RPSBLAST alignment for GI: 254780730 and conserved domain: pfam04964

>gnl|CDD|113726 pfam04964, Flp_Fap, Flp/Fap pilin component. Length = 47
 Score = 56.8 bits (138), Expect = 1e-09
 Identities = 25/46 (54%), Positives = 35/46 (76%)

Query: 10 LKNGSGATAIEYGLLASLVSVAIISAVSTLGDRMKGVYQTISTELD 55
          LK+ SGATAIEYGL+A+L++V II+ V+TLG  +K  + +I T L 
Sbjct: 2  LKDESGATAIEYGLIAALIAVVIIAYVTTLGTALKTKFTSIGTALT 47