFSFGSFLPSGVQSFGGGSGPGSAGYIPTLGSPVASAFNLVVNAAGRGIFGDLSLLEA 243

Query: 266 ATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSP 325
               R LAEPTL A+SGQSASF +GG+          G+T++    YGV L  TPTVLSP
Sbjct: 244 NNLARVLAEPTLVALSGQSASFLAGGEIPVP-SPQGLGSTAIQWKQYGVGLSLTPTVLSP 302

Query: 326 GRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQL 381
            RI L++  E S+      + ++   +P    R+ADTTVEL  G + V+ GL+       
Sbjct: 303 QRIALKVAPESSQLDFVNSVTISGVAVPGITTRRADTTVELGDGESFVIGGLIDRQTMSN 362

Query: 382 KEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAK 441
              +PLL  +PI+G  F+N  + + + E+ I  TP LV P+A               +  
Sbjct: 363 VSKVPLLGDLPIIGTFFKNLNYQQNDKELLIIVTPHLVAPIAKGAALPAT-----PGELS 417

Query: 442 AFFFNRVNKIYGPKEASEVEGQNYK 466
                 V + Y    AS      + 
Sbjct: 418 EQRDGPVWRSYLGGVASPDAAPGFS 442


>gi|206559894|ref|YP_002230658.1| flp type pilus assembly protein [Burkholderia cenocepacia J2315]
 gi|198035935|emb|CAR51827.1| flp type pilus assembly protein [Burkholderia cenocepacia J2315]
          Length = 443

 Score =  240 bits (612), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 121/469 (25%), Positives = 189/469 (40%), Gaps = 49/469 (10%)

Query: 16  LFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPT 75
           L     +++ L     ++AA              IS+ +     +     +Q V V DP+
Sbjct: 5   LIGLAIALSALAMPPLSDAA---------DTSGTISLAIGAQRQIATGRALQRVAVGDPS 55

Query: 76  KADVVVHSPRT--MYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIAD 133
            ADV+V       + L  KN G  NV++      +    ++ +    A      R  +  
Sbjct: 56  VADVLVVKGGRGGVLLVAKNAGATNVMIWERGRDEPTVYNVNVTSGAA------RALLDG 109

Query: 134 SNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGE 193
           ++  V     T V+ G   T+   QRAV  ++T   + G    A++ S K +  +++   
Sbjct: 110 TSPSVNTYGGTTVIGGAAGTLDGHQRAVHAAKTVGGKDGTTLDASTISGKNVVQVDVRVV 169

Query: 194 DQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGD--------- 244
                     E  R +LKQ G       +                 + GG          
Sbjct: 170 ----------EFSRSVLKQAGLNFFKQSNGFSFGAFAPTGLTSISGTPGGSLTYNTSVPI 219

Query: 245 ---FSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSS 301
              F++            L  LE     R LA+PTL A+SGQSA+F +GG+     V  S
Sbjct: 220 SSAFNLVVNSVSRGLFADLSILEANNLARVLAQPTLVALSGQSANFLAGGEIPVP-VPQS 278

Query: 302 TGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEP----VIGVNAGDMPSYRVRKAD 357
            G  S+    YGV L  TPTVLSP RI L++  E S+      I +N+  +P+   R+AD
Sbjct: 279 LGTISIEWKPYGVGLTVTPTVLSPRRIALKVAPESSQLDFVHSITINSVQVPALTTRRAD 338

Query: 358 TTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPF 417
           TTVEL  G + V+ GL+  +       +P L  +PI+GA F+N  + + + E+ I  TP 
Sbjct: 339 TTVELGDGESFVIGGLIDRETTSNVNKVPFLGDLPIIGAFFKNLSYQQNDKELVIIVTPH 398

Query: 418 LVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYK 466
           LV P+A      P    +   +        V + Y    AS   G  + 
Sbjct: 399 LVAPIAQGA-PLP----ATPGELSEQRDGPVWRSYLGGMASPDAGPGFS 442


>gi|187926427|ref|YP_001892772.1| type II and III secretion system protein [Ralstonia pickettii 12J]
 gi|241665914|ref|YP_002984273.1| type II and III secretion system protein [Ralstonia pickettii 12D]
 gi|187728181|gb|ACD29345.1| type II and III secretion system protein [Ralstonia pickettii 12J]
 gi|240867941|gb|ACS65601.1| type II and III secretion system protein [Ralstonia pickettii 12D]
          Length = 454

 Score =  240 bits (612), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 101/438 (23%), Positives = 181/438 (41%), Gaps = 41/438 (9%)

Query: 19  SNPSVAKLPPIKEANAAVINISDVEIGKG-KKISIGLNKVIILQVPVDVQDVLVSDPTKA 77
           +      +  +    AA ++ +  E     + + +       +++   ++ + + +P  A
Sbjct: 4   AAMVRGWMGGLALGCAAFVSSAFAETAPTGQTLHLLTGSQREIRLGKPLERIAIGNPEIA 63

Query: 78  DVVVHSPR----TMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIAD 133
           D ++   R    ++ +  K  G ANV++    G      ++ ++             +  
Sbjct: 64  DALLLKGRGTATSVLIIAKKPGAANVMVWTQGG-VATTYNVQVDAAAP---------VPG 113

Query: 134 SNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGE 193
            +  V    DT V+ G  +          L+    S +  +         V++  ++   
Sbjct: 114 -DPAVVAQGDTAVVSGQPKD------VYALARARRSAAAASGAEKPKDGNVIDTTSMNVP 166

Query: 194 DQVTLKVTIAEVRRDILKQIGFQHS-----ITGSSSGPSKSFAADFGGKFVSE------G 242
             V + V + E  + +LK+ GF            +  PS      FG   +S       G
Sbjct: 167 GTVQVDVRVVEFSKTVLKEAGFTFGRTRGGFDFRTFAPSSLSKVTFGSNGLSTESTMPIG 226

Query: 243 GDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSST 302
             F++            L  LE     R LAEP+L A+SGQSA+F +GG+     V  + 
Sbjct: 227 SAFNLLVSSVSKGLFADLSLLESNGMARVLAEPSLVALSGQSANFLAGGEIPIP-VPQAL 285

Query: 303 GATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPV----IGVNAGDMPSYRVRKADT 358
           G T++    +G+ L  +PT+LS  RI L++  E S+      + +N   +P+   R+ADT
Sbjct: 286 GTTTIEYKPFGIGLTVSPTILSENRIALKVAPEASDLDFSRGVTLNGATVPAIVTRRADT 345

Query: 359 TVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFL 418
           TVEL  G + V+ GL+        + +P L  +PI+G  F+   +N+EE E+ I  TP L
Sbjct: 346 TVELGDGESFVIGGLVSRSTLSNVDKVPFLGDVPIIGTFFKRLNYNQEERELVIIVTPHL 405

Query: 419 VKPVAMRDLSRPDDHYSV 436
           VKP+A      P D    
Sbjct: 406 VKPMARNA---PIDKMLP 420


>gi|107022594|ref|YP_620921.1| type II and III secretion system protein [Burkholderia cenocepacia
           AU 1054]
 gi|116689543|ref|YP_835166.1| type II and III secretion system protein [Burkholderia cenocepacia
           HI2424]
 gi|170732847|ref|YP_001764794.1| type II and III secretion system protein [Burkholderia cenocepacia
           MC0-3]
 gi|105892783|gb|ABF75948.1| type II and III secretion system protein [Burkholderia cenocepacia
           AU 1054]
 gi|116647632|gb|ABK08273.1| type II and III secretion system protein [Burkholderia cenocepacia
           HI2424]
 gi|169816089|gb|ACA90672.1| type II and III secretion system protein [Burkholderia cenocepacia
           MC0-3]
          Length = 443

 Score =  240 bits (612), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 121/469 (25%), Positives = 189/469 (40%), Gaps = 49/469 (10%)

Query: 16  LFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPT 75
           L     +++ L     ++AA              IS+ +     +     +Q V V DP+
Sbjct: 5   LIGLAIALSALAMPPLSDAA---------DTSGTISLAIGAQRQIATGRALQRVAVGDPS 55

Query: 76  KADVVVHSPRT--MYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIAD 133
            ADV+V       + L  KN G  NV++      +    ++ +    A      R  +  
Sbjct: 56  VADVLVVKGGRGGVLLVAKNAGATNVMIWERGRDEPTVYNVNVTSGAA------RALLDG 109

Query: 134 SNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGE 193
           ++  V     T V+ G   T+   QRAV  ++T   + G    A++ S K +  +++   
Sbjct: 110 TSPSVNTYGGTTVIGGAAGTLDGHQRAVHAAKTVGGKDGTTLDASTISGKNVVQVDVRVV 169

Query: 194 DQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGD--------- 244
                     E  R +LKQ G       +                 + GG          
Sbjct: 170 ----------EFSRSVLKQAGLNFFKQSNGFAFGAFAPTGLTSITGTPGGSLTYNTSVPI 219

Query: 245 ---FSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSS 301
              F++            L  LE     R LA+PTL A+SGQSA+F +GG+     V  S
Sbjct: 220 SSAFNLVVNSVSRGLFADLSILEANNLARVLAQPTLVALSGQSANFLAGGEIPVP-VPQS 278

Query: 302 TGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEP----VIGVNAGDMPSYRVRKAD 357
            G  S+    YGV L  TPTVLSP RI L++  E S+      I +N+  +P+   R+AD
Sbjct: 279 LGTISIEWKPYGVGLTVTPTVLSPRRIALKVAPESSQLDFVHSITINSVQVPALTTRRAD 338

Query: 358 TTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPF 417
           TTVEL  G + V+ GL+  +       +P L  +PI+GA F+N  + + + E+ I  TP 
Sbjct: 339 TTVELGDGESFVIGGLIDRETTSNVNKVPFLGDLPIIGAFFKNLSYQQNDKELVIIVTPH 398

Query: 418 LVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYK 466
           LV P+A      P    +   +        V + Y    AS   G  + 
Sbjct: 399 LVAPIAQGA-PLP----ATPGELSEQRDGPVWRSYLGGMASPDAGPGFS 442


>gi|307944371|ref|ZP_07659712.1| putative type III secretion component [Roseibium sp. TrichSKD4]
 gi|307772717|gb|EFO31937.1| putative type III secretion component [Roseibium sp. TrichSKD4]
          Length = 411

 Score =  240 bits (611), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 98/398 (24%), Positives = 169/398 (42%), Gaps = 18/398 (4%)

Query: 42  VEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVIL 101
                   I++     I+L+    V  V +     A+V   + + +Y+ G   G  N+++
Sbjct: 15  SSSNAAPPINLTKGFGILLRFNEPVASVFIGSNEIAEVQAVNEKAIYVSGLTAGTTNLLV 74

Query: 102 IGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAV 161
           + +D   + +  I++          L   I + ++ V+   +T ++ G V  I D+    
Sbjct: 75  MNYDNDIIRSHAIVVHPVNNETSYLLENLIPNGDVTVQSSGNTSIIRGNVDNIDDADDIR 134

Query: 162 ELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITG 221
           E+                  +KV++    +   QV+LKV I E+ R  L ++GF  S   
Sbjct: 135 EVKTRL----------EEQGRKVIDKTTTSTPVQVSLKVRIVELYRADLIKLGFDVSSVS 184

Query: 222 SSSGPSKSFAADFGGKFVSEGGD-------FSVKGVLDRFSFETVLHALERATAIRTLAE 274
           S S       +     F+S             + G  + F+   +L  LE+   I+ LAE
Sbjct: 185 SGSVFKVVTGSGIAQDFMSTLIGSVEGQTRVGISGANNSFNVNAMLDLLEKRGYIQILAE 244

Query: 275 PTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQT 334
           P LT ++G+ A+F SGG+    +V+   G  +    + G+ + F P +L   +I + I +
Sbjct: 245 PRLTTVTGEKATFRSGGEF-AVSVNQGNGVFTAEYKETGISIDFIPEILPGDKISIDISS 303

