BLAST/PSIBLAST alignment of GI: 254780730 and GI: 116249978 at iteration 1
>gi|116249978|ref|YP_765816.1| pilus subunit protein [Rhizobium leguminosarum bv. viciae 3841] Length = 61
>gi|115254626|emb|CAK05700.1| putative pilus subunit protein [Rhizobium leguminosarum bv. viciae 3841] Length = 61
 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 40/53 (75%)

Query: 5  IIKKILKNGSGATAIEYGLLASLVSVAIISAVSTLGDRMKGVYQTISTELDKG 57
          +  + LK+ SGATAIEYGL+A+L+SVA+I+  +TLGDR+   +  + T+++ G
Sbjct: 4  LFSRFLKDESGATAIEYGLIAALISVALITGATTLGDRIGTTFNNLGTKMNTG 56