RPS-BLAST 2.2.22 [Sep-27-2009]

Database: pdb70 
           24,244 sequences; 5,693,230 total letters

Searching..................................................done

Query= gi|254780730|ref|YP_003065143.1| hypothetical protein
CLIBASIA_03085 [Candidatus Liberibacter asiaticus str. psy62]
         (120 letters)



>2pff_B Fatty acid synthase subunit beta; fatty acid synthase,
           acyl-carrier-protein, beta-ketoacyl reductase,
           beta-ketoacyl synthase, dehydratase; 4.00A
           {Saccharomyces cerevisiae}
          Length = 2006

 Score = 34.1 bits (78), Expect = 0.007
 Identities = 22/142 (15%), Positives = 35/142 (24%), Gaps = 53/142 (37%)

Query: 9   ILKNGSGATAIEYGLLASLVSVAIISAVSTLGDRMKGVYQTISTELDKGDVPPTKP---- 64
            L +GS    +E+ LL   V  A     S L ++   +    +      D  PT P    
Sbjct: 10  TLSHGS----LEHVLL---VPTASFFIASQLQEQFNKILPEPTEGFA-ADDEPTTPAELV 61

Query: 65  ----GSVPMQPESSNPSTRLQ--------------------------PPAKPTSIPVKTK 94
               G V    E S      Q                               T++    +
Sbjct: 62  GKFLGYVSSLVEPSKVGQFDQVLNLCLTEFENCYLEGNDIHALAAKLLQENDTTLVKTKE 121

Query: 95  -----------SSKKSPKRIQS 105
                      + +   K+  S
Sbjct: 122 LIKNYITARIMAKRPFDKKSNS 143



 Score = 25.7 bits (56), Expect = 3.0
 Identities = 27/172 (15%), Positives = 40/172 (23%), Gaps = 92/172 (53%)

Query: 14  SGATAIEYGLLASLVSVAIISAVST-----------------LGDRMKGVY-------QT 49
            GAT    GL    V+   I+   +                 +G R    Y         
Sbjct: 268 KGATGHSQGL----VTAVAIAETDSWESFFVSVRKAITVLFFIGVRCYEAYPNTSLPPSI 323

Query: 50  ISTELDKGDVPPTKPGSVPM-----------Q----------PESS-------N------ 75
           +   L+  +  P+     PM           Q          P          N      
Sbjct: 324 LEDSLENNEGVPS-----PMLSISNLTQEQVQDYVNKTNSHLPAGKQVEISLVNGAKNLV 378

Query: 76  ----PS------TRLQPPAKPTS-----IPVKTKSSKKSPK---R---IQSP 106
               P         L+    P+      IP     S++  K   R   + SP
Sbjct: 379 VSGPPQSLYGLNLTLRKAKAPSGLDQSRIP----FSERKLKFSNRFLPVASP 426



 Score = 24.5 bits (53), Expect = 6.5
 Identities = 16/59 (27%), Positives = 29/59 (49%), Gaps = 5/59 (8%)

Query: 14   SGATAIEYGLLASLVSV-AIISAVSTLGDRMKGVYQTISTELDKGDVPPTKPGSVPMQP 71
            +G +  EY  LASL  V +I S V  +  R  G+  T+   + + ++  +  G + + P
Sbjct: 1760 AGHSLGEYAALASLADVMSIESLVEVVFYR--GM--TMQVAVPRDELGRSNYGMIAINP 1814


>2p4f_A Similar to SP|P32453 saccharomyces cerevisiae YNL315C ATP11; half
           barrel, chaperone; HET: P6G; 1.40A {Candida glabrata cbs
           138}
          Length = 299

 Score = 28.4 bits (63), Expect = 0.41
 Identities = 11/54 (20%), Positives = 23/54 (42%), Gaps = 2/54 (3%)

Query: 67  VPMQPESSNPSTRLQPPAKPTSIPVKTKSSKKSPKRI--QSPAKNKKSYVKPNK 118
           +    +  N  +R+    +  +  +  KS++KS   +    P K    Y+K +K
Sbjct: 57  LRELEQHLNAGSRIHTNKEHKTTKMSNKSNEKSGNVLPKDKPYKTLDDYLKLDK 110


>2gj7_F Glycoprotein E; FC receptor, low resolution, immune
           system/virus/viral protein complex; HET: NAG BMA MAN GAL
           FUC; 5.00A {Human herpesvirus 1 strain kos} SCOP:
           b.1.1.1
          Length = 401

 Score = 25.4 bits (55), Expect = 3.3
 Identities = 7/31 (22%), Positives = 11/31 (35%)

Query: 62  TKPGSVPMQPESSNPSTRLQPPAKPTSIPVK 92
             P       E ++P     P A PT   ++
Sbjct: 369 PLPQRGADLAEPTHPHVGAPPHAPPTHGALR 399


>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2,
           autoinhibitory, ATP-binding, nucleotide-binding,
           phosphorylation; 2.00A {Mus musculus} PDB: 2qr8_A 2wnt_A
          Length = 342

 Score = 24.6 bits (53), Expect = 5.1
 Identities = 13/59 (22%), Positives = 25/59 (42%), Gaps = 8/59 (13%)

Query: 51  STELDKGDVPPTKPGSVPMQ--PESSNPSTRLQPPAKPTSIPVKTKSSKKSPKRIQSPA 107
             +L++ D P    G++       + N S  L+P  + T       + ++  K+I S A
Sbjct: 289 QYQLNRQDAPHLVKGAMAATYSALNRNQSPVLEPVGRSTL------AQRRGIKKITSTA 341


>1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION,
          membrane protein; HET: ATP; 2.10A {Rattus norvegicus}
          SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A*
          Length = 422

 Score = 24.6 bits (53), Expect = 6.2
 Identities = 8/31 (25%), Positives = 13/31 (41%)

Query: 60 PPTKPGSVPMQPESSNPSTRLQPPAKPTSIP 90
          P   PGS     E ++ +  +  PA P+   
Sbjct: 41 PGATPGSAAASAERASTAAPVASPAAPSPGS 71


>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling
          protein; 2.85A {Arabidopsis thaliana}
          Length = 338

 Score = 23.8 bits (50), Expect = 9.0
 Identities = 5/16 (31%), Positives = 10/16 (62%)

Query: 5  IIKKILKNGSGATAIE 20
          + K+I+K G G+   +
Sbjct: 51 VSKQIIKEGHGSKPSK 66


  Database: pdb70
    Posted date:  Jan 26, 2011 11:21 AM
  Number of letters in database: 5,693,230
  Number of sequences in database:  24,244
  
Lambda     K      H
   0.305    0.123    0.329 

Gapped
Lambda     K      H
   0.267   0.0445    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 24244
Number of Hits to DB: 888,627
Number of extensions: 35096
Number of successful extensions: 91
Number of sequences better than 10.0: 1
Number of HSP's gapped: 87
Number of HSP's successfully gapped: 25
Length of query: 120
Length of database: 5,693,230
Length adjustment: 81
Effective length of query: 39
Effective length of database: 3,729,466
Effective search space: 145449174
Effective search space used: 145449174
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 50 (23.8 bits)