Query: 335 EVSEPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPIL 394
           E+            P+  VR   T  ++ SG T  LAGL +      K G P LSKIP+ 
Sbjct: 304 EIKFVDPQSVVNSAPALLVRSVQTNAQVASGQTFALAGLYQLTQSSSKSGPPYLSKIPVF 363

Query: 395 GALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDD 432
           G L   +  +REE E+    TP+LV      +  +P D
Sbjct: 364 GNLLSKTNESREERELIFFITPYLVHSSVPIEKKQPTD 401


>gi|309778769|ref|ZP_07673542.1| roadblock/LC7 domain protein [Ralstonia sp. 5_7_47FAA]
 gi|308922477|gb|EFP68101.1| roadblock/LC7 domain protein [Ralstonia sp. 5_7_47FAA]
          Length = 454

 Score =  240 bits (611), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 100/438 (22%), Positives = 181/438 (41%), Gaps = 41/438 (9%)

Query: 19  SNPSVAKLPPIKEANAAVINISDVEIGKG-KKISIGLNKVIILQVPVDVQDVLVSDPTKA 77
           +      +  +    AA ++ +  E     + + +       +++   ++ + + +P  A
Sbjct: 4   AAMVRGWMGGLALGCAAFVSSAFAETAPTGQTLHLLTGSQREIRLGKPLERIAIGNPEIA 63

Query: 78  DVVVHSPR----TMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIAD 133
           D ++   R    ++ +  K  G ANV++    G      ++ ++             +  
Sbjct: 64  DALLLKGRGTATSVLIIAKKPGAANVMVWTQGG-VATTYNVQVDAAAP---------VPG 113

Query: 134 SNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGE 193
            +  V    DT V+ G  +          L+    S +  +         V++  ++   
Sbjct: 114 -DPAVVAQGDTAVVSGQPKD------VYALARARRSAAAASGAEKPKDGNVIDTTSMNVP 166

Query: 194 DQVTLKVTIAEVRRDILKQIGFQHS-----ITGSSSGPSKSFAADFGGKFVSE------G 242
             V + V + E  + +LK+ GF            +  PS      FG   +S       G
Sbjct: 167 GTVQVDVRVVEFSKTVLKEAGFTFGRTRGGFDFRTFAPSSLSKVTFGSNGLSTESTMPIG 226

Query: 243 GDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSST 302
             F++            L  LE     R LAEP+L A+SGQSA+F +GG+     V  + 
Sbjct: 227 SAFNLLVSSVSKGLFADLSLLESNGMARVLAEPSLVALSGQSANFLAGGEIPIP-VPQAL 285

Query: 303 GATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPV----IGVNAGDMPSYRVRKADT 358
           G T++    +G+ L  +PT+LS  RI L++  E S+      + +N   +P+   R+ADT
Sbjct: 286 GTTTIEYKPFGIGLTVSPTILSENRIALKVAPEASDLDFSRGVTLNGATVPAIVTRRADT 345

Query: 359 TVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFL 418
           TVEL  G + V+ GL+        + +P L  +P++G  F+   +N+EE E+ I  TP L
Sbjct: 346 TVELGDGESFVIGGLVSRSTLSNVDKVPFLGDVPVIGTFFKRLNYNQEERELVIIVTPHL 405

Query: 419 VKPVAMRDLSRPDDHYSV 436
           VKP+A      P D    
Sbjct: 406 VKPMARNA---PIDKMLP 420


>gi|325518465|gb|EGC98164.1| pilus assembly protein [Burkholderia sp. TJI49]
          Length = 429

 Score =  240 bits (611), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 106/445 (23%), Positives = 166/445 (37%), Gaps = 45/445 (10%)

Query: 44  IGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRT---MYLFGKNVGQANVI 100
                 I + +     +     +Q V V DP  ADV++        + L  K  G  NV+
Sbjct: 7   ASASGTIELAVGTQRQISAGRSLQRVAVGDPAIADVLIMKGSRSGSVLLTAKAPGATNVM 66

Query: 101 LIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRA 160
           L      +     + +      ++      + DS  RV     T VL G   ++   +RA
Sbjct: 67  LWERGRDEPTVWSVEV------VDAAAHAVLDDSTPRVNAYGGTAVLRGTSASLDAHERA 120

Query: 161 VELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSIT 220
           V + +    +      +  + K V+ +                E  R +LKQ+GF     
Sbjct: 121 VAVGKNMAGKGAVIDRSTLAGKNVVQVDVRVV-----------EFSRSVLKQVGFNFFKQ 169

Query: 221 GSSSGPSKSFAAD---------------FGGKFVSEGGDFSVKGVLDRFSFETVLHALER 265
            +                                     F++            L  LE 
Sbjct: 170 SNGFSFGSFSPGGVQSYGGGSGPGTAGYIPTLGSPVASAFNLVVNAAGHGIFGDLSLLEA 229

Query: 266 ATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSP 325
               R LAEPTL A+SGQSASF +GG+  +       G+T++    YG+ L  TPTVLSP
Sbjct: 230 NNLARVLAEPTLVALSGQSASFLAGGEIPFP-SPQGLGSTAIQWKQYGIGLSLTPTVLSP 288

Query: 326 GRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQL 381
            RI L++  E S+      + ++   +P    R+ADTTVEL  G + V+ GL+       
Sbjct: 289 QRIALKVAPESSQLDYVNSVTISGVSVPGITTRRADTTVELGDGESFVIGGLIDRQTMSN 348

Query: 382 KEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAK 441
              +PLL  +PI+G  F+N  + + + E+ I  TP LV P+A               +  
Sbjct: 349 VSKVPLLGDLPIIGTFFKNLNYQQNDKELLIIVTPHLVAPIAKGAALPAT-----PGELS 403

Query: 442 AFFFNRVNKIYGPKEASEVEGQNYK 466
                 V + Y    AS      + 
Sbjct: 404 EQRDGPVWRSYLGGVASPDAAPGFS 428


>gi|221213139|ref|ZP_03586115.1| bacterial type II/III secretion system protein [Burkholderia
           multivorans CGD1]
 gi|221167352|gb|EED99822.1| bacterial type II/III secretion system protein [Burkholderia
           multivorans CGD1]
          Length = 443

 Score =  240 bits (611), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 112/445 (25%), Positives = 173/445 (38%), Gaps = 45/445 (10%)

Query: 44  IGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRT---MYLFGKNVGQANVI 100
              G  I + +     +     +Q V V DP  ADV++        + +  K  G  NV+
Sbjct: 21  ASAGGTIELAVGAQRQISAGRALQRVAVGDPAIADVLIMKGSRSGAVLVIAKAPGATNVM 80

Query: 101 LIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRA 160
           L      +    ++ +      ++      + DS  RV     T VL G   ++   +RA
Sbjct: 81  LWERGRDEPTVWNVEV------VDAAAHAVLDDSTPRVNTYGGTSVLRGTAASLDAHERA 134

Query: 161 VELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQH--- 217
           V + +    +      +  + K V+ +                E  R +LKQ+GF     
Sbjct: 135 VAVGKNVSGKGAVIDRSTLAGKNVVQVDVRVV-----------EFSRSVLKQVGFNFFKQ 183

Query: 218 --SITGSSSGPSKSFAADFGGKFVSEG----------GDFSVKGVLDRFSFETVLHALER 265
               +  S  P    + + G    S G            F++            L  LE 
Sbjct: 184 SNGFSFGSFSPGGVQSYNGGAGPGSAGYLPTLGAPVASAFNLVVNAAGRGIFADLSLLEA 243

Query: 266 ATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSP 325
               R LAEPTL A+SGQSASF +GG+          G+T++    YGV L  TPTVLSP
Sbjct: 244 NNLARVLAEPTLVALSGQSASFLAGGEIPVP-SPQGLGSTAIQWKQYGVGLSLTPTVLSP 302

Query: 326 GRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQL 381
            RI L++  E S+      + ++   +P    R+ADTTVEL  G + V+ GL+       
Sbjct: 303 QRIALKVAPESSQLDFVNSVTISGVAVPGITTRRADTTVELGDGESFVIGGLIDRQTMSN 362

Query: 382 KEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAK 441
              +PLL  +PI+G  F+N  + + + E+ I  TP LV P+A                  
Sbjct: 363 VSKVPLLGDLPIIGTFFKNLNYQQNDKELLIIVTPHLVAPIAKGAALPAT-----PGQLS 417

Query: 442 AFFFNRVNKIYGPKEASEVEGQNYK 466
                 V + Y    AS      + 
Sbjct: 418 EQRDGPVWRSYLGGAASPDAAPGFS 442


>gi|221197781|ref|ZP_03570827.1| bacterial type II/III secretion system protein [Burkholderia
           multivorans CGD2M]
 gi|221204661|ref|ZP_03577678.1| bacterial type II/III secretion system protein [Burkholderia
           multivorans CGD2]
 gi|221175518|gb|EEE07948.1| bacterial type II/III secretion system protein [Burkholderia
           multivorans CGD2]
 gi|221181713|gb|EEE14114.1| bacterial type II/III secretion system protein [Burkholderia
           multivorans CGD2M]
          Length = 443

 Score =  239 bits (610), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 112/445 (25%), Positives = 173/445 (38%), Gaps = 45/445 (10%)

Query: 44  IGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRT---MYLFGKNVGQANVI 100
              G  I + +     +     +Q V V DP  ADV++        + +  K  G  NV+
Sbjct: 21  ASAGGTIELAVGAQRQISAGRALQRVAVGDPAIADVLIMKGSRSGAVLVIAKAPGATNVM 80

Query: 101 LIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRA 160
           L      +    ++ +      ++      + DS  RV     T VL G   ++   +RA
Sbjct: 81  LWERGRDEPTVWNVEV------VDAAAHAVLDDSTPRVNTYGGTSVLRGTAASLDAHERA 134

Query: 161 VELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQH--- 217
           V + +    +      +  + K V+ +                E  R +LKQ+GF     
Sbjct: 135 VAVGKNVSGKGTVIDRSTLAGKNVVQVDVRVV-----------EFSRSVLKQVGFNFFKQ 183

Query: 218 --SITGSSSGPSKSFAADFGGKFVSEG----------GDFSVKGVLDRFSFETVLHALER 265
               +  S  P    + + G    S G            F++            L  LE 
Sbjct: 184 SNGFSFGSFSPGGVQSYNGGAGPGSAGYLPTLGAPVASAFNLVVNAAGRGIFADLSLLEA 243

Query: 266 ATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSP 325
               R LAEPTL A+SGQSASF +GG+          G+T++    YGV L  TPTVLSP
Sbjct: 244 NNLARVLAEPTLVALSGQSASFLAGGEIPVP-SPQGLGSTAIQWKQYGVGLSLTPTVLSP 302

Query: 326 GRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQL 381
            RI L++  E S+      + ++   +P    R+ADTTVEL  G + V+ GL+       
Sbjct: 303 QRIALKVAPESSQLDFVNSVTISGVAVPGITTRRADTTVELGDGESFVIGGLIDRQTMSN 362

Query: 382 KEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAK 441
              +PLL  +PI+G  F+N  + + + E+ I  TP LV P+A                  
Sbjct: 363 VSKVPLLGDLPIIGTFFKNLNYQQNDKELLIIVTPHLVAPIAKGAALPAT-----PGQLS 417

Query: 442 AFFFNRVNKIYGPKEASEVEGQNYK 466
                 V + Y    AS      + 
Sbjct: 418 EQRDGPVWRSYLGGAASPDAAPGFS 442


>gi|116694140|ref|YP_728351.1| flp pilus assembly protein, secretin [Ralstonia eutropha H16]
 gi|113528639|emb|CAJ94986.1| flp pilus assembly protein, secretin [Ralstonia eutropha H16]
          Length = 470

 Score =  239 bits (610), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 91/417 (21%), Positives = 166/417 (39%), Gaps = 40/417 (9%)

Query: 34  AAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPR---TMYLF 90
           A        E    +++ +       ++    V+ V V +P  AD +V   R   ++ L 
Sbjct: 33  ALAPRAQAQEAVNARQLRLLAGAQKEIRSAQPVERVAVGNPAVADALVLRTRGAPSVLLV 92

