Query         gi|254780730|ref|YP_003065143.1| hypothetical protein CLIBASIA_03085 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 120
No_of_seqs    110 out of 335
Neff          2.6 
Searched_HMMs 33803
Date          Wed Jun  1 14:24:03 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780730.hhm -d /home/congqian_1/database/mmdb/mmdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 >2wbi_A Acyl-COA dehydrogenase  19.4      35   0.001   15.6   0.6   26    9-34     85-110 (276)
  2 >2jo1_A Phospholemman; FXYD1,   11.8 1.1E+02  0.0031   12.8   1.5   44   22-66     20-63  (72)
  3 >2akh_Z Preprotein translocase  10.8 1.1E+02  0.0034   12.6   4.2   39   20-58     29-67  (111)
  4 >2nxx_E Ecdysone receptor (ECR  10.5 1.2E+02  0.0035   12.6   2.1   45    5-49     17-69  (89)
  5 >2kjf_A Carnocyclin-A; circula   8.2      65  0.0019   14.0  -0.8   31   27-57     22-52  (60)
  6 >3ci9_A Heat shock factor-bind   7.7 1.5E+02  0.0046   11.9   3.3   23   32-54      7-29  (48)
  7 >1mw7_A Hypothetical protein H   7.3 1.6E+02  0.0048   11.8   0.9   36   38-73     24-59  (84)
  8 >1n0q_A 3ANK, 3 ankyrin repeat   5.4 2.1E+02  0.0061   11.2   0.8   22   10-31     63-84  (93)
  9 >2f4q_A Type I topoisomerase,    4.5 2.2E+02  0.0065   11.1   0.2   27   38-66     47-73  (131)
 10 >1m56_D Cytochrome C oxidase;    4.3 2.5E+02  0.0074   10.7   1.9   19   16-34     32-50  (51)

No 1  
>>2wbi_A Acyl-COA dehydrogenase family member 11; human, polymorphism, phosphoprotein, oxidoreductase, alternative splicing; HET: FAD; 2.80A {Homo sapiens} (A:1-111,A:264-428)
Probab=19.36  E-value=35  Score=15.55  Aligned_cols=26  Identities=23%  Similarity=0.413  Sum_probs=20.9

Q ss_pred             HHHCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             96122570299999999999999999
Q gi|254780730|r    9 ILKNGSGATAIEYGLLASLVSVAIIS   34 (120)
Q Consensus         9 Fl~DEsGATAIEYgLIaALIaVAIIa   34 (120)
                      |+-++.|.|-+||++|+-.+.-..++
T Consensus        85 ~lp~~~gl~~~eya~~~e~~g~s~~~  110 (276)
T 2wbi_A           85 FLPAVSGLSHVDYALIAEETGKCFFA  110 (276)
T ss_dssp             TCHHHHCCCHHHHHHHHHHHTTSTTH
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHCCCC
T ss_conf             79641389889999999997530456


No 2  
>>2jo1_A Phospholemman; FXYD1, Na,K-ATPase, micelle, hydrolase regulator; NMR {Homo sapiens} (A:)
Probab=11.80  E-value=1.1e+02  Score=12.83  Aligned_cols=44  Identities=16%  Similarity=0.194  Sum_probs=23.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             999999999999999876358999999997310147898767887
Q gi|254780730|r   22 GLLASLVSVAIISAVSTLGDRMKGVYQTISTELDKGDVPPTKPGS   66 (120)
Q Consensus        22 gLIaALIaVAIIaavt~LGt~L~~~FttVst~LnkG~~pp~~p~~   66 (120)
                      |||.|.| +-+++.+-.+.....-.|+.=....+.++.+...|||
T Consensus        20 GLi~A~v-Lfi~GI~iilS~kcrC~~~qk~r~~~~~~~e~~~~~s   63 (72)
T 2jo1_A           20 GLVIAGI-LFILGILIVLSRRCRCKFNQQQRTGEPDEEEGTFRSS   63 (72)
T ss_dssp             HHHHHHH-HHHHHHHHHHHHHHHHHHCTTTSSSCCCTTTSTHHHH
T ss_pred             CHHHHHH-HHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHH
T ss_conf             2378999-9999999998365656777777899971235579999


