BLAST/PSIBLAST alignment of GI: 254780729 and GI: 190889879 at iteration 1
>gi|190889879|ref|YP_001976421.1| prepilin peptidase [Rhizobium etli CIAT 652] Length = 170
>gi|190695158|gb|ACE89243.1| prepilin peptidase protein [Rhizobium etli CIAT 652] Length = 170
 Score =  134 bits (336), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 111/170 (65%)

Query: 6   MVFSAVFLIPPFCLVFAALSDLFSAMIPNRVSIVMLGSFLLTAFLLGMDYELIALHLLVG 65
           M+ + VF++ P CL  AA SDLF+  IPNRVS++++ SFL+ A  LG   + I +HL   
Sbjct: 1   MIATGVFVVLPLCLAMAAFSDLFTMTIPNRVSLILIVSFLVLAPFLGFGLQAIGMHLAAA 60

Query: 66  LIVFIICFCFFAFNIMGGGDVKLLTSTAVWFGWTPSFLSFLFFVAILGGILSVFILTVRM 125
            IV   CF  FAFN+MGGGD KLL++TA+WFG   S    +  VA +GG++++ IL VR 
Sbjct: 61  AIVLAACFALFAFNVMGGGDAKLLSATALWFGLNQSLTLLMADVAAVGGLITLLILLVRT 120

Query: 126 ITNHIPIFGMFVPKSFLMKNKIPYGIAISMGGLISYPDSYLFKVALMGLS 175
            +N I   G+ +P S L+  KIPYGIAI++GG +++P S +F  AL  L 
Sbjct: 121 QSNTILAIGLPLPDSVLVAKKIPYGIAIAIGGFMAFPSSPIFIAALESLK 170