Query: 91  GKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGM 150
            K  G  +V++    G + L  ++ ++      +            ++   +    + G 
Sbjct: 93  AKQPGVTDVMVWTRGGAEPLTYNVQVDAIAPDAD----------GAKLGYSAAGATITGQ 142

Query: 151 VRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDIL 210
                 +           +++      +     V++   +     V + V + E+ + +L
Sbjct: 143 SPDAYAAA-----RAQAAARAATTGKTDGKPGLVVDRSTVPLSGTVQVDVKVVEISKTVL 197

Query: 211 KQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRF---------------- 254
           K++G       S         +       + G   +                        
Sbjct: 198 KEVGINFFRNNSGFAFGTFSPSTLNKFTFTPGSGGAPGSFSADIASPMSNAFNLVAASLT 257

Query: 255 -SFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYG 313
                 +  LE     R LAEP+L A+SGQSASF +GG+     V  + G T++    +G
Sbjct: 258 HGIFANISLLEANGLARVLAEPSLVALSGQSASFLAGGEIPIP-VPQALGTTTIQFKPFG 316

Query: 314 VVLHFTPTVLSPGRIGLRIQTEVSEPVIG----VNAGDMPSYRVRKADTTVELPSGGTIV 369
           + L  +PTVLS  RI L++  E S+        +N   +P+   R+ADTTVEL  G + V
Sbjct: 317 IGLTVSPTVLSADRIALKVAPEASDLDPSRGISINGAVVPAIVTRRADTTVELGDGESFV 376

Query: 370 LAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRD 426
           + GL+  +       +P+L  +P++GA F+N  F++E+ E+ I  TP LVKP+A   
Sbjct: 377 IGGLVSRNTVSNVNKVPVLGDLPVIGAFFKNLNFHQEDRELMIVVTPRLVKPLAKGA 433


>gi|163857691|ref|YP_001631989.1| putative Flp pilus assembly secretin [Bordetella petrii DSM 12804]
 gi|163261419|emb|CAP43721.1| putative Flp pilus assembly secretin [Bordetella petrii]
          Length = 464

 Score =  238 bits (608), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 109/478 (22%), Positives = 185/478 (38%), Gaps = 35/478 (7%)

Query: 3   YLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQV 62
           +++      +   + ++       P   +  A     +       + IS+ +    +L +
Sbjct: 4   WMKPRMRASLLCTVLATAGVFYGAPVAGQ--ARPAEPAAAAPAASQDISLAVKGQQLLPL 61

Query: 63  PVDVQDVLVSDPTKADVVVH-----SPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIE 117
           P     + V+DP  ADV V       P  + L GK+ G   V +   + +      + + 
Sbjct: 62  PGTPTRIAVADPDVADVKVLPAAAGRPAAVMLIGKSAGTTQVQVWARNSRSPATWTVHVT 121

Query: 118 RDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYA 177
             +   +  L+R        V++     V+ G   +    Q +V  +   +        A
Sbjct: 122 GPV---QAELQRRGQAGGANVDVAGTHAVVSGHAPSALSHQNSVAAAAASVGDKNVVDVA 178

Query: 178 NSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFA----AD 233
            + S  V+ +     E             R ++KQ+G   +      G     +    + 
Sbjct: 179 TAGSGGVVQVEVKVVEV-----------SRSVMKQVGLSMTGNAGGWGFGSRTSPDGFST 227

Query: 234 FGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQH 293
            G              + D   F   L  L+     R LAEPTL A+SGQSASF +GG+ 
Sbjct: 228 PGTLNPRGVLSDGFNLLFDSNHFGATLRMLQSNGMARVLAEPTLVALSGQSASFLAGGEI 287

Query: 294 LYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPV--------IGVNA 345
                    G  +V    +G+ L  TPTVLS  RI L++  E SE           G  A
Sbjct: 288 PIPES-GGLGTQNVVFKPFGIGLTVTPTVLSRDRIALKVAPEASELDYVNGIPILNGETA 346

Query: 346 GDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNR 405
             +P+ R R+ADT +EL  G + V++GL+    +     +P L ++PI+GA FR   +++
Sbjct: 347 TLIPALRTRRADTMIELGDGESFVISGLVSRQTKASVNKVPFLGELPIIGAFFRGIEYSQ 406

Query: 406 EETEIFIAATPFLVKPVAMR-DLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEG 462
           EE E+ I  TP LV+P+A    L  P +     D     +   +    G ++      
Sbjct: 407 EEHELVIVVTPRLVRPIARGVALPLPGERQERPDSITNAWGYYLMGPAGGQQVPGFSR 464


>gi|283778969|ref|YP_003369724.1| type II and III secretion system protein [Pirellula staleyi DSM
           6068]
 gi|283437422|gb|ADB15864.1| type II and III secretion system protein [Pirellula staleyi DSM
           6068]
          Length = 684

 Score =  238 bits (607), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 105/510 (20%), Positives = 186/510 (36%), Gaps = 63/510 (12%)

Query: 23  VAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVH 82
           +A   P  E +         +I     + + L +  IL      + + + D + A   V 
Sbjct: 138 MANPVPTAEVSQRFDRFIQRKIDPENTLEVILGRPRILVFNETPKRIYLPDESIAAFQVI 197

Query: 83  SPRTMYLFGKNVGQANVILI---GHDGKQMLNLDILIERDIAHLEMTL-----------R 128
             R + + G++VG   + L       GK+++   ++       L+  L            
Sbjct: 198 DDRQISIVGRSVGSTALNLWVIDPETGKEIVLSYLVKVLPEPQLKERLEAVYAGLEREIN 257

Query: 129 RFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANS--------- 179
           +    S I++ ++ D + + G      ++ + +++         ++++            
Sbjct: 258 QAFPRSKIQLSLIGDQLAVRGQAHDAVEANQILQIVARHSPTKSQDEFGRPVQYVQQAAF 317

Query: 180 --------------------------SSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQI 213
                                     +   ++NLL I GE QV L+VT+AEV R   + I
Sbjct: 318 IDQQRDPLVDQDQAFLRQTVVDSALLARSGIINLLQIPGEQQVMLRVTVAEVNRTAARSI 377

Query: 214 GFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLA 273
           G   S+  ++ G +              G   +V   LD       ++AL      +TLA
Sbjct: 378 GLNFSVQ-NNQGTTVFQNLTGQLGAAGGGNLSNVLASLDNGQVILAINALRSLRLAKTLA 436

Query: 274 EPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVT--THDYGVVLHFTPTVLSPGRIGLR 331
           EP LT ++GQ A+F +GG      +    G          +GV + FTP V+   RI L+
Sbjct: 437 EPNLTTLNGQQATFRAGGSFPVPQIGGLGGTGLQGTVFVPFGVSIEFTPYVIDRDRIRLK 496

Query: 332 IQTEVSEPVIGVNA----------GDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQL 381
           +   VS     +              +     R  D+TVEL  G T+ +AGL++ ++   
Sbjct: 497 LSAGVSVRDESLGTSIGGSAGAGGTQVAGLNSRTFDSTVELREGQTLAVAGLIQTNMGAD 556

Query: 382 KEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLS-RPDDHYSVEDDA 440
            + +P    +PI+G     SR    E E+ I  TP LV P+   D    P        D 
Sbjct: 557 SDRVPFWGDLPIIGHTGGFSRTTAGEQELVILVTPELVHPLEACDTPSLPGADVFETGDI 616

Query: 441 KAFFFNRVNKIYGPKEASEVEGQNYKGAIG 470
           + +  N +         S V     +   G
Sbjct: 617 EFYLGNHLEARRMRDYRSTVRTDFARIRAG 646


>gi|91775995|ref|YP_545751.1| type II and III secretion system protein [Methylobacillus
           flagellatus KT]
 gi|91709982|gb|ABE49910.1| type II and III secretion system protein [Methylobacillus
           flagellatus KT]
          Length = 453

 Score =  238 bits (607), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 104/425 (24%), Positives = 181/425 (42%), Gaps = 40/425 (9%)

Query: 47  GKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDG 106
            ++I + + +  + +  V +Q V V++P    V + SP+TM +  K VG   + L     
Sbjct: 27  AEEIMVSMGQQRLYEHTVTLQRVAVANPEVLAVTLTSPKTMMIVPKAVGATEISLWDSQS 86

Query: 107 KQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSET 166
            Q   +  +       LE    +    + ++VE   + + L G  R++++  RA+E  + 
Sbjct: 87  VQPSRVLQVSVTPSLALEGQGLKAADAAGLQVEAAGNGLALSGEARSLEEHARALESLQK 146

Query: 167 FLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSS--- 223
               +     +   S              V + + + EV R    + GF      S+   
Sbjct: 147 ERQGALDVTSSEFDSH-------------VQIDIKVVEVSRQNAMRFGFLMGKNNSASRD 193

Query: 224 --------------SGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAI 269
                            S  F       F+     F+V            L  LE     
Sbjct: 194 GFGIVASPNSFSGVEAGSGGFDFSSTSGFLPVLNAFNVVFGNHGSGLLGTLSILEGNGFA 253

Query: 270 RTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVT--THDYGVVLHFTPTVLSPGR 327
            TLAEP+L+AISGQ+A+F +GG+      +     +++T    +YGV L  TPT+LS  R
Sbjct: 254 YTLAEPSLSAISGQTATFLAGGEFPVPIRTGGGSDSAITIRYKEYGVRLMLTPTILSGER 313

Query: 328 IGLRIQTEVSEPV----IGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKE 383
           I L++  EVSE      +      +P  +VR+ +T+V L +G + V++G++  +     +
Sbjct: 314 IFLKVAPEVSELDFANAVQTGGVAVPGLKVRRTETSVSLGNGESFVISGMVSRNTINNID 373

Query: 384 GIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRD--LSRPDDHYSV--EDD 439
            +P L  IPI+GA F + RF+RE+ E+ +  TP LV+P+A      + P           
Sbjct: 374 KVPGLGNIPIIGAFFSSKRFDREDKELLMVVTPRLVRPIARNAELPALPGSELKHYKPSF 433

Query: 440 AKAFF 444
           ++ F 
Sbjct: 434 SEFFL 438


>gi|238762407|ref|ZP_04623378.1| Type II/III secretion system protein [Yersinia kristensenii ATCC
           33638]
 gi|238699392|gb|EEP92138.1| Type II/III secretion system protein [Yersinia kristensenii ATCC
           33638]
          Length = 379

 Score =  238 bits (607), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 96/372 (25%), Positives = 171/372 (45%), Gaps = 25/372 (6%)

Query: 82  HSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMV 141
               ++ ++ K  G A  IL   + + +    +L+   I      ++    +S+I +  +
Sbjct: 1   MGKNSIIVYAKQEGTAEFILFNQNNQPIKKSAVLVNNTITAANKRIQIEYPESDIEINKI 60

Query: 142 SDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANS-----SSKKVMNLLNIAGEDQV 196
             + +L GM  + +     V +    +         +          ++N + + G +QV
Sbjct: 61  GTSYILTGMAESEEAKDTIVSIIGEAIGSKKTIDTDSQYLNTPEYYGIINKIKLMGTNQV 120

Query: 197 TLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSF 256
            +K+TIAEV +D  + IG   S  G  SG  +    +    F + G              
Sbjct: 121 NVKLTIAEVTKDFSENIGVDWSTIGDFSGSFQLVKLNSLNNFSARG-------------I 167

Query: 257 ETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVL 316
             ++HA+   +  R LAEP L+ +SG+SASF  GG+     V+++  +T +T  ++G+ L
Sbjct: 168 SALVHAINDDSIARVLAEPNLSVLSGESASFLVGGEIPM--VNTTQNSTVITYKEFGIKL 225

Query: 317 HFTPTVLSPGRIGLRIQTEVSEPV---IGVNAGDMPSYRVRKADTTVELPSGGTIVLAGL 373
           +    V    RI + +  EVS              PS+R RKA TT+EL  G + +L GL
Sbjct: 226 NIGAKVNEKKRIRIMLDEEVSSIDKVFNIDGGNAYPSFRTRKAATTLELGDGESFILGGL 285