No 3  
>>2akh_Z Preprotein translocase SECE subunit; protein transport, translocation, transmembrane, transport; 14.90A {Escherichia coli} PDB: 2aki_Z (Z:)
Probab=10.80  E-value=1.1e+02  Score=12.64  Aligned_cols=39  Identities=13%  Similarity=0.128  Sum_probs=30.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             999999999999999998763589999999973101478
Q gi|254780730|r   20 EYGLLASLVSVAIISAVSTLGDRMKGVYQTISTELDKGD   58 (120)
Q Consensus        20 EYgLIaALIaVAIIaavt~LGt~L~~~FttVst~LnkG~   58 (120)
                      --++++.++....+...+.-|.++-+-|..+-.++.|=-
T Consensus        29 vl~~~~~~i~a~~i~~~T~~G~~~~~f~~e~~~ElkKVv   67 (111)
T 2akh_Z           29 ALAVVILIAAAGGVALLTTKGKATVAFAREARTEVRKVI   67 (111)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCC
T ss_conf             999999999999999984224489999999999978478


No 4  
>>2nxx_E Ecdysone receptor (ECR, NRH1); hormone receptor, APO and holo ligand binding pocket, hormone/growth factor complex; HET: P1A; 2.75A {Tribolium castaneum} (E:1-30,E:151-209)
Probab=10.50  E-value=1.2e+02  Score=12.58  Aligned_cols=45  Identities=18%  Similarity=0.254  Sum_probs=26.3

Q ss_pred             HHHHH--HHCCCCHHHHHHHHHHHHHHH------HHHHHHHHHHHHHHHHHHH
Q ss_conf             99999--612257029999999999999------9999998763589999999
Q gi|254780730|r    5 IIKKI--LKNGSGATAIEYGLLASLVSV------AIISAVSTLGDRMKGVYQT   49 (120)
Q Consensus         5 ~ikrF--l~DEsGATAIEYgLIaALIaV------AIIaavt~LGt~L~~~Ftt   49 (120)
                      ++.|+  +.+|---+-.||+++.|+|-.      .-...|..+-+.+....+.
T Consensus        17 ~~~~~~~~~~~~~~d~~EyaLLkAIvLfsDrpGL~d~~~VE~LQe~i~~ALq~   69 (89)
T 2nxx_E           17 LIHRLVYFQNEYEHDNAEYALLTAIVIFSERPALIEGWKVEKIQEIYLEALRA   69 (89)
T ss_dssp             HHHHHHHHHHHTSSCHHHHHHHHHHHHTCCCSSCTTHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             99999999987458999999999999957887888799999999999999999


No 5  
>>2kjf_A Carnocyclin-A; circular bacteriocin, antimicrobial peptide, solution helical, saposin-fold, antibiotic, antimicrobial, bacteriocin; NMR {Carnobacterium maltaromaticum} (A:)
Probab=8.24  E-value=65  Score=14.02  Aligned_cols=31  Identities=23%  Similarity=0.380  Sum_probs=22.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             9999999999876358999999997310147
Q gi|254780730|r   27 LVSVAIISAVSTLGDRMKGVYQTISTELDKG   57 (120)
Q Consensus        27 LIaVAIIaavt~LGt~L~~~FttVst~LnkG   57 (120)
                      |-...||..+..+--.++++|+.|...+.+-
T Consensus        22 ltvgsiisilggvtvglsgvftavkaaiakq   52 (60)
T 2kjf_A           22 LTVGSIISILGGVTVGLSGVFTAVKAAIAKQ   52 (60)
T ss_dssp             CCHHHHHHHHCSSCTTTHHHHHHHHHHHHHT
T ss_pred             CHHHHHHHHHCCCEECHHHHHHHHHHHHHHH
T ss_conf             4166788765472550035799999999998


No 6  
>>3ci9_A Heat shock factor-binding protein 1; triple helix, nucleus, transcription; 1.80A {Homo sapiens} (A:)
Probab=7.66  E-value=1.5e+02  Score=11.91  Aligned_cols=23  Identities=39%  Similarity=0.548  Sum_probs=18.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999876358999999997310
Q gi|254780730|r   32 IISAVSTLGDRMKGVYQTISTEL   54 (120)
Q Consensus        32 IIaavt~LGt~L~~~FttVst~L   54 (120)
                      +.+.|..|=.++.+.|+++++++
T Consensus         7 Lt~~Vq~LLqQmQ~kFq~mSd~I   29 (48)
T 3ci9_A            7 LTSVVQTLLQQMQDKFQTISDQI   29 (48)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999889999


