RPSBLAST alignment for GI: 254780729 and conserved domain: COG4960

>gnl|CDD|34567 COG4960, CpaA, Flp pilus assembly protein, protease CpaA [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion]. Length = 168
 Score = 91.4 bits (227), Expect = 1e-19
 Identities = 65/169 (38%), Positives = 92/169 (54%), Gaps = 2/169 (1%)

Query: 4   SKMVFSAVFLIPPFCLVFAALSDLFSAMIPNRVSIVMLGSFLLTAFLLGMDYELIALHLL 63
             M+ +++FLI P  LVFAA SD+ S  IPNR+ +V+L +F + A + GM      L L 
Sbjct: 1   MDMIIASLFLIFPVLLVFAAYSDIRSRTIPNRLVLVLLLAFAILAPVAGMPLAGAGLSLA 60

Query: 64  VGLIVFIICFCFFAFNIMGGGDVKLLTSTAVWFGWTPSFLSFLFFVAILGGILSVFILTV 123
              I   + F  FA  +MGGGDVKLL    +W G   + L FL + ++ GG+L+V IL +
Sbjct: 61  GAAIALALGFGLFALGVMGGGDVKLLAVLGLWLGPLQA-LYFLLYTSVAGGVLTVAILLL 119

Query: 124 RMITNHIPIFGMFVPKSFLMKNK-IPYGIAISMGGLISYPDSYLFKVAL 171
           R +      F     +  L     IPYG+AI++G L + P S L   AL
Sbjct: 120 RRVDLSAAAFKAPWLRRLLTPKGSIPYGVAIALGALAALPISPLMVSAL 168