Query: 374 LKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDH 433
           + +  ++  + IP +  IPILGA FRN+   + +TE+ + AT  LV+PV+ R++  P  +
Sbjct: 286 ISNSERESLKKIPFIGDIPILGAFFRNAETRKNQTELVVVATVNLVRPVSEREVELP--N 343

Query: 434 YSVEDDAKAFFF 445
           +      + FF 
Sbjct: 344 FMHTSTLERFFN 355


>gi|187923645|ref|YP_001895287.1| type II and III secretion system protein [Burkholderia phytofirmans
           PsJN]
 gi|187714839|gb|ACD16063.1| type II and III secretion system protein [Burkholderia phytofirmans
           PsJN]
          Length = 468

 Score =  238 bits (607), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 111/469 (23%), Positives = 186/469 (39%), Gaps = 41/469 (8%)

Query: 17  FSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTK 76
            S+    A      +A  A            + I + +     + V   +Q V + DP+ 
Sbjct: 21  VSAATDAAGPAQRAQAAPAAQPHQAAFAPPAQGIDLTVGAQRQIAVGHTLQRVAIGDPSV 80

Query: 77  ADVVVHSPRT---MYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIAD 133
           ADV++        + L GK  G  N++L   D    L   + +    A         +  
Sbjct: 81  ADVLIIKGDKRGGVLLVGKAAGTTNLMLWSRDRDAPLQYTVNVTTPAAA------SLLGA 134

Query: 134 SNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGE 193
               V+++  T ++ G   T++  QRAV  +E  L + G     ++ + + +  +++   
Sbjct: 135 DTPAVKVLGGTAIVSGTSATMEAHQRAVVAAEGSLGKDGAVFDTSTVASRAVVQVDVRVV 194

Query: 194 DQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEG----------- 242
                     E  R +LK++GF      +         +       + G           
Sbjct: 195 ----------EFSRSVLKEVGFNFFKQNNGFTFGSFAPSALSSVSATAGQAPSLTGVTPI 244

Query: 243 -GDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSS 301
              F++            L  LE     R LAEPTL A+SGQSASF +GG+     V  +
Sbjct: 245 SSAFNLIFNSATHGLFANLSLLESNNLARVLAEPTLVALSGQSASFLAGGEVPIP-VPQA 303

Query: 302 TGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPV----IGVNAGDMPSYRVRKAD 357
            G+TS+    YGV L  TPTVLSP RI L++  E S+      + ++   +P++  R+AD
Sbjct: 304 LGSTSIEFKPYGVGLTLTPTVLSPQRIALKVAPEASQLDFANAVTISGVSVPAFTTRRAD 363

Query: 358 TTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPF 417
           TTVEL  G + V+ GL+  +       +PLL  +P++G  F+   + + E E+ I  TP 
Sbjct: 364 TTVELGDGESFVIGGLIDRETASNVSKVPLLGDLPVIGTFFKQLNYQQNEKELVIIVTPH 423

Query: 418 LVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYK 466
           LV P+A               +        V +      A+      + 
Sbjct: 424 LVSPLARGATLPST-----PGEQSEQRNGPVWRSLIGGVAARDASPGFS 467


>gi|296158794|ref|ZP_06841623.1| type II and III secretion system protein [Burkholderia sp. Ch1-1]
 gi|295890999|gb|EFG70788.1| type II and III secretion system protein [Burkholderia sp. Ch1-1]
          Length = 474

 Score =  238 bits (606), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 115/485 (23%), Positives = 195/485 (40%), Gaps = 49/485 (10%)

Query: 9   FTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGK--------KISIGLNKVIIL 60
              + + L + + +     P     AA    +       +        +I++ +     L
Sbjct: 11  AAWLGVALLAVSAATDAAGPAPRGQAAQAAQAAQAAQAAQPALAAPAQRIALTVGAQQQL 70

Query: 61  QVPVDVQDVLVSDPTKADVVVHSPRT---MYLFGKNVGQANVILIGHDGKQMLNLDILIE 117
            V   +Q V + DP+ ADV++        + L GK  G  N++L   D    L   + + 
Sbjct: 71  AVGHTLQRVAIGDPSVADVLIIKGDKRGGVLLVGKAAGTTNLMLWARDRDAPLQYTVDVT 130

Query: 118 RDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYA 177
              A         +      V+++  T V+ G   T++  QRAV  +E  L + G     
Sbjct: 131 TPAAA------SLLGPDTPAVKVLGGTAVVSGTSATMEAHQRAVVAAEGSLGKDGAVFDT 184

Query: 178 NSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGK 237
           ++ + + +  +++             E  R +LK++GF      +         +     
Sbjct: 185 STVASRAVVQVDVRVV----------EFSRSVLKEVGFNFFKQNNGFTFGSFAPSALSSV 234

Query: 238 FVSEG------------GDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSA 285
             + G              F++            L  LE     R LAEPTL A+SGQSA
Sbjct: 235 SATAGQAPSMTGVTPISSAFNLIFNSATHGLFANLSLLESNNLARVLAEPTLVALSGQSA 294

Query: 286 SFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPV----I 341
           SF +GG+     V  + G+TS+    YG+ L  TPTVLSP RI L++  E S+      +
Sbjct: 295 SFLAGGEVPIP-VPQALGSTSIEFKPYGIGLTLTPTVLSPQRIALKVAPEASQLDFANAV 353

Query: 342 GVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNS 401
            ++   +P++  R+ADTTVEL  G + V+ GL+  +       +PLL  +P++G  F+  
Sbjct: 354 TISGVSVPAFITRRADTTVELGDGESFVIGGLIDRETASNVSKVPLLGDLPVIGTFFKQL 413

Query: 402 RFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVE 461
            + + E E+ I  TP LV P+A    S P    S   +        V +      A+   
Sbjct: 414 NYQQNEKELVIIVTPHLVSPLAKGA-SLP----STPGEQSEQRNGPVWRSLIGGVAARDS 468

Query: 462 GQNYK 466
              + 
Sbjct: 469 SPGFS 473


>gi|167570105|ref|ZP_02362979.1| type II/III secretion system protein [Burkholderia oklahomensis
           C6786]
          Length = 434

 Score =  237 bits (605), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 110/449 (24%), Positives = 174/449 (38%), Gaps = 40/449 (8%)

Query: 36  VINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRT--MYLFGKN 93
           V+        +   I +       + V  +VQ V V DP  ADV+V       + L  K 
Sbjct: 7   VLLSFAARAAEMGTIELATGAQRQVSVGRNVQRVAVGDPNVADVLVVKGGRGSVLLVAKA 66

Query: 94  VGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRT 153
            G  ++++      +     + +    A      R  +   +  V+    T V+ G   T
Sbjct: 67  AGSTSLMVWERGRDEPAVYTVNVVSGAA------RALLDGGSPSVKAYGGTAVVSGSAAT 120

Query: 154 IQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQI 213
           +    RA+ L +    + G    A++   K +  +++             E  R +LKQ 
Sbjct: 121 LDAHARALALGKGMAGKDGGVVDASTVGGKNVVQVDVRVV----------EFSRSVLKQA 170

Query: 214 GFQHSITGSSSGPSKSFAADFGGKFVSEG------------GDFSVKGVLDRFSFETVLH 261
           G       +         +                        F++            L 
Sbjct: 171 GLNFFKQNNGFTFGAFAPSGLASVTGGATPSMSVSANIPISSAFNLVVGSATRGLFADLS 230

Query: 262 ALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPT 321
            LE     R LA+PTL A+SGQSASF +GG+     V  S G  S+    YGV L  TPT
Sbjct: 231 ILEANNLARVLAQPTLVALSGQSASFLAGGEIPVP-VPQSLGTISIDWKPYGVGLTLTPT 289

Query: 322 VLSPGRIGLRIQTEVSEP----VIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDD 377
           VLSP RI L++  E S+      I +N   +P+   R+ADTTVEL  G + V+ GL+  +
Sbjct: 290 VLSPRRIALKVAPESSQLDFVHSITINGVTVPALTTRRADTTVELGDGESFVIGGLIDRE 349

Query: 378 IQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVE 437
                + +P L  +PI+G  F++  + + + E+ I  TP LV P+A    S P    +  
Sbjct: 350 TTSNVDKVPFLGDLPIIGTFFKHLSYQQNDKELVIIVTPHLVAPIAKNA-SLP----ATP 404

Query: 438 DDAKAFFFNRVNKIYGPKEASEVEGQNYK 466
            +        V + Y     S   G  + 
Sbjct: 405 GELSEQRDGPVWRSYLGGALSPDAGPGFS 433


>gi|171317113|ref|ZP_02906316.1| type II and III secretion system protein [Burkholderia ambifaria
           MEX-5]
 gi|171097747|gb|EDT42574.1| type II and III secretion system protein [Burkholderia ambifaria
           MEX-5]
          Length = 443

 Score =  237 bits (605), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 107/450 (23%), Positives = 169/450 (37%), Gaps = 45/450 (10%)

Query: 39  ISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRT---MYLFGKNVG 95
                      I + +     +     +Q V V DP  ADV++        + L  K  G
Sbjct: 16  TVASLASASGTIELAVGAQRQISAGRTLQRVAVGDPAVADVLIMKGSRSGSVLLTAKAPG 75

Query: 96  QANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQ 155
             NV+L      +     + +      ++   +  +  S  RV     T VL G   ++ 
Sbjct: 76  ATNVMLWARGRDEPTVWSVEV------VDAAAQAVLDGSTPRVNAYGGTAVLQGTAASLD 129

Query: 156 DSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGF 215
              RA  +               S+   V++   + G++ V + V + E  R +LKQ+GF
Sbjct: 130 AHARASAV-----------GKNMSAKGNVIDRSTVVGKNVVQVDVRVVEFSRSVLKQVGF 178

Query: 216 QHSITGSSSGPSKSFAADF---------------GGKFVSEGGDFSVKGVLDRFSFETVL 260
                 +                                     F++            L
Sbjct: 179 NFFKQSNGFSFGSFSPGGVQSYSGGAGPGTGGYVPTLGSPVASAFNLVVNAAGRGIFADL 238

Query: 261 HALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTP 320
             LE     R LAEPTL A+SGQSASF +GG+          G+T++    YGV L  TP
Sbjct: 239 SLLEANNLARVLAEPTLVALSGQSASFLAGGEIPVP-APQGLGSTAIQWKQYGVGLTLTP 297

Query: 321 TVLSPGRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKD 376
           TVL+P RI L++  E S+      + ++   +P    R+ADTTVEL  G + V+ GL+  
Sbjct: 298 TVLNPNRIALKVAPESSQLDFVNSVTISGVAVPGITTRRADTTVELGDGESFVIGGLIDR 357

Query: 377 DIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSV 436
                   +PLL  +PI+G  F+N  + + + E+ I  TP LV P+A   +         
Sbjct: 358 QTMSNVSKVPLLGDLPIIGTFFKNLSYQQNDKELLIIVTPHLVAPIAKGAVLPAT----- 412

Query: 437 EDDAKAFFFNRVNKIYGPKEASEVEGQNYK 466
             +        V + Y    AS      + 
Sbjct: 413 PGELSEQRDGPVWRSYLGGVASPDAAPGFS 442


>gi|167562915|ref|ZP_02355831.1| type II/III secretion system protein [Burkholderia oklahomensis
           EO147]
          Length = 432

 Score =  237 bits (604), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 110/449 (24%), Positives = 174/449 (38%), Gaps = 40/449 (8%)

Query: 36  VINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRT--MYLFGKN 93
           V+        +   I +       + V  +VQ V V DP  ADV+V       + L  K 
Sbjct: 5   VLLSFAARAAEMGTIELATGAQRQVSVGRNVQRVAVGDPNVADVLVVKGGRGSVLLVAKA 64

Query: 94  VGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRT 153
            G  ++++      +     + +    A      R  +   +  V+    T V+ G   T
Sbjct: 65  AGSTSLMVWERGRDEPAVYTVNVVSGAA------RALLDGGSPSVKAYGGTAVVSGSAAT 118

