RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddA 
           21,609 sequences; 6,263,737 total letters

Searching..................................................done

Query= gi|254780727|ref|YP_003065140.1| putative pilus assembly
protein [Candidatus Liberibacter asiaticus str. psy62]
         (474 letters)



>gnl|CDD|34571 COG4964, CpaC, Flp pilus assembly protein, secretin CpaC
           [Intracellular trafficking and secretion].
          Length = 455

 Score =  335 bits (860), Expect = 2e-92
 Identities = 179/461 (38%), Positives = 254/461 (55%), Gaps = 19/461 (4%)

Query: 22  SVAKLPPIKEANA-AVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVV 80
           SV +  P+  A A AV  I+       K + + L K   + +P D  D+LV DP  AD V
Sbjct: 6   SVYRTLPMASAAAPAVARIALSSASATKTLKLELGKSKTVVLPSDADDILVGDPNIADAV 65

Query: 81  VHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEM 140
           + + R++Y+ GK+VG  NV + G +G+ +++LDI + RD + L   +R  I DS I+V  
Sbjct: 66  LLTDRSIYILGKSVGTTNVFVFGEEGRSIVSLDIEVTRDTSGLGAPIRAVIPDSRIKVSS 125

Query: 141 VSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKV 200
           V+D VVL G VRT  D++ AV ++  FL             +   +L+ +AG  QV LKV
Sbjct: 126 VNDRVVLSGSVRTAVDAESAVRIASQFLG----------GGEVTNSLITVAGSQQVQLKV 175

Query: 201 TIAEVRRDILKQIGFQHSITGSSSGPSKSFAA---DFGGKFVSEGGDFSVKGVLDRFSFE 257
            + EV R +LKQ+G   S  G  SG   SF A      G  + +G  F      +  S +
Sbjct: 176 RVVEVSRSVLKQLGANLSARGGFSGGPVSFGALAVLGTGLGLEKGTTFGSLLSDNGVSID 235

Query: 258 TVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLH 317
             ++ALE     RTLAEP LTA+SG++ASF +GG+          G  ++   ++GV L 
Sbjct: 236 AYINALEANGLARTLAEPNLTALSGETASFLAGGEFPIPVPDDKNGNVTIEYKEFGVGLT 295

Query: 318 FTPTVLSPGRIGLRIQTEVSEPVIG----VNAGDMPSYRVRKADTTVELPSGGTIVLAGL 373
           FTPTVLS GRI L++  EVSE        V  G +P    R+ADTTVEL SG + V+ GL
Sbjct: 296 FTPTVLSNGRISLKVAPEVSELDYSGSVAVGGGTVPGLTTRRADTTVELASGQSFVIGGL 355

Query: 374 LKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDH 433
           L+ +++   + +P L  IPILGALFR+  F R ETE+ I  TP+LVKPVA   L  P D 
Sbjct: 356 LQSNVRGAVDKVPGLGDIPILGALFRSKDFQRNETELVIIVTPYLVKPVAPGQLPAPPDD 415

Query: 434 YSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
           ++   D   +F   VN++YG   A + +   Y GA+GF+ K
Sbjct: 416 FTPASDPALYFLGNVNRVYG-FPAGQTDAARYGGAVGFVIK 455


>gnl|CDD|144009 pfam00263, Secretin, Bacterial type II and III secretion system
           protein. 
          Length = 164

 Score =  144 bits (365), Expect = 6e-35
 Identities = 59/164 (35%), Positives = 89/164 (54%), Gaps = 5/164 (3%)

Query: 262 ALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTT---HDYGVVLHF 318
           ALE+    + L+ P+L  ++ Q AS   G +  Y T S+S   T+       D G+ L  
Sbjct: 1   ALEQNGNAKVLSSPSLLTLNNQEASILVGQEVPYPTSSTSGNGTTTVEIKYIDAGLSLEV 60

Query: 319 TPTVLSPGRIGLRIQTEVSEPV--IGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKD 376
           TP V   G I L I  EVS       V  G +P+   R+  TTV +  G T+VL GL+++
Sbjct: 61  TPRVTDDGTITLEINPEVSSLDGSNAVTGGGVPTINTREVTTTVRVRDGQTLVLGGLIQE 120