No 7  
>>1mw7_A Hypothetical protein HP0162; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Helicobacter pylori} (A:74-126,A:210-240)
Probab=7.30  E-value=1.6e+02  Score=11.81  Aligned_cols=36  Identities=11%  Similarity=0.187  Sum_probs=28.6

Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCC
Q ss_conf             763589999999973101478987678875578677
Q gi|254780730|r   38 TLGDRMKGVYQTISTELDKGDVPPTKPGSVPMQPES   73 (120)
Q Consensus        38 ~LGt~L~~~FttVst~LnkG~~pp~~p~~~~~~~~~   73 (120)
                      .+-++.+.+...|-.-+++.+-.-+.||||....|.
T Consensus        24 ~lTDN~nRT~~~vr~~f~K~gG~lg~~GsV~~~~e~   59 (84)
T 1mw7_A           24 CMTDNPTRTIANLKSYFNKTQGASIVPNGSELNDEQ   59 (84)
T ss_dssp             EEESCHHHHHHHHHHHHTTSTTCEEECTTTCCCHHH
T ss_pred             EECCCHHHHHHHHHHHHHHCCCCCCCCCCCECCHHH
T ss_conf             917977679999999998638853356884329999


No 8  
>>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} (A:)
Probab=5.38  E-value=2.1e+02  Score=11.20  Aligned_cols=22  Identities=18%  Similarity=0.256  Sum_probs=14.8

Q ss_pred             HHCCCCHHHHHHHHHHHHHHHH
Q ss_conf             6122570299999999999999
Q gi|254780730|r   10 LKNGSGATAIEYGLLASLVSVA   31 (120)
Q Consensus        10 l~DEsGATAIEYgLIaALIaVA   31 (120)
                      .+|+.|.|++.||..-+-..++
T Consensus        63 ~~d~~g~T~Lh~A~~~~~~~~~   84 (93)
T 1n0q_A           63 AKDKNGRTPLHLAARNGHLEVV   84 (93)
T ss_dssp             CCCTTSCCHHHHHHHTTCHHHH
T ss_pred             CCCCCCCCHHHHHHHCCCHHHH
T ss_conf             3434447559999995889999


No 9  
>>2f4q_A Type I topoisomerase, putative; topoisomerase IB; 1.75A {Deinococcus radiodurans} (A:86-103,A:234-346)
Probab=4.47  E-value=2.2e+02  Score=11.06  Aligned_cols=27  Identities=19%  Similarity=0.386  Sum_probs=18.6

Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             76358999999997310147898767887
Q gi|254780730|r   38 TLGDRMKGVYQTISTELDKGDVPPTKPGS   66 (120)
Q Consensus        38 ~LGt~L~~~FttVst~LnkG~~pp~~p~~   66 (120)
                      ..--.+..++..|+..|  ||||.-.-.|
T Consensus        47 ~~kk~i~~ai~~VA~~L--GNTPAVcRks   73 (131)
T 2f4q_A           47 QAKKVLVDCVKFVADDL--GNTPAVTRGS   73 (131)
T ss_dssp             HHHHHHHHHHHHHHHHH--TCCHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHH--CCCHHHHHHH
T ss_conf             99999999999999984--8976557675


No 10 
>>1m56_D Cytochrome C oxidase; membrane protein, oxidoreductase; HET: HEA PEH; 2.30A {Rhodobacter sphaeroides} (D:)
Probab=4.27  E-value=2.5e+02  Score=10.74  Aligned_cols=19  Identities=21%  Similarity=0.235  Sum_probs=11.5

Q ss_pred             HHHHHHHHHHHHHHHHHHH
Q ss_conf             0299999999999999999
Q gi|254780730|r   16 ATAIEYGLLASLVSVAIIS   34 (120)
Q Consensus        16 ATAIEYgLIaALIaVAIIa   34 (120)
                      .|-.-+++|+.||.+|+++
T Consensus        32 ~t~~~i~ii~~liFlAif~   50 (51)
T 1m56_D           32 VTWAAVVIVAALIFLALAN   50 (51)
T ss_dssp             HHHHHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHHHHHHHC
T ss_conf             9999999999999999962


Done!