Query: 154 IQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQI 213
           +    RA+ L +    + G    A++   K +  +++             E  R +LKQ 
Sbjct: 119 LDAHARALALGKGMAGKDGGVVDASTVGGKNVVQVDVRVV----------EFSRSVLKQA 168

Query: 214 GFQHSITGSSSGPSKSFAADFGGKFVSEG------------GDFSVKGVLDRFSFETVLH 261
           G       +         +                        F++            L 
Sbjct: 169 GLNFFKQNNGFTFGAFAPSGLASVTGGATPSMSVSANIPISSAFNLVVGSATRGLFADLS 228

Query: 262 ALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPT 321
            LE     R LA+PTL A+SGQSASF +GG+     V  S G  S+    YGV L  TPT
Sbjct: 229 ILEANNLARVLAQPTLVALSGQSASFLAGGEIPVP-VPQSLGTISIDWKPYGVGLTLTPT 287

Query: 322 VLSPGRIGLRIQTEVSEP----VIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDD 377
           VLSP RI L++  E S+      I +N   +P+   R+ADTTVEL  G + V+ GL+  +
Sbjct: 288 VLSPRRIALKVAPESSQLDFVHSITINGVTVPALTTRRADTTVELGDGESFVIGGLIDRE 347

Query: 378 IQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVE 437
                + +P L  +PI+G  F++  + + + E+ I  TP LV P+A    S P    +  
Sbjct: 348 TTSNVDKVPFLGDLPIIGTFFKHLSYQQNDKELVIIVTPHLVAPIAKNA-SLP----ATP 402

Query: 438 DDAKAFFFNRVNKIYGPKEASEVEGQNYK 466
            +        V + Y     S   G  + 
Sbjct: 403 GELSEQRDGPVWRSYLGGALSPDAGPGFS 431


>gi|254245567|ref|ZP_04938888.1| Flp pilus assembly protein, secretin CpaC [Burkholderia cenocepacia
           PC184]
 gi|124870343|gb|EAY62059.1| Flp pilus assembly protein, secretin CpaC [Burkholderia cenocepacia
           PC184]
          Length = 443

 Score =  237 bits (604), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 107/445 (24%), Positives = 170/445 (38%), Gaps = 45/445 (10%)

Query: 44  IGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRT---MYLFGKNVGQANVI 100
                 I + +     +     +Q V V DP  ADV++        + L  K  G  NV+
Sbjct: 21  ASASATIELAVGAQRQISAGRTLQRVAVGDPAIADVLIMKGSRSGSVLLTAKAPGATNVM 80

Query: 101 LIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRA 160
           L      +    ++ +      ++   +  +  +  RV     T VL G   +++   RA
Sbjct: 81  LWERGRDEPTIWNVEV------VDAAAQAVLDGAAPRVNAYGGTAVLQGSAASLEAHSRA 134

Query: 161 VELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSIT 220
             + +    +             V++   + G+  V + V + E  R +LKQ+GF     
Sbjct: 135 AAVGKNMSGKGV-----------VIDRSTVPGKSVVQVDVRVVEFSRSVLKQVGFNFFKQ 183

Query: 221 GSSSGPSKSFAADF---------------GGKFVSEGGDFSVKGVLDRFSFETVLHALER 265
            +                                     F++            L  LE 
Sbjct: 184 SNGFSFGSFSPGGVQSYSGGSGPGTGGYVPTLGSPVASAFNLVVNAAGRGIFADLSLLEA 243

Query: 266 ATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSP 325
               R LAEPTL A+SGQSASF +GG+          G+T++    YGV L  TPTVLSP
Sbjct: 244 NNLARVLAEPTLVALSGQSASFLAGGEIPVP-SPQGLGSTAIQWKQYGVGLSLTPTVLSP 302

Query: 326 GRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQL 381
            RI L++  E S+      + ++   +P    R+ADTTVEL  G + V+ GL+       
Sbjct: 303 SRIALKVAPESSQLDFVNSVTISGVAVPGITTRRADTTVELGDGESFVIGGLIDRQTMSN 362

Query: 382 KEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAK 441
              +PLL  +PI+G  F+N  + + + E+ I  TP LV P+A   +           +  
Sbjct: 363 VSKVPLLGDLPIIGTFFKNLSYQQNDKELLIIVTPHLVAPIAKGAVLPAT-----PGELS 417

Query: 442 AFFFNRVNKIYGPKEASEVEGQNYK 466
                 V K Y    AS      + 
Sbjct: 418 EQRDGPVWKSYLGGAASPDAAPGFS 442


>gi|156975620|ref|YP_001446527.1| Flp pilus assembly protein secretin [Vibrio harveyi ATCC BAA-1116]
 gi|156527214|gb|ABU72300.1| hypothetical protein VIBHAR_03353 [Vibrio harveyi ATCC BAA-1116]
          Length = 449

 Score =  236 bits (603), Expect = 5e-60,   Method: Composition-based stats.
 Identities = 112/405 (27%), Positives = 187/405 (46%), Gaps = 47/405 (11%)

Query: 52  IGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLN 111
           I ++    ++V   +  V VSDP   D  V +  T+ +F K VGQA  I+ G   K +L+
Sbjct: 28  ITVSDGQHIEVKEPISTVFVSDPEIVDYNVVNENTVVVFAKEVGQARFIIYGKSKKVLLS 87

Query: 112 LDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQS 171
             I+++ D++ +   ++    + NI+VE V + V + G+V + Q       +  T L + 
Sbjct: 88  DRIIVDIDLSLVRRQIKLHYPELNIKVESVGNQVAVSGVVESEQQRDDIYRMVATLLGRD 147

Query: 172 GRNQYANSSS------------------------KKVMNLLNIAGEDQVTLKVTIAEVRR 207
              ++  +                          + ++ L+ +A + QV +K+++A+V  
Sbjct: 148 KTEKWEETQVLEFENEAYDIEEPQSMIFARNMTWEGILELIEVATDQQVNVKISVAQVTE 207

Query: 208 DILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERAT 267
              + +G   S  G+  G                     +    D     T++ AL    
Sbjct: 208 TFSQTVGVDWSSVGADVGEF-------------------LFQQFDAADLTTLITALGNEN 248

Query: 268 AIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGR 327
             + LAEP LT ISG+SASF  GG+        +    ++T  ++G+ L  T  VL  G+
Sbjct: 249 VAQVLAEPNLTVISGESASFLVGGEVPVIVT--TNNNINITFREFGIKLDLTAKVLHEGK 306

Query: 328 IGLRIQTEVSEPV--IGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGI 385
           I +R+  EVSE    I     ++P +  R+A TT+EL  G + VL GL+     +  + I
Sbjct: 307 IRMRLMPEVSEVERYIRSAGLEVPQFATRRAMTTIELGDGDSFVLGGLMSSADLEELKKI 366

Query: 386 PLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRP 430
           PLL  IP+LGA FR +  +R  TE+ I AT  LVKP+  +D+  P
Sbjct: 367 PLLGDIPVLGAAFRKASTDRRRTELIIVATVNLVKPMKKKDIQMP 411


>gi|115351456|ref|YP_773295.1| type II and III secretion system protein [Burkholderia ambifaria
           AMMD]
 gi|115281444|gb|ABI86961.1| type II and III secretion system protein [Burkholderia ambifaria
           AMMD]
          Length = 444

 Score =  236 bits (603), Expect = 5e-60,   Method: Composition-based stats.
 Identities = 102/447 (22%), Positives = 176/447 (39%), Gaps = 41/447 (9%)

Query: 39  ISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVH---SPRTMYLFGKNVG 95
           +     G    I + +     +     +Q + V DP   DV+V       ++ L  K  G
Sbjct: 19  VLTEAAGTNASIDLAVGSQRQVAAGRTLQRIAVGDPAVVDVLVMKGSHAGSVLLVAKAPG 78

Query: 96  QANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQ 155
             NV+L      +    ++        ++   +  +  S  +V+      VL G   ++ 
Sbjct: 79  STNVLLWERGRDEPTVWNV------NVVDAAAQAALDGSAPKVKGYGGAAVLSGSSASLD 132

Query: 156 DSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGF 215
             +RAV + +    + G    A++   + +  +++             E  R +LK+ G 
Sbjct: 133 AHERAVAVGKRMGGKDGTVIDASTVGNRSVVQVDVRVV----------EFSRSVLKEAGL 182

Query: 216 QHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVL------------DRFSFETVLHAL 263
                 +                      F+  G +                    +  L
Sbjct: 183 NFFKQSNGFAFGAFSPGGLQSVTGGATSAFAATGGIPIASAFNLVVNSAGRGIFGNISIL 242

Query: 264 ERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVL 323
           E     R LA+PTL A+SGQSASF +GG+     V  + G+T++    YGV L  TPTVL
Sbjct: 243 EANNLARVLAQPTLVALSGQSASFLAGGEIPVP-VPQALGSTAIDWKQYGVGLTLTPTVL 301

Query: 324 SPGRIGLRIQTEVSEPV----IGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQ 379
           S  RI L++  E S+      + +N+  +P+   R+ADTTVEL  G + V+ GL+  +  
Sbjct: 302 SQHRIALKVAPESSQLDFQHGVTINSVSVPAITTRRADTTVELGDGESFVIGGLIDRETM 361

Query: 380 QLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDD 439
                +P+L  +PI+GA F++  + + + E+ I  TP LV P+A      P    +   +
Sbjct: 362 SNISKVPVLGDLPIIGAFFKSLNYQQNDKELVIIVTPHLVAPIAKGA-PLP----ATPGE 416

Query: 440 AKAFFFNRVNKIYGPKEASEVEGQNYK 466
                   V + Y    AS      + 
Sbjct: 417 LSEQRDGPVWRSYLGGIASPDAAPGFS 443


>gi|83718419|ref|YP_443059.1| type II/III secretion system protein [Burkholderia thailandensis
           E264]
 gi|167582062|ref|ZP_02374936.1| type II/III secretion system protein [Burkholderia thailandensis
           TXDOH]
 gi|167620224|ref|ZP_02388855.1| type II/III secretion system protein [Burkholderia thailandensis
           Bt4]
 gi|257139289|ref|ZP_05587551.1| type II/III secretion system protein [Burkholderia thailandensis
           E264]
 gi|83652244|gb|ABC36307.1| type II/III secretion system protein [Burkholderia thailandensis
           E264]
          Length = 441

 Score =  236 bits (601), Expect = 7e-60,   Method: Composition-based stats.
 Identities = 112/449 (24%), Positives = 175/449 (38%), Gaps = 40/449 (8%)

Query: 36  VINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRT--MYLFGKN 93
           V+        +   I +       + V   VQ V + DP+ ADVVV       + L  K 
Sbjct: 14  VLLSFAARAAEMGTIELATGAQRQIAVGRGVQRVAIGDPSVADVVVIKGGRGGVLLVAKA 73

Query: 94  VGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRT 153
            G  N+++      +     + +    A      R  +   +  V+  + T V+ G   T
Sbjct: 74  AGSTNLMVWERGRDEPSVYTVNVASGAA------RALLDGGSPSVKAYNGTAVVSGSAAT 127

Query: 154 IQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQI 213
           +    RA+ + +    + G    A++   K +  +++             E  R +LKQ 
Sbjct: 128 LDAHARALAVGKGMAGKDGGVVDASTVGGKNVVQVDVRVV----------EFSRSVLKQA 177

Query: 214 GFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVL------------DRFSFETVLH 261
           G       +         A             SV   +                    L 
Sbjct: 178 GLNFFKQSNGFTFGSFAPAGLASVTGGGTSSMSVSANIPIASAFNLVVGSATRGLFADLS 237

Query: 262 ALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPT 321
            LE     R LA+PTL A+SGQSASF +GG+     V  S G  S+    YGV L  TPT
Sbjct: 238 ILEANNLARVLAQPTLVALSGQSASFLAGGEIPVP-VPQSLGTISIDWKPYGVGLTLTPT 296