Query: 377 DIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVK 420
           +  +    +PLL  IP+LGALFR++  ++E+TE+ I  TP +V+
Sbjct: 121 EDSESVSKVPLLGDIPLLGALFRSTSKSKEKTELLIFITPRIVR 164


>gnl|CDD|31639 COG1450, PulD, Type II secretory pathway, component PulD [Cell
           motility and secretion / Intracellular trafficking and
           secretion].
          Length = 587

 Score =  120 bits (302), Expect = 8e-28
 Identities = 59/242 (24%), Positives = 107/242 (44%), Gaps = 11/242 (4%)

Query: 194 DQVTLKVTIAEVRRDILKQIGFQHSITGSSSG----PSKSFAADFGGKFVSEGGDFSVKG 249
            QV ++ +I EV  + L+Q+G   S   S  G     + S            G    +  
Sbjct: 311 KQVEIEASIVEVSLNDLEQLGVNWSALNSGGGKVGNTNSSLGNAGLSGGALAGLVSGINT 370

Query: 250 VLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQH----LYKTVSSSTGAT 305
              + +F+ +++AL +      L+ P+L  ++ Q A    G          T  +     
Sbjct: 371 GAGKSNFDALINALSQNGDANVLSTPSLLTLNNQQAIIDVGQDVPQTGTSYTKVTGEKTA 430

Query: 306 SVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPV---IGVNAGDMPSYRVRKADTTVEL 362
           ++   D GV+L  TP +   GR+ L I+ EVS         +   +P+   R+  T V +
Sbjct: 431 TLERIDVGVMLKVTPRINDDGRVLLDIEQEVSSVATSDSVTSNDPLPTTNKREITTEVRV 490

Query: 363 PSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPV 422
             G +++L GL++D        +P L  IP++G+LFR++   R++TE+    TP +++  
Sbjct: 491 KDGDSLLLGGLIQDKQSDSVSKVPFLGDIPLIGSLFRSTSKTRKKTELMFFITPRIIRSP 550

Query: 423 AM 424
           A 
Sbjct: 551 AE 552


>gnl|CDD|34405 COG4796, HofQ, Type II secretory pathway, component HofQ
           [Intracellular trafficking and secretion].
          Length = 709

 Score = 80.1 bits (197), Expect = 1e-15
 Identities = 52/173 (30%), Positives = 84/173 (48%), Gaps = 4/173 (2%)

Query: 253 RFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGA--TSVTTH 310
               +  L ALE+    + LA P L   +G+ AS   G +  Y+  S   G   TSV   
Sbjct: 537 GPLLDLELSALEQEGRAKILASPRLITANGEPASIKQGTEIPYQVASGGGGGTITSVEFK 596

Query: 311 DYGVVLHFTPTVLSPGRIGLRIQTEVSEP--VIGVNAGDMPSYRVRKADTTVELPSGGTI 368
           +  + L  TP +   GRI L +      P  V  +  G++P    ++ +T V + +G T+
Sbjct: 597 EAVLGLEVTPRITPDGRIFLDLFVTQDSPGQVQVIGVGEIPLISKQEINTQVIVKNGETV 656

Query: 369 VLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKP 421
           VL G+ ++  +     +PLL  IP++GALFR +    E  E+ I  TP +++P
Sbjct: 657 VLGGIFQEADRSTVSKVPLLGDIPVIGALFRTTTKTTERRELLIFITPRIIEP 709


>gnl|CDD|147246 pfam04972, BON, Putative phospholipid-binding domain.  This domain
           is found in a family of osmotic shock protection
           proteins. It is also found in some Secretins and a group
           of potential haemolysins. Its likely function is
           attachment to phospholipid membranes.
          Length = 64

 Score = 31.8 bits (73), Expect = 0.39
 Identities = 9/39 (23%), Positives = 21/39 (53%)

Query: 129 RFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETF 167
             +  S+I+V + +  V L G V + ++ ++A E++   
Sbjct: 12  PGLPASDIKVTVENGVVTLSGTVDSEEEKEKAEEIARNV 50


