HHsearch alignment for GI: 254780729 and conserved domain: pfam01478

>pfam01478 Peptidase_A24 Type IV leader peptidase family. Peptidase A24, or the prepilin peptidase as it is also known, processes the N-terminus of the prepilins. The processing is essential for the correct formation of the pseudopili of type IV bacterial protein secretion. The enzyme is found across eubacteria and archaea.
Probab=99.80  E-value=7.3e-19  Score=126.69  Aligned_cols=101  Identities=36%  Similarity=0.613  Sum_probs=80.3

Q ss_pred             HHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHH
Q ss_conf             99999999999988975012489999999999999607899799999999999999999999982001720499999999
Q gi|254780729|r   14 IPPFCLVFAALSDLFSAMIPNRVSIVMLGSFLLTAFLLGMDYELIALHLLVGLIVFIICFCFFAFNIMGGGDVKLLTSTA   93 (176)
Q Consensus        14 i~~~~Lv~~a~~Dl~~~~IPn~l~l~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~mG~GDvKL~aa~g   93 (176)
T Consensus         2 ~~~~~L~~~s~~D~~~~~iP~~l~~~~~~~gl~~~~~~~--~~~~~~~~~g~~~~~~~~~~l~~~~~mG~GDvKL~a~lg   79 (103)
T pfam01478         2 LLLSLLLLLSLIDLRTRLLPNRLTLPLLWLGLLFALLLG--LLSLLDALLGALAGFLLLFLLYLKEGMGGGDVKLLAALG   79 (103)
T ss_pred             CHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHCC--CCCHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHH
T ss_conf             199999999999973460683369999999999998657--998999999999999999999904557772399999999


Q ss_pred             HHHCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             983406679999999999999999
Q gi|254780729|r   94 VWFGWTPSFLSFLFFVAILGGILS  117 (176)
Q Consensus        94 ~~lG~~~~l~~~l~~s~i~G~v~~  117 (176)
T Consensus        80 ~~lg~~~~~~~~~~-a~~~g~v~~  102 (103)
T pfam01478        80 AWLGWQALLLLLLL-ASLLGGLYA  102 (103)
T ss_pred             HHHHHHHHHHHHHH-HHHHHHHHH
T ss_conf             99859999999999-999999982