Query: 322 VLSPGRIGLRIQTEVSEP----VIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDD 377
           VLSP RI L++  E S+      I +N   +P+   R+ADTTVEL  G + V+ GL+  +
Sbjct: 297 VLSPRRIALKVAPESSQLDFVHSITINGVTVPALTTRRADTTVELGDGESFVIGGLIDRE 356

Query: 378 IQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVE 437
                + +P L  +PI+G  F++  + + + E+ I  TP LV P+A    S P    +  
Sbjct: 357 TTSNVDKVPFLGDLPIIGTFFKHLSYQQNDKELVIIVTPHLVAPIAKNA-SLP----ATP 411

Query: 438 DDAKAFFFNRVNKIYGPKEASEVEGQNYK 466
            +        V + Y     S   G  + 
Sbjct: 412 GELSEQRDGPVWRSYLGGVLSPDAGPGFS 440


>gi|299069498|emb|CBJ40767.1| putative pilus assembly protein (cpaC) [Ralstonia solanacearum
           CMR15]
          Length = 467

 Score =  236 bits (601), Expect = 7e-60,   Method: Composition-based stats.
 Identities = 91/438 (20%), Positives = 171/438 (39%), Gaps = 40/438 (9%)

Query: 18  SSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKA 77
           ++              A         +  G+ + +       +++   ++ + + +P  A
Sbjct: 17  AAVVRGWMGALALGWVALAPAAHAQGMPAGQVLHLLSGSQREIRLGKPLERIAIGNPEVA 76

Query: 78  DVVVHSPR----TMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIAD 133
           D ++        ++ +  K  G AN+++    G  +     +                  
Sbjct: 77  DALLLKGHGAAGSLLIIAKKPGAANILVWTQGGTALTYNVQVDAEPRGA----------- 125

Query: 134 SNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGE 193
            +  + +   T VL G V+          L+    S +            +++   +A  
Sbjct: 126 GSPDLAVQGSTAVLTGQVKD------VYSLARARKSAAVAGGAEPPKGGNMIDNTTLAVP 179

Query: 194 DQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDR 253
             V + V + E  + +LK+ GF  + T           +      V+     +       
Sbjct: 180 GTVQVDVRVVEFSKTVLKEAGFIFTRTRGGFTFGSFSPSTLTQYTVTPTSLTTQSTTPIG 239

Query: 254 FSFETVLH-----------ALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSST 302
            +F  ++             +E     R LAEP+L A+SGQSA+F +GG+     V  + 
Sbjct: 240 TAFNLLISSFSKGIFADLSLIESNGLARVLAEPSLVALSGQSANFLAGGEIPIP-VPQAL 298

Query: 303 GATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPV----IGVNAGDMPSYRVRKADT 358
           G T++    +G+ L  +PT+LS  RI L++  E S+      + +N   +P+   R+ADT
Sbjct: 299 GTTTIEYKPFGIGLTVSPTILSENRIALKVAPEASDLDFSRGVTLNGATVPAIVTRRADT 358

Query: 359 TVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFL 418
           TVEL  G + V+ GL+        + +P L  +PI+G  F+   +N+EE E+ I  TP L
Sbjct: 359 TVELGDGESFVIGGLVSRTTLSNVDKVPFLGDVPIIGTFFKRLDYNQEERELVIIVTPRL 418

Query: 419 VKPVAMRDLSRPDDHYSV 436
           V+P+A      P D    
Sbjct: 419 VRPMARNA---PIDKMLP 433


>gi|170701752|ref|ZP_02892688.1| type II and III secretion system protein [Burkholderia ambifaria
           IOP40-10]
 gi|170133335|gb|EDT01727.1| type II and III secretion system protein [Burkholderia ambifaria
           IOP40-10]
          Length = 444

 Score =  235 bits (600), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 101/447 (22%), Positives = 176/447 (39%), Gaps = 41/447 (9%)

Query: 39  ISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVH---SPRTMYLFGKNVG 95
           +     G    I + +     +     +Q + V DP   DV+V       ++ L  K  G
Sbjct: 19  VLTEAAGTNASIDLAVGSQRQIAAGRTLQRIAVGDPAVVDVLVMKGSHAGSVLLVAKAPG 78

Query: 96  QANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQ 155
             NV+L      +    ++        ++   +  +  +  +V+      VL G   ++ 
Sbjct: 79  STNVLLWERGRDEPTVWNV------NVVDAAAQAALDGTGPKVKAYGGAAVLSGSSASLD 132

Query: 156 DSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGF 215
             +RAV + +    + G    A++   + +  +++             E  R +LK+ G 
Sbjct: 133 AHERAVAVGKRMGGKDGTVIDASTVGNRSVVQVDVRVV----------EFSRSVLKEAGL 182

Query: 216 QHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVL------------DRFSFETVLHAL 263
                 +                      F+  G +                    +  L
Sbjct: 183 NFFKQSNGFAFGAFSPGGLQSVTGGATSAFAATGGIPIASAFNLVVNSAGRGIFGNISIL 242

Query: 264 ERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVL 323
           E     R LA+PTL A+SGQSASF +GG+     V  + G+T++    YGV L  TPTVL
Sbjct: 243 EANNLARVLAQPTLVALSGQSASFLAGGEIPVP-VPQALGSTAIDWKQYGVGLTLTPTVL 301

Query: 324 SPGRIGLRIQTEVSEPV----IGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQ 379
           S  RI L++  E S+      + +N+  +P+   R+ADTTVEL  G + V+ GL+  +  
Sbjct: 302 SQRRIALKVAPESSQLDFQHGVTINSVSVPAITTRRADTTVELGDGESFVIGGLIDRETM 361

Query: 380 QLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDD 439
                +P+L  +PI+GA F++  + + + E+ I  TP LV P+A      P    +   +
Sbjct: 362 SNISKVPVLGDLPIIGAFFKSLNYQQNDKELVIIVTPHLVAPIAKGA-PLP----ATPGE 416

Query: 440 AKAFFFNRVNKIYGPKEASEVEGQNYK 466
                   V + Y    AS      + 
Sbjct: 417 LSEQRDGPVWRSYLGGIASPDAAPGFS 443


>gi|312882144|ref|ZP_07741893.1| pilus assembly protein CpaC [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309370190|gb|EFP97693.1| pilus assembly protein CpaC [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 456

 Score =  235 bits (600), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 105/437 (24%), Positives = 188/437 (43%), Gaps = 63/437 (14%)

Query: 51  SIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQML 110
           SI LN    +QV + +  V +S+P  AD  V +  T+ ++   VGQ+ +I+ G D   +L
Sbjct: 34  SITLNDGQHIQVNMPIGKVFISNPEVADYKVINENTLVVYANEVGQSRLIVYGTDSSVLL 93

Query: 111 NLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQ 170
           +  I+++ +++ +   L+    D  ++V+ +   V + G+V + +       L  T L +
Sbjct: 94  SDRIVVDLNLSEVRRQLKFHYPDVQVKVQSIGTQVAVSGVVDSEETRDDIYRLVATLLGR 153

Query: 171 SGRNQYANSSS------------------------KKVMNLLNIAGEDQVTLKVTIAEVR 206
               ++                             + ++  + +    QV +K++IA V 
Sbjct: 154 EKTEKWNQVEKLTFESENTRYEEPESMVFARNMTWEGIIERIKVTTTQQVNVKISIAHVT 213

Query: 207 RDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERA 266
               + +G      G+  G                     V    +  +  T++ AL   
Sbjct: 214 ESFGQTVGIDWGSIGARVGSF-------------------VFDQFNAANLGTIISALGND 254

Query: 267 TAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPG 326
              + LAEP LT +SG+SASF +GG+     +  +    +V+   +G+ L+ T  VLS  
Sbjct: 255 EIAQVLAEPNLTVLSGESASFLAGGEVPVIVL--NDRNLTVSFKQFGIGLNLTAKVLSRD 312

Query: 327 RIGLRIQTEVSEPVIGVN--AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEG 384
           +I +++   VSE    V      +P + +RKA TTVEL  G + +L GL+     +  + 
Sbjct: 313 KIQMQLAPSVSEVEGFVEFEGLKVPQFTLRKALTTVELSDGDSFILGGLMSSADFEEMQK 372

Query: 385 IPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRP-------------- 430
           +P++  IP+ GA FR ++  R+ TE+ I AT  LV+PV   D+  P              
Sbjct: 373 VPVIGDIPLFGAAFRKAKTERKRTELIIVATVNLVEPVRPNDIQVPYINKTSTLERWLNI 432

Query: 431 --DDHYSVEDDAKAFFF 445
             DD +    DA     
Sbjct: 433 NSDDSFQPSSDATIRLL 449


>gi|91783011|ref|YP_558217.1| putative outer membrane channel signal peptide protein, CpaC like
           [Burkholderia xenovorans LB400]
 gi|91686965|gb|ABE30165.1| Putative outer membrane channel signal peptide protein, CpaC like
           protein [Burkholderia xenovorans LB400]
          Length = 454

 Score =  235 bits (599), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 111/475 (23%), Positives = 191/475 (40%), Gaps = 41/475 (8%)

Query: 11  MMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVL 70
           M+++   +     A+     +A  A            ++I++ +     L V   +Q + 
Sbjct: 1   MLAVSAATDAAGPAQRGQAAQAAQAAQAAQPTLAAPAQRIALTVGAQQQLAVGHTLQRIA 60

Query: 71  VSDPTKADVVVHSPRT---MYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTL 127
           + DP+ ADV++        + L GK  G  N++L   D    L   + +    A      
Sbjct: 61  IGDPSVADVLIIKGDKRGGVLLVGKAAGTTNLMLWARDRDAPLQYTVDVTTPAAA----- 115

Query: 128 RRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNL 187
              +      V+++  T V+ G   T++  QRAV  +E  L + G     ++ + + +  
Sbjct: 116 -SLLGPDTPAVKVLGGTAVVSGTSATMEAHQRAVVAAEGSLGKDGAVFDTSTVASRAVVQ 174

Query: 188 LNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEG----- 242
           +++             E  R +LK++GF      +         +       + G     
Sbjct: 175 VDVRVV----------EFSRSVLKEVGFNFFKQNNGFTFGSFAPSALSSVSATAGQAPSM 224

Query: 243 -------GDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLY 295
                    F++            L  LE     R LAEPTL A+SGQSASF +GG+   
Sbjct: 225 TGVTPISSAFNLIFNSATHGLFANLSLLESNNLARVLAEPTLVALSGQSASFLAGGEVPI 284

Query: 296 KTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPV----IGVNAGDMPSY 351
             V  + G TS+    YG+ L  TPTVLSP RI L++  E S+      + ++   +P++
Sbjct: 285 P-VPQALGTTSIEFKPYGIGLTLTPTVLSPQRIALKVAPEASQLDFANAVTISGVSVPAF 343

Query: 352 RVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIF 411
             R+ADTTVEL  G + V+ GL+  +       +PLL  +P++G  F+   + + E E+ 
Sbjct: 344 ITRRADTTVELGDGESFVIGGLIDRETASNVSKVPLLGDLPVIGTFFKQLNYQQNEKELV 403

Query: 412 IAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYK 466
           I  TP LV P+A               +        V +      A+      + 
Sbjct: 404 IIVTPHLVSPLAKGATLPST-----PGEQSEQRNGPVWRSLIGGVAARDSAPGFS 453


>gi|332284569|ref|YP_004416480.1| putative outer membrane protein [Pusillimonas sp. T7-7]
 gi|330428522|gb|AEC19856.1| putative outer membrane protein [Pusillimonas sp. T7-7]
          Length = 474

 Score =  234 bits (596), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 109/470 (23%), Positives = 189/470 (40%), Gaps = 45/470 (9%)

Query: 15  FLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDP 74
            L      +A+      +  A+             +++ + +V +L +P DV  V V D 
Sbjct: 6   ILLGCLLMMAQHSGAAPSQEAM-------------LNLQVGEVKVLGIP-DVARVAVGDG 51

Query: 75  TKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIAD- 133
              + V    + + +F ++ G   + +   DG++      +    +  ++  LR  +   
Sbjct: 52  HIINAVATDEKEVIVFARHEGSTALQIWSADGQRWQYQIEVAPEGLRQIQQELRSVLERI 111

