BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|254780727|ref|YP_003065140.1| putative pilus assembly
protein [Candidatus Liberibacter asiaticus str. psy62]
         (474 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|254780727|ref|YP_003065140.1| putative pilus assembly protein [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 474

 Score =  961 bits (2483), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/474 (100%), Positives = 474/474 (100%)

Query: 1   MRYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIIL 60
           MRYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIIL
Sbjct: 1   MRYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIIL 60

Query: 61  QVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDI 120
           QVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDI
Sbjct: 61  QVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDI 120

Query: 121 AHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSS 180
           AHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSS
Sbjct: 121 AHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSS 180

Query: 181 SKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVS 240
           SKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVS
Sbjct: 181 SKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVS 240

Query: 241 EGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSS 300
           EGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSS
Sbjct: 241 EGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSS 300

Query: 301 STGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGDMPSYRVRKADTTV 360
           STGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGDMPSYRVRKADTTV
Sbjct: 301 STGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGDMPSYRVRKADTTV 360

Query: 361 ELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVK 420
           ELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVK
Sbjct: 361 ELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVK 420

Query: 421 PVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
           PVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK
Sbjct: 421 PVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474


>gi|255764483|ref|YP_003065151.2| hypothetical protein CLIBASIA_03125 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 135

 Score = 41.6 bits (96), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 44/74 (59%), Gaps = 7/74 (9%)

Query: 49  KISIGLNKVIILQVPVDVQDVLVSDPTKADVV-VHSPRTMYLFGKNVGQANVILIGHDGK 107
           +I I + + +ILQ  V  + V+V D    DV+ +   +T+ + GKN+G  N+I++GH   
Sbjct: 34  RIRIAVGQSLILQFDVLPKQVIVGDDKIVDVLALEKEKTVVITGKNLGSTNIIVLGH--- 90

Query: 108 QMLNLDILIERDIA 121
              N DIL++ +IA
Sbjct: 91  ---NNDILLDTEIA 101


>gi|254780549|ref|YP_003064962.1| signal peptide protein [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 271

 Score = 25.8 bits (55), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 15/24 (62%)

Query: 244 DFSVKGVLDRFSFETVLHALERAT 267
           DFSV+   DRFS +T  HA E  T
Sbjct: 75  DFSVQENGDRFSDQTKTHATENET 98


>gi|254780680|ref|YP_003065093.1| seryl-tRNA synthetase [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 430

 Score = 23.9 bits (50), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 10/25 (40%), Positives = 15/25 (60%)

Query: 366 GTIVLAGLLKDDIQQLKEGIPLLSK 390
           G + L   LK++   LKE +P+L K
Sbjct: 65  GNLSLVDALKNETSTLKEQLPILEK 89


>gi|254780877|ref|YP_003065290.1| ATP-dependent Clp protease, ATP-binding subunit protein [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 853

 Score = 23.9 bits (50), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 10/17 (58%), Positives = 14/17 (82%)

Query: 330 LRIQTEVSEPVIGVNAG 346
           LRI+TE+S+ VIG +A 
Sbjct: 560 LRIETEISKSVIGQSAA 576


>gi|254780163|ref|YP_003064576.1| ATP-dependent Clp protease ATP-binding subunit [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 798

 Score = 23.5 bits (49), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 39/85 (45%), Gaps = 19/85 (22%)

Query: 115 LIERDIAHLEMTLRRFIADSNIRVEMVSD-----TVVLHGMVRTIQDSQRAVELSETFLS 169
           +++R + H++ T R  +  +NI V + S+     T  L     T+ D+         F+S
Sbjct: 89  VVQRAVLHVQSTGRGIVTGANILVALFSEPDSHATYFLQEQEMTLYDAV-------NFIS 141

Query: 170 Q--SGRNQYANSSSKKVMNLLNIAG 192
              S R ++AN  SK     LN+ G
Sbjct: 142 HGISKRKEFANFQSK-----LNVDG 161


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.318    0.135    0.372 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 282,405
Number of Sequences: 1233
Number of extensions: 11626
Number of successful extensions: 29
Number of sequences better than 100.0: 8
Number of HSP's better than 100.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 23
Number of HSP's gapped (non-prelim): 8
length of query: 474
length of database: 328,796
effective HSP length: 77
effective length of query: 397
effective length of database: 233,855
effective search space: 92840435
effective search space used: 92840435
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 40 (20.0 bits)