RPS-BLAST 2.2.22 [Sep-27-2009]

Database: mmdb70 
           33,805 sequences; 4,956,049 total letters

Searching..................................................done

Query= gi|254780729|ref|YP_003065142.1| peptidase A24A prepilin type
IV [Candidatus Liberibacter asiaticus str. psy62]
         (176 letters)



>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase
           regulator/viral protein complex; 3.10A {Simian virus 40}
           PDB: 2pkg_C (E:93-174)
          Length = 82

 Score = 25.2 bits (55), Expect = 5.7
 Identities = 11/47 (23%), Positives = 19/47 (40%), Gaps = 14/47 (29%)

Query: 67  IVFIICFCFFAFNIMGGGDVKLLTSTAVWFGWTPSFLSFLFFVAILG 113
           +V++ C+CF  F               +WFG      + L +  I+G
Sbjct: 41  LVWVDCYCFDCF--------------RMWFGLDLCEGTLLLWCDIIG 73


>2bpq_A Anthranilate phosphoribosyltransferase; tryptophan
          biosynthesis, transferase phosphoribosyltransferase,
          amino-acid biosynthesis; 1.9A {Mycobacterium
          tuberculosis} PDB: 1zvw_A* (A:1-112,A:185-284)
          Length = 212

 Score = 25.1 bits (55), Expect = 5.7
 Identities = 2/41 (4%), Positives = 11/41 (26%)

Query: 19 LVFAALSDLFSAMIPNRVSIVMLGSFLLTAFLLGMDYELIA 59
          L     +     ++        + +F +   +     + + 
Sbjct: 40 LARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVG 80


>1khd_A Anthranilate phosphoribosyltransferase; type 3 PRT fold,
          nucleotide binding fold; 1.86A {Pectobacterium
          carotovorum} (A:)
          Length = 345

 Score = 24.6 bits (53), Expect = 7.5
 Identities = 9/41 (21%), Positives = 18/41 (43%)

Query: 19 LVFAALSDLFSAMIPNRVSIVMLGSFLLTAFLLGMDYELIA 59
          +       LF+A++   +    L + L++  + G   E IA
Sbjct: 26 MTQEESHQLFAAIVRGELEDSQLAAALISMKMRGERPEEIA 66


>2tpt_A Thymidine phosphorylase; transferase, salvage pathway;
          2.60A {Escherichia coli K12} (A:1-329,A:430-440)
          Length = 340

 Score = 24.3 bits (52), Expect = 8.7
 Identities = 6/41 (14%), Positives = 13/41 (31%)

Query: 19 LVFAALSDLFSAMIPNRVSIVMLGSFLLTAFLLGMDYELIA 59
          L    +    + +  N +S   + +  +T F   M      
Sbjct: 17 LSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERV 57


  Database: mmdb70
    Posted date:  Jun 20, 2010  3:12 AM
  Number of letters in database: 4,956,049
  Number of sequences in database:  33,805
  
Lambda     K      H
   0.337    0.149    0.463 

Gapped
Lambda     K      H
   0.267   0.0450    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 33805
Number of Hits to DB: 1,286,995
Number of extensions: 53527
Number of successful extensions: 336
Number of sequences better than 10.0: 1
Number of HSP's gapped: 331
Number of HSP's successfully gapped: 60
Length of query: 176
Length of database: 4,956,049
Length adjustment: 83
Effective length of query: 93
Effective length of database: 2,150,234
Effective search space: 199971762
Effective search space used: 199971762
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.7 bits)
S2: 51 (24.1 bits)