Query: 134 SNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGE 193
            + ++  V D +V+ G   +  D +R  EL++ +                      +  +
Sbjct: 112 PHAQLSAVGDKLVIEGDDLSDGDRERIAELAKHYPQLLDFTG-------------QVGWD 158

Query: 194 DQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGG-----------KFVSEG 242
             V L V + EV R  L+++G + +   +  G S   A D G              +   
Sbjct: 159 RMVLLDVQVVEVPRIQLQELGLRWNT-ATDGGLSAGLAWDGGSKRLDDRPSESVMPIGFP 217

Query: 243 GDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSST 302
              +             ++A+ +      LA+P L A SG +A F +GG+  Y TV  + 
Sbjct: 218 ATMAAGYFGVNALLSARINAMAQKGTAVVLAQPQLLARSGSTAEFLAGGEVPYSTV-DAN 276

Query: 303 GATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGDMPSYRVRKADTTVEL 362
           G T+     YGV L  TP +   G +  RI+ EVS     ++  + PS + R+A T   +
Sbjct: 277 GNTNTAFKPYGVSLRITPQIERNGAVRSRIEVEVSSVDNALSVPNGPSLKTRRAATEFNV 336

Query: 363 PSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLV--- 419
            SG T+VLAG L  +     + +P L  IPILG LF++SRF R ETE+ I  TP LV   
Sbjct: 337 RSGQTLVLAGFLSREATHNVDKVPGLGDIPILGELFKSSRFQRHETELAIFVTPVLVGAD 396

Query: 420 KPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGP-KEASEVEGQNYKGA 468
            P   R +   +D               +  +  P   A +V    ++G 
Sbjct: 397 HPGLARRVQLGEDILKTAFPQAPIINASLAPLPKPLVAADQVSWDPWQGP 446


>gi|152989020|ref|YP_001350207.1| putative type II secretion system protein [Pseudomonas aeruginosa
           PA7]
 gi|150964178|gb|ABR86203.1| probable type II secretion system protein [Pseudomonas aeruginosa
           PA7]
          Length = 408

 Score =  234 bits (596), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 92/434 (21%), Positives = 170/434 (39%), Gaps = 71/434 (16%)

Query: 31  EANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLF 90
           +  +A+       + +  ++S+   +   L++ V ++ + + DP  ADV +    ++ + 
Sbjct: 15  QPASALPQGCLELLAQAPQVSVAQGQQNDLRLAVPIKRLAIGDPQIADVQLLDRSSLLVT 74

Query: 91  GKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGM 150
           GK  G  ++++      + L   + +E                               G 
Sbjct: 75  GKEQGSTSLLIWTACSAEPLRSQVAVEG-----------------------------RGS 105

Query: 151 VRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDIL 210
           V T          ++                            +QV   +   EV R  L
Sbjct: 106 VDTAAAPALGAGGADEL-------------------------PNQVQTDIRFVEVSRSKL 140

Query: 211 KQIGFQHSITGSSSGPSKSFAA---------DFGGKFVSEGGDFSVKGVLDRFSFETVLH 261
           KQ        G +     +  +           G       G      +     + + ++
Sbjct: 141 KQASTSFVRRGGNLWVLGAPGSLGDIKVNADGSGLGGTFGAGASGFNLIFGGGKWLSFMN 200

Query: 262 ALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPT 321
           ALE +    TLA P+L A+SGQSASF +GG+      + +    ++   ++G+ L  TPT
Sbjct: 201 ALEGSGFAYTLARPSLVAMSGQSASFLAGGEFPIPVPNGTNDNVTIEYKEFGIRLTLTPT 260

Query: 322 VLSPGRIGLRIQTEVSEPV----IGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDD 377
           V++  RI L++  EVSE      I      +P+ RVR+ DT+V L  G + V++GL   +
Sbjct: 261 VMNNRRIALKVAPEVSELDYSAGIQSGGVAVPALRVRRTDTSVMLADGESFVISGLTSSN 320

Query: 378 IQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLS--RPDDHYS 435
                +  P L  IPILGA FR+++ ++++ E+ +  TP LV+P+A        P +   
Sbjct: 321 SVSNVDKFPWLGDIPILGAFFRSTKLDKDDRELLMIVTPHLVQPLAADAQLPGLPGEGLR 380

Query: 436 --VEDDAKAFFFNR 447
                 ++ +F  R
Sbjct: 381 HYDPGFSRLYFLER 394


>gi|149173675|ref|ZP_01852304.1| probable type II secretion system protein [Planctomyces maris DSM
           8797]
 gi|148847205|gb|EDL61539.1| probable type II secretion system protein [Planctomyces maris DSM
           8797]
          Length = 744

 Score =  233 bits (595), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 105/477 (22%), Positives = 195/477 (40%), Gaps = 52/477 (10%)

Query: 35  AVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNV 94
            +        G   ++ I + +  ++     ++   ++DP+  + V +SP  + + G  +
Sbjct: 134 PLPTQIRSTPGIFDEMEIIIRRSQLIITNSRIRRYAIADPSIIEFVTYSPTEISIVGLEL 193

Query: 95  GQANVILIGHDGKQMLNLDILIERDIA----------HLEMTLRRFIADSNIRVEMVSDT 144
           G   + L        +   +   +D +           LE  +     +S + +  +S  
Sbjct: 194 GTTTLTLWFEGDDTPITYLVHTIQDPSLEGQRRIDYGKLERKIAVLFPNSKVYLIPLSRK 253

Query: 145 VVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANS------------------------- 179
           +++ G      ++   + +    +     N                              
Sbjct: 254 IIVKGEASDATEAANILSVIRGEVINYEGNLGGPQPYGAGGAYGGGYGAAGGVLDGIGNN 313

Query: 180 --SSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGK 237
             +S  ++N+L I GE QV + VTIA++ R +++Q+G   S+     G  +   +  GG 
Sbjct: 314 GYASSFIVNMLEIPGEFQVMIHVTIAQMNRTMMRQLGVDLSVLFD--GGRQFLGSSMGGV 371

Query: 238 FVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQH--LY 295
             +      + G+ +      +++AL +    + +A PTLT +SG SASF +GG+     
Sbjct: 372 PST------LTGIFEAGEVNVLINALAQNGTTKIMARPTLTVLSGHSASFLAGGEFAVPT 425

Query: 296 KTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGDMPSYRVRK 355
                    TS T   +G  +  TP V+    I +RI  E S+   G +   +P    R+
Sbjct: 426 IVGVGGAQGTSTTFRGFGTSIVVTPIVIDKDLIRMRIVPEYSQINDGNSVQGIPGLNSRR 485

Query: 356 ADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILG-ALFRNSRFNREETEIFIAA 414
           A TTVEL  G TIVLAGL   D       IP L +IP++G  LF + + ++ E+E+ I  
Sbjct: 486 AQTTVELREGQTIVLAGLFGHDSSTGVTRIPWLGEIPLVGSYLFSSKQSSQGESELLITV 545

Query: 415 TPFLVKPVAMRDL-SRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIG 470
           TP LV+P+   ++   P    +V  D + +   +     G  + +  + Q Y    G
Sbjct: 546 TPQLVRPMEEDEVPPYPGFEVTVPQDKELY---KYAMTEGAPDTAVYQLQPYGRGAG 599


>gi|293606490|ref|ZP_06688848.1| roadblock/LC7 domain protein [Achromobacter piechaudii ATCC 43553]
 gi|292815113|gb|EFF74236.1| roadblock/LC7 domain protein [Achromobacter piechaudii ATCC 43553]
          Length = 458

 Score =  233 bits (594), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 107/479 (22%), Positives = 188/479 (39%), Gaps = 41/479 (8%)

Query: 4   LQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVP 63
           ++R   T M   L ++      +  + +  A   N         + I++ +     L + 
Sbjct: 1   MKRYQRTTMICVLSAAVAMTYGVVSLAQTTAPGAN------AAARDIAVAVKGQQSLMLD 54

Query: 64  VDV-QDVLVSDPTKADVVVH-----SPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIE 117
                 + + DP  ADV +         ++ L+GK  G   + +   +       ++ + 
Sbjct: 55  GAAPSRIAIGDPEVADVKILPASGKRAGSLLLYGKKAGTTQLQIWTGNNPTPQIWNVRV- 113

Query: 118 RDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYA 177
                ++  L          V++  D  VL G   T      A + +   +        +
Sbjct: 114 --AGSVQAALASRGIQGGPNVDIAGDKAVLSGNAETPLAQIAAAQAAAAAVGDKNVVDVS 171

Query: 178 NSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGK 237
            + +  V+ +     E             R ++KQ G   + +      + + A    G 
Sbjct: 172 TAGAGGVVQVEVKVVEV-----------SRSVMKQAGINFAASNGPWAGTSATAPSGLGA 220

Query: 238 FVSEGGDFSVKGVL----DRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQH 293
            +       +        D  +F   L  L+     R LAEPTL A++GQSASF +GG+ 
Sbjct: 221 PLGFTPGGIIASGFSLFYDSNNFSARLRLLQSNGMARVLAEPTLVALTGQSASFLAGGEL 280

Query: 294 LYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE---------PVIGVN 344
                    G T+VT   +G+ L  TPTVLS  RI L++  E SE               
Sbjct: 281 PIPEA-GGLGTTTVTFKPFGIGLTVTPTVLSRDRISLKVAPEASELDYSNGIAINTSADT 339

Query: 345 AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFN 404
           +  +P+ R R+ADTTVEL  G + V++GL+    + +   +P+L  +PI+GA FR+  ++
Sbjct: 340 STIIPALRTRRADTTVELGDGESFVISGLVSRQTKAMVNKVPMLGDLPIIGAFFRSVDYS 399

Query: 405 REETEIFIAATPFLVKPVAMR-DLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEG 462
           +E+TE+ I  TP LV+P+A    L  P       D     +   +    G ++      
Sbjct: 400 QEDTELVIVVTPRLVRPIARGVTLPLPGGRQEAADSTFNAWGYYLMGPVGGQQMPGFSR 458


>gi|167911136|ref|ZP_02498227.1| type II/III secretion system protein [Burkholderia pseudomallei
           112]
          Length = 432

 Score =  233 bits (593), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 109/449 (24%), Positives = 174/449 (38%), Gaps = 40/449 (8%)

Query: 36  VINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRT--MYLFGKN 93
           V+        +   I +       + V   VQ V ++DP  ADV+V       + L  K 
Sbjct: 5   VLLSFAARAAETGTIELAAGTQRQIAVGHGVQRVAIADPNVADVLVIKGGRGGVLLVAKA 64

Query: 94  VGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRT 153
            G  ++++      +     + +    A      R  +   +  V+  + T V+ G   T
Sbjct: 65  AGTTSLMVWERGRDEPAAYTVNVVSGAA------RALLDGGSPSVKAYNGTAVVAGSAAT 118

Query: 154 IQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQI 213
           +    RA+ + +    + G     ++   K +  +++             E  R +LKQ 
Sbjct: 119 LDAHARALAVGKGMAGKDGGVLDVSTVGGKNVVQVDVRVV----------EFSRSVLKQA 168

Query: 214 GFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVL------------DRFSFETVLH 261
           G       +         A             SV   +                    L 
Sbjct: 169 GLNFFKQNNGFTFGSFAPAGLASVTGGGTSSMSVSANIPIASAFNLVVGSATRGLFADLS 228

Query: 262 ALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPT 321
            LE     R LA+PTL A+SGQSASF +GG+     V  S G  S+    YGV L  TPT
Sbjct: 229 ILEANNLARVLAQPTLVALSGQSASFLAGGEIPVP-VPQSLGTISIDWKPYGVGLTLTPT 287

Query: 322 VLSPGRIGLRIQTEVSEP----VIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDD 377
           VLSP RI L++  E S+      I +N   +P+   R+ADTTVEL  G + V+ GL+  +
Sbjct: 288 VLSPRRIALKVAPESSQLDFVHSITINGVTVPALTTRRADTTVELGDGESFVIGGLIDRE 347

