BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780732|ref|YP_003065145.1| hypothetical protein CLIBASIA_03095 [Candidatus Liberibacter asiaticus str. psy62] (58 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780732|ref|YP_003065145.1| hypothetical protein CLIBASIA_03095 [Candidatus Liberibacter asiaticus str. psy62] Length = 58 Score = 115 bits (288), Expect = 2e-28, Method: Compositional matrix adjust. Identities = 58/58 (100%), Positives = 58/58 (100%) Query: 1 MKMHIVKNFLQDESGATAIEYGLLASLIAVAIIASVTTLGGKLTAVFADISSKLNPKS 58 MKMHIVKNFLQDESGATAIEYGLLASLIAVAIIASVTTLGGKLTAVFADISSKLNPKS Sbjct: 1 MKMHIVKNFLQDESGATAIEYGLLASLIAVAIIASVTTLGGKLTAVFADISSKLNPKS 58 >gi|254780733|ref|YP_003065146.1| hypothetical protein CLIBASIA_03100 [Candidatus Liberibacter asiaticus str. psy62] Length = 56 Score = 87.8 bits (216), Expect = 3e-20, Method: Compositional matrix adjust. Identities = 44/51 (86%), Positives = 48/51 (94%) Query: 1 MKMHIVKNFLQDESGATAIEYGLLASLIAVAIIASVTTLGGKLTAVFADIS 51 MKM+IVK+FL+DESGATAIEYGLLASLIAVAIIASVTTLGGKL+ VF DI Sbjct: 1 MKMNIVKDFLKDESGATAIEYGLLASLIAVAIIASVTTLGGKLSKVFEDIE 51 >gi|254780734|ref|YP_003065147.1| Flp/Fap pilin component [Candidatus Liberibacter asiaticus str. psy62] Length = 62 Score = 83.2 bits (204), Expect = 8e-19, Method: Compositional matrix adjust. Identities = 42/50 (84%), Positives = 42/50 (84%) Query: 1 MKMHIVKNFLQDESGATAIEYGLLASLIAVAIIASVTTLGGKLTAVFADI 50 MKMHIVKNFLQDESGATAIEYGLL SLIAV II SVTTLGGKL F I Sbjct: 1 MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50 >gi|254780730|ref|YP_003065143.1| hypothetical protein CLIBASIA_03085 [Candidatus Liberibacter asiaticus str. psy62] Length = 120 Score = 70.5 bits (171), Expect = 5e-15, Method: Compositional matrix adjust. Identities = 32/55 (58%), Positives = 47/55 (85%) Query: 1 MKMHIVKNFLQDESGATAIEYGLLASLIAVAIIASVTTLGGKLTAVFADISSKLN 55 MKM+I+K L++ SGATAIEYGLLASL++VAII++V+TLG ++ V+ IS++L+ Sbjct: 1 MKMNIIKKILKNGSGATAIEYGLLASLVSVAIISAVSTLGDRMKGVYQTISTELD 55 >gi|254780736|ref|YP_003065149.1| hypothetical protein CLIBASIA_03115 [Candidatus Liberibacter asiaticus str. psy62] Length = 60 Score = 38.9 bits (89), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 30/57 (52%), Positives = 42/57 (73%), Gaps = 1/57 (1%) Query: 3 MHIVKNFLQDESGATAIEYGLLASLIAVAIIASVTTLGGKLTAVFADISSKL-NPKS 58 ++ + L+DESGA AIEYG+L +LIAVAIIA+VT LGG L F + ++++ N KS Sbjct: 2 INCMNKLLKDESGAAAIEYGMLVALIAVAIIAAVTMLGGSLKGTFEEAANRISNVKS 58 >gi|254780735|ref|YP_003065148.1| hypothetical protein CLIBASIA_03110 [Candidatus Liberibacter asiaticus str. psy62] Length = 75 Score = 26.2 bits (56), Expect = 0.10, Method: Compositional matrix adjust. Identities = 19/36 (52%), Positives = 30/36 (83%) Query: 20 EYGLLASLIAVAIIASVTTLGGKLTAVFADISSKLN 55 EYG++A+LIAVAIIA+VT LGG L F +++++++ Sbjct: 6 EYGMMAALIAVAIIAAVTKLGGSLKGAFEEVANQMS 41 >gi|254780877|ref|YP_003065290.1| ATP-dependent Clp protease, ATP-binding subunit protein [Candidatus Liberibacter asiaticus str. psy62] Length = 853 Score = 20.4 bits (41), Expect = 5.3, Method: Composition-based stats. Identities = 7/13 (53%), Positives = 10/13 (76%) Query: 4 HIVKNFLQDESGA 16 H++ FL+DE GA Sbjct: 33 HVLHIFLEDEQGA 45 >gi|254780638|ref|YP_003065051.1| molecular chaperone protein DnaJ [Candidatus Liberibacter asiaticus str. psy62] Length = 384 Score = 20.4 bits (41), Expect = 6.6, Method: Composition-based stats. Identities = 8/16 (50%), Positives = 10/16 (62%) Query: 7 KNFLQDESGATAIEYG 22 K L D+ G A+EYG Sbjct: 62 KRALYDQGGHEALEYG 77 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.317 0.130 0.338 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,794 Number of Sequences: 1233 Number of extensions: 697 Number of successful extensions: 9 Number of sequences better than 100.0: 9 Number of HSP's better than 100.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of query: 58 length of database: 328,796 effective HSP length: 30 effective length of query: 28 effective length of database: 291,806 effective search space: 8170568 effective search space used: 8170568 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.2 bits) S2: 31 (16.5 bits)