>gnl|CDD|33997 COG4275, COG4275, Uncharacterized conserved protein [Function
           unknown].
          Length = 143

 Score = 30.7 bits (69), Expect = 0.95
 Identities = 18/63 (28%), Positives = 26/63 (41%), Gaps = 13/63 (20%)

Query: 353 VRKADTTVELPS----GGTIVLAGL---LKDDIQQLKEGIPLLSKIPILGALFRNSRFNR 405
           VR ADT          G   +  GL     DD++QL+ G+ +        AL+   R   
Sbjct: 87  VRAADTARLDLEPEAGGLLAISLGLSRMFADDLEQLRAGMGVYD------ALYAWCRDAT 140

Query: 406 EET 408
           +ET
Sbjct: 141 KET 143


>gnl|CDD|176226 cd08265, Zn_ADH3, Alcohol dehydrogenases of the MDR family.  This
           group resembles the zinc-dependent alcohol dehydrogenase
           and has the catalytic and structural zinc-binding sites
           characteristic of this group. The medium chain
           dehydrogenases/reductase (MDR)/zinc-dependent alcohol
           dehydrogenase-like family, which contains the
           zinc-dependent alcohol dehydrogenase (ADH-Zn) and
           related proteins, is a diverse group of proteins related
           to the first identified member, class I mammalian ADH.
           MDRs display a broad range of activities and are
           distinguished from the smaller short chain
           dehydrogenases (~ 250 amino acids vs. the ~ 350 amino
           acids of the MDR).  The MDR proteins have 2 domains: a
           C-terminal NAD(P) binding-Rossmann fold domain of a
           beta-alpha form and an N-terminal catalytic domain with
           distant homology  to GroES.  The MDR group contains a
           host of activities, including the founding alcohol
           dehydrogenase (ADH), quinone reductase, sorbitol
           dehydrogenase, formaldehyde dehydrogenase, butanediol
           DH, ketose reductase, cinnamyl reductase, and numerous
           others. The zinc-dependent alcohol dehydrogenases (ADHs)
           catalyze the  NAD(P)(H)-dependent interconversion of
           alcohols to aldehydes or ketones.  Active site zinc has
           a catalytic role, while structural zinc aids in
           stability.  ADH-like proteins typically form dimers
           (typically higher plants, mammals) or tetramers (yeast,
           bacteria), and generally have 2 tightly bound zinc atoms
           per subunit. The active site zinc is coordinated by a
           histidine, two cysteines, and a water molecule. The
           second zinc seems to play a structural role, affects
           subunit interactions, and is typically coordinated by 4
           cysteines. Other MDR members have only a catalytic zinc,
           and some contain no coordinated zinc.
          Length = 384

 Score = 29.8 bits (67), Expect = 1.8
 Identities = 17/66 (25%), Positives = 27/66 (40%), Gaps = 10/66 (15%)

Query: 187 LLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVS----EG 242
           L   AG  +V     I+E RR++ K++G  +        P+K      G K +      G
Sbjct: 222 LAKAAGASKVIA-FEISEERRNLAKEMGADYVFN-----PTKMRDCLSGEKVMEVTKGWG 275

Query: 243 GDFSVK 248
            D  V+
Sbjct: 276 ADIQVE 281


>gnl|CDD|144886 pfam01459, Porin_3, Eukaryotic porin. 
          Length = 272

 Score = 29.5 bits (67), Expect = 1.9
 Identities = 10/35 (28%), Positives = 18/35 (51%)

Query: 218 SITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLD 252
           +++GS S      + DF  K+  +G   ++KG  D
Sbjct: 40  TVSGSKSLGGGLSSGDFEAKYKDKGLTLTLKGDTD 74


>gnl|CDD|30541 COG0192, MetK, S-adenosylmethionine synthetase [Coenzyme
           metabolism].
          Length = 388

 Score = 29.8 bits (67), Expect = 2.0
 Identities = 13/36 (36%), Positives = 19/36 (52%)

Query: 186 NLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITG 221
            L+ IAGE   +  V I  + R  +K+IG+  S  G
Sbjct: 50  GLVVIAGEITTSAYVDIVNIARKTIKEIGYTESDYG 85