Query: 378 IQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVE 437
                + +P L  +PI+G  F++  + + + E+ I  TP LV P+A    S P    +  
Sbjct: 348 TTSNVDKVPFLGDLPIIGTFFKHLSYQQNDKELVIIVTPHLVAPIAKNA-SLP----ATP 402

Query: 438 DDAKAFFFNRVNKIYGPKEASEVEGQNYK 466
            +        V + Y     S   G  + 
Sbjct: 403 GELSEQRDGPVWRSYLGGVLSPDAGPGFS 431


>gi|78486068|ref|YP_391993.1| type II and III secretion system protein [Thiomicrospira crunogena
           XCL-2]
 gi|78364354|gb|ABB42319.1| Flp (type IV) pilus assembly protein CpaC homolog [Thiomicrospira
           crunogena XCL-2]
          Length = 520

 Score =  233 bits (593), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 98/475 (20%), Positives = 200/475 (42%), Gaps = 69/475 (14%)

Query: 56  KVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHD--GKQMLNLD 113
           +  I++    ++  LV++P  A++ V + + + + GK  G+  +I+       +   ++ 
Sbjct: 37  ESQIVKFDYPIKRALVANPDLANLKVLNSKELLVSGKQAGKTELIIWYKKAPNQVGRHIV 96

Query: 114 ILIERDIA-------HLEMTLRRFIADSNI-----------------RVEMVSDTVVLHG 149
           + +  D +        +   +R+   D  +                  ++ V + +    
Sbjct: 97  LKVAPDASRREEIEQTVSTLIRQLDPDKKVKFVLKNIWIESNSSVRRELDNVGNQIDNDS 156

Query: 150 MVRTIQDSQR-------------AVELSETFLSQSGRNQYANSSSKK-----------VM 185
            +++  +  +                ++  ++          +  K+           V+
Sbjct: 157 TIKSKGNKNQDILQETQKAGSLNIKPVAGNYMVLLTGEVPNKARKKRIQSVISALGLSVV 216

Query: 186 NLLNIAGEDQVTLKVTIAEVRRDILKQIGF-------QHSITGSSSGPSKSFAADFGGKF 238
           N++++ G+ Q+ L V +AEV +    + G        +  I    +  +++  +      
Sbjct: 217 NMIDVTGKSQIKLSVRVAEVVKGNPFKSGVAIRDKKDRFGIFPPGNLGTQALFSLNNSPG 276

Query: 239 VSEGGDFS------VKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQ 292
            + G  F       +    +  S   VL  LE     R LA+P L   SG++A+F  GG+
Sbjct: 277 DTAGISFPHPDAFQIGFNPENGSIFGVLSLLEGHNLARVLAKPELIVQSGETATFLVGGE 336

Query: 293 HLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGD----M 348
                  ++   T V+  +YGV L F+P V   G I + ++ EVS+             +
Sbjct: 337 VAIPVAQNADTIT-VSYKEYGVRLRFSPIVTESGDIQMTVEPEVSDIDAANGTQTNNIII 395

Query: 349 PSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREET 408
           PS+R RK  TT+ L  G + ++ GLL+D+I+     +P+L  IPILGALFR++ +  +++
Sbjct: 396 PSFRSRKTSTTITLAPGQSFIIGGLLQDNIRSQVSKVPVLGDIPILGALFRSNSYVHDKS 455

Query: 409 EIFIAATPFLVKPVAM-RDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEG 462
           E+ I  TP  V PV   + +S P ++     +  AFF  +V ++    E++  E 
Sbjct: 456 ELAIMVTPTFVAPVDAGKKVSLPGENLKRPSNMDAFFLGKVAEVLPEGESALPES 510


>gi|53719509|ref|YP_108495.1| putative exported fimbriae assembly protein [Burkholderia
           pseudomallei K96243]
 gi|76808601|ref|YP_333341.1| type II/III secretion system protein [Burkholderia pseudomallei
           1710b]
 gi|121598954|ref|YP_993098.1| type II/III secretion system protein [Burkholderia mallei SAVP1]
 gi|124383520|ref|YP_001026125.1| type II/III secretion system protein [Burkholderia mallei NCTC
           10229]
 gi|126440403|ref|YP_001058807.1| type II/III secretion system protein [Burkholderia pseudomallei
           668]
 gi|134282202|ref|ZP_01768907.1| type II/III secretion system protein [Burkholderia pseudomallei
           305]
 gi|167002482|ref|ZP_02268272.1| type II/III secretion system protein [Burkholderia mallei PRL-20]
 gi|167719788|ref|ZP_02403024.1| type II/III secretion system protein [Burkholderia pseudomallei
           DM98]
 gi|167738786|ref|ZP_02411560.1| type II/III secretion system protein [Burkholderia pseudomallei 14]
 gi|167816009|ref|ZP_02447689.1| type II/III secretion system protein [Burkholderia pseudomallei 91]
 gi|167845916|ref|ZP_02471424.1| type II/III secretion system protein [Burkholderia pseudomallei
           B7210]
 gi|167894492|ref|ZP_02481894.1| type II/III secretion system protein [Burkholderia pseudomallei
           7894]
 gi|167902899|ref|ZP_02490104.1| type II/III secretion system protein [Burkholderia pseudomallei
           NCTC 13177]
 gi|237812067|ref|YP_002896518.1| bacterial type II/III secretion system protein [Burkholderia
           pseudomallei MSHR346]
 gi|238562618|ref|ZP_00440075.2| bacterial type II/III secretion system protein [Burkholderia mallei
           GB8 horse 4]
 gi|242315526|ref|ZP_04814542.1| type II/III secretion system protein [Burkholderia pseudomallei
           1106b]
 gi|254177827|ref|ZP_04884482.1| type II/III secretion system protein [Burkholderia mallei ATCC
           10399]
 gi|254179957|ref|ZP_04886556.1| type II/III secretion system protein [Burkholderia pseudomallei
           1655]
 gi|254188633|ref|ZP_04895144.1| type II/III secretion system protein [Burkholderia pseudomallei
           Pasteur 52237]
 gi|254198005|ref|ZP_04904427.1| type II/III secretion system protein [Burkholderia pseudomallei
           S13]
 gi|254260610|ref|ZP_04951664.1| type II/III secretion system protein [Burkholderia pseudomallei
           1710a]
 gi|254358355|ref|ZP_04974628.1| type II/III secretion system protein [Burkholderia mallei
           2002721280]
 gi|52209923|emb|CAH35895.1| putative exported fimbriae assembly protein [Burkholderia
           pseudomallei K96243]
 gi|76578054|gb|ABA47529.1| type II/III secretion system protein [Burkholderia pseudomallei
           1710b]
 gi|121227764|gb|ABM50282.1| type II/III secretion system protein [Burkholderia mallei SAVP1]
 gi|124291540|gb|ABN00809.1| type II/III secretion system protein [Burkholderia mallei NCTC
           10229]
 gi|126219896|gb|ABN83402.1| type II/III secretion system protein [Burkholderia pseudomallei
           668]
 gi|134246240|gb|EBA46329.1| type II/III secretion system protein [Burkholderia pseudomallei
           305]
 gi|148027482|gb|EDK85503.1| type II/III secretion system protein [Burkholderia mallei
           2002721280]
 gi|157936312|gb|EDO91982.1| type II/III secretion system protein [Burkholderia pseudomallei
           Pasteur 52237]
 gi|160698866|gb|EDP88836.1| type II/III secretion system protein [Burkholderia mallei ATCC
           10399]
 gi|169654746|gb|EDS87439.1| type II/III secretion system protein [Burkholderia pseudomallei
           S13]
 gi|184210497|gb|EDU07540.1| type II/III secretion system protein [Burkholderia pseudomallei
           1655]
 gi|237503987|gb|ACQ96305.1| bacterial type II/III secretion system protein [Burkholderia
           pseudomallei MSHR346]
 gi|238522203|gb|EEP85649.1| bacterial type II/III secretion system protein [Burkholderia mallei
           GB8 horse 4]
 gi|242138765|gb|EES25167.1| type II/III secretion system protein [Burkholderia pseudomallei
           1106b]
 gi|243061822|gb|EES44008.1| type II/III secretion system protein [Burkholderia mallei PRL-20]
 gi|254219299|gb|EET08683.1| type II/III secretion system protein [Burkholderia pseudomallei
           1710a]
          Length = 441

 Score =  233 bits (593), Expect = 7e-59,   Method: Composition-based stats.
 Identities = 108/449 (24%), Positives = 173/449 (38%), Gaps = 40/449 (8%)

Query: 36  VINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRT--MYLFGKN 93
           V+        +   I +       + V   VQ V ++DP  ADV+V       + L  K 
Sbjct: 14  VLLSFAARAAETGTIELAAGTQRQIAVGHGVQRVAIADPNVADVLVIKGGRGGVLLVAKA 73

Query: 94  VGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRT 153
            G  ++++      +     + +    A      R  +   +  V+  + T V+ G   T
Sbjct: 74  AGTTSLMVWERGRDEPAAYTVNVVSGAA------RALLDGGSPSVKAYNGTAVVAGSAAT 127

Query: 154 IQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQI 213
           +    RA+ + +    + G     ++   K +  +++             E  R +LKQ 
Sbjct: 128 LDAHARALAVGKGMAGKDGGVLDVSTVGGKNVVQVDVRVV----------EFSRSVLKQA 177

Query: 214 GFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVL------------DRFSFETVLH 261
           G       +         A             SV   +                    L 
Sbjct: 178 GLNFFKQNNGFTFGSFAPAGLASVTGGGTSSMSVSANIPIASAFNLVVGSATRGLFADLS 237

Query: 262 ALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPT 321
            LE     R LA+PTL A+SGQSASF +GG+     V  S G  S+    YGV L  TPT
Sbjct: 238 ILEANNLARVLAQPTLVALSGQSASFLAGGEIPVP-VPQSLGTISIDWKPYGVGLTLTPT 296

Query: 322 VLSPGRIGLRIQTEVSEP----VIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDD 377
           VLSP RI L++  E S+      I +N   +P+   R+ADTTVEL  G +  + GL+  +
Sbjct: 297 VLSPRRIALKVAPESSQLDFVHSITINGVTVPALTTRRADTTVELGDGESFAIGGLIDRE 356

Query: 378 IQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVE 437
                + +P L  +PI+G  F++  + + + E+ I  TP LV P+A    S P    +  
Sbjct: 357 TTSNVDKVPFLGDLPIIGTFFKHLSYQQNDKELVIIVTPHLVAPIAKNA-SLP----ATP 411

Query: 438 DDAKAFFFNRVNKIYGPKEASEVEGQNYK 466
            +        V + Y     S   G  + 
Sbjct: 412 GELSEQRDGPVWRSYLGGVLSPDAGPGFS 440


>gi|307726635|ref|YP_003909848.1| type II and III secretion system protein [Burkholderia sp.
           CCGE1003]
 gi|307587160|gb|ADN60557.1| type II and III secretion system protein [Burkholderia sp.
           CCGE1003]
          Length = 642

 Score =  232 bits (592), Expect = 8e-59,   Method: Composition-based stats.
 Identities = 93/467 (19%), Positives = 182/467 (38%), Gaps = 28/467 (5%)

Query: 1   MRYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIIL 60
           +R  +R   +++   L           P+  A +     +D      + + +   +V IL
Sbjct: 8   VRLRRRVLPSVLVGVLLCEA------APLTLAQSIYSPAADDASAASRVLEMFRGEVRIL 61

Query: 61  QVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDI 120
            VP  ++ + + +       V     + L G+  G  ++++    G  +     + + ++
Sbjct: 62  HVPGTIKRIAIGNGKLITANVVDGN-LMLLGEQDGMTSLVVWNEKGIALQTTVRIAKSEV 120

Query: 121 AHLEMTLRRFIAD-SNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANS 179
                 LR  +   S +R++ +   +VL G++      +  V + ++            +
Sbjct: 121 NASLQQLRAVLKSVSGLRIDAIGSNIVLSGVI-----HRDMVAVVKSATQDMKNVVDTTT 175

Query: 180 SSKKVMNLLNIAGEDQV