BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780728|ref|YP_003065141.1| pilus assembly protein [Candidatus Liberibacter asiaticus str. psy62] (263 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780728|ref|YP_003065141.1| pilus assembly protein [Candidatus Liberibacter asiaticus str. psy62] Length = 263 Score = 520 bits (1338), Expect = e-149, Method: Compositional matrix adjust. Identities = 263/263 (100%), Positives = 263/263 (100%) Query: 1 MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60 MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV Sbjct: 1 MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60 Query: 61 VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG 120 VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG Sbjct: 61 VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG 120 Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAID 180 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAID Sbjct: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAID 180 Query: 181 HNIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQ 240 HNIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQ Sbjct: 181 HNIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQ 240 Query: 241 EEGKEIQIIKAGVIVNKDGEGIS 263 EEGKEIQIIKAGVIVNKDGEGIS Sbjct: 241 EEGKEIQIIKAGVIVNKDGEGIS 263 >gi|254780743|ref|YP_003065156.1| putative uracil-DNA glycosylase [Candidatus Liberibacter asiaticus str. psy62] Length = 261 Score = 26.6 bits (57), Expect = 0.50, Method: Compositional matrix adjust. Identities = 14/40 (35%), Positives = 23/40 (57%) Query: 210 AQSVAKLSLVLRSIADLNPSSSEDSDVWDVQEEGKEIQII 249 A S+ +L +LRS D + S+ S + Q EG+++ II Sbjct: 74 ACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMII 113 >gi|254781053|ref|YP_003065466.1| dihydrolipoamide dehydrogenase [Candidatus Liberibacter asiaticus str. psy62] Length = 466 Score = 24.6 bits (52), Expect = 1.7, Method: Compositional matrix adjust. Identities = 14/37 (37%), Positives = 19/37 (51%) Query: 182 NIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSL 218 +ID DE+V+V ST L + + LV V L L Sbjct: 153 SIDFDEQVIVSSTGALSFSSVPKNLLVIGAGVIGLEL 189 >537021.9.peg.363_1 Length = 79 Score = 24.3 bits (51), Expect = 2.4, Method: Compositional matrix adjust. Identities = 8/26 (30%), Positives = 15/26 (57%) Query: 78 DGFIDDVHQPNAMQELDGVLVRVPIL 103 DG + D++ P+ Q + + VPI+ Sbjct: 54 DGLVKDINTPDKQQTKNPITSSVPII 79 >gi|254780512|ref|YP_003064925.1| flagellar biosynthesis protein FlhA [Candidatus Liberibacter asiaticus str. psy62] Length = 692 Score = 23.9 bits (50), Expect = 3.2, Method: Compositional matrix adjust. Identities = 25/96 (26%), Positives = 47/96 (48%), Gaps = 5/96 (5%) Query: 146 IKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDHNIDSDERVLVGSTAT--LELTPMQ 203 P D++ VV+ + ++ +LS V + +D + + L T + + + +Q Sbjct: 475 FHPIDNLAVVLTHLSEVIRNNLSQLLSYKDVKNLISRLDPEYQKLAEETCSSHISYSGIQ 534 Query: 204 A--KALVAAQ-SVAKLSLVLRSIADLNPSSSEDSDV 236 A K L+A S+ L L+L SIA++ P S + S + Sbjct: 535 AVLKLLLAEHVSIRNLPLILESIAEVAPHSRKTSHI 570 >gi|254780193|ref|YP_003064606.1| lipid A ABC exporter family, fused ATPase and inner membrane subunits [Candidatus Liberibacter asiaticus str. psy62] Length = 528 Score = 23.5 bits (49), Expect = 4.4, Method: Compositional matrix adjust. Identities = 10/33 (30%), Positives = 18/33 (54%) Query: 14 VFALVAGIIAMRLVSPHHVQTEEVITENPAKFI 46 +F + GI + L+ H+V T E+ A+F+ Sbjct: 199 IFFVSCGIFIVFLIGAHYVATAEMPRGKLAEFV 231 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.317 0.135 0.370 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 158,201 Number of Sequences: 1233 Number of extensions: 6312 Number of successful extensions: 20 Number of sequences better than 100.0: 7 Number of HSP's better than 100.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 13 Number of HSP's gapped (non-prelim): 7 length of query: 263 length of database: 328,796 effective HSP length: 72 effective length of query: 191 effective length of database: 240,020 effective search space: 45843820 effective search space used: 45843820 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 37 (18.9 bits)