>gnl|CDD|58582 cd04282, ZnMc_meprin, Zinc-dependent metalloprotease, meprin_like
           subfamily. Meprins are membrane-bound or secreted
           extracellular proteases, which cleave a variety of
           targets, including peptides such as parathyroid hormone,
           gastrin, and cholecystokinin, cytokines such as
           osteopontin, and proteins such as collagen IV,
           fibronectin, casein and gelatin. Meprins may also be
           able to release proteins from the cell surface. Closely
           related meprin alpha- and beta-subunits form homo- and
           hetero-oligomers; these complexes are found on
           epithelial cells of the intestine, for example, and are
           also expressed in certain cancer cells..
          Length = 230

 Score = 29.5 bits (66), Expect = 2.0
 Identities = 16/57 (28%), Positives = 26/57 (45%), Gaps = 2/57 (3%)

Query: 288 TSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE--PVIG 342
            SG +H +     S      T +DY  V+H++P   + G     I T++ E   +IG
Sbjct: 155 LSGREHNFNKYDDSFSTDLNTPYDYESVMHYSPFSFNKGASEPTITTKIPEFNDIIG 211


>gnl|CDD|30796 COG0447, MenB, Dihydroxynaphthoic acid synthase [Coenzyme
           metabolism].
          Length = 282

 Score = 28.7 bits (64), Expect = 3.5
 Identities = 20/74 (27%), Positives = 32/74 (43%), Gaps = 7/74 (9%)

Query: 235 GGKFVSEGGDFSVKGVLDRFSFETV---LHALERATAIRTLAEPTLTAISGQSASFTSGG 291
           G K    GGD  V+G    +  +     L+ L+    IRT+ +P +  ++G +     GG
Sbjct: 75  GDKAFCSGGDQKVRGDSGGYVDDDGIPRLNVLDLQRLIRTMPKPVIAMVAGYAI----GG 130

Query: 292 QHLYKTVSSSTGAT 305
            H+   V   T A 
Sbjct: 131 GHVLHVVCDLTIAA 144


>gnl|CDD|32651 COG2823, OsmY, Predicted periplasmic or secreted lipoprotein
           [General function prediction only].
          Length = 196

 Score = 28.4 bits (63), Expect = 4.1
 Identities = 12/33 (36%), Positives = 22/33 (66%)

Query: 134 SNIRVEMVSDTVVLHGMVRTIQDSQRAVELSET 166
           SNI+VE  +  V L G+V + ++++RA E++  
Sbjct: 149 SNIKVETENGEVYLSGLVDSQEEAERAEEIASK 181


>gnl|CDD|31263 COG1063, Tdh, Threonine dehydrogenase and related Zn-dependent
           dehydrogenases [Amino acid transport and metabolism /
           General function prediction only].
          Length = 350

 Score = 27.3 bits (60), Expect = 8.8
 Identities = 15/79 (18%), Positives = 35/79 (44%), Gaps = 7/79 (8%)

Query: 365 GGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAM 424
           GGT+V+ G+   +   L  G+ +  ++ + G+L  + R + E     +A+     + +  
Sbjct: 262 GGTVVVVGVYGGEDIPLPAGLVVSKELTLRGSLRPSGREDFERALDLLASGKIDPEKLI- 320

Query: 425 RDLSRPDDHYSVEDDAKAF 443
                      ++D A+A+
Sbjct: 321 ------THRLPLDDAAEAY 333


  Database: CddA
    Posted date:  Feb 4, 2011  9:38 PM
  Number of letters in database: 6,263,737
  Number of sequences in database:  21,609
  
Lambda     K      H
   0.318    0.135    0.372 

Gapped
Lambda     K      H
   0.267   0.0777    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21609
Number of Hits to DB: 5,369,814
Number of extensions: 284369
Number of successful extensions: 648
Number of sequences better than 10.0: 1
Number of HSP's gapped: 637
Number of HSP's successfully gapped: 18
Length of query: 474
Length of database: 6,263,737
Length adjustment: 97
Effective length of query: 377
Effective length of database: 4,167,664
Effective search space: 1571209328
Effective search space used: 1571209328
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (26.4 bits)