RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780730|ref|YP_003065143.1| hypothetical protein CLIBASIA_03085 [Candidatus Liberibacter asiaticus str. psy62] (120 letters) >d2af4c1 c.77.1.5 (C:2-333) Phosphotransacetylase Pta {Methanosarcina thermophila [TaxId: 2210]} Length = 332 Score = 23.5 bits (50), Expect = 6.0 Identities = 8/40 (20%), Positives = 14/40 (35%) Query: 4 NIIKKILKNGSGATAIEYGLLASLVSVAIISAVSTLGDRM 43 NI KI + + A A + +S + D + Sbjct: 278 NIAYKIAQRLAKAEAYGPITQGLAKPINDLSRGCSDEDIV 317 >d1k3va_ b.121.5.2 (A:) Parvovirus (panleukopenia virus) capsid protein {Porcine parvovirus [TaxId: 10796]} Length = 542 Score = 23.4 bits (50), Expect = 6.2 Identities = 11/34 (32%), Positives = 16/34 (47%) Query: 46 VYQTISTELDKGDVPPTKPGSVPMQPESSNPSTR 79 + Q +T + G+ PT G + M PE S R Sbjct: 506 IQQHTTTAENIGNYIPTNIGGIRMFPEYSQLIPR 539 >d1wj4a_ d.15.1.2 (A:) Hypothetical protein KIAA0794 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Score = 22.7 bits (48), Expect = 9.9 Identities = 6/24 (25%), Positives = 11/24 (45%) Query: 58 DVPPTKPGSVPMQPESSNPSTRLQ 81 ++PP K V + + P +L Sbjct: 24 EMPPEKADGVVEGIDVNGPKAQLM 47 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.305 0.123 0.329 Gapped Lambda K H 0.267 0.0520 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 379,002 Number of extensions: 14395 Number of successful extensions: 20 Number of sequences better than 10.0: 1 Number of HSP's gapped: 20 Number of HSP's successfully gapped: 5 Length of query: 120 Length of database: 2,407,596 Length adjustment: 74 Effective length of query: 46 Effective length of database: 1,391,576 Effective search space: 64012496 Effective search space used: 64012496 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 43 (21.9 bits) S2: 47 (22.4 bits)