RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780733|ref|YP_003065146.1| hypothetical protein CLIBASIA_03100 [Candidatus Liberibacter asiaticus str. psy62] (56 letters) >gnl|CDD|183848 PRK13024, PRK13024, bifunctional preprotein translocase subunit SecD/SecF; Reviewed. Length = 755 Score = 25.6 bits (57), Expect = 3.4 Identities = 8/20 (40%), Positives = 13/20 (65%) Query: 15 GATAIEYGLLASLIAVAIIA 34 G AI+ G++A +I A+I Sbjct: 261 GQDAIDAGIIAGIIGFALIF 280 >gnl|CDD|177576 PHA03286, PHA03286, envelope glycoprotein E; Provisional. Length = 492 Score = 24.5 bits (53), Expect = 6.6 Identities = 10/32 (31%), Positives = 16/32 (50%), Gaps = 2/32 (6%) Query: 10 LKDESGATAIEYGLLASLIAVAIIASVTTLGG 41 + + G T I L++S+ A AI+ V L Sbjct: 379 IAFKEGPTVIYSLLVSSMAAGAIL--VVLLFA 408 >gnl|CDD|151095 pfam10552, ORF6C, ORF6C domain. This domain was identified by Iyer and colleagues. Length = 114 Score = 24.1 bits (53), Expect = 8.5 Identities = 15/57 (26%), Positives = 23/57 (40%), Gaps = 11/57 (19%) Query: 8 DFLKDESGATAIEYGLLASLIAVAIIASVTTLGGKLS--------KVFEDIEKGIKA 56 D L++ A E + + ++ LGGK S KVF DI + +K Sbjct: 25 DDLEENMPLFAGEAKEIQKKVNKRVVE---LLGGKGSPAYKNLRKKVFRDIYRQLKR 78 >gnl|CDD|173617 PTZ00427, PTZ00427, isoleucine-tRNA ligase, putative; Provisional. Length = 1205 Score = 24.2 bits (52), Expect = 8.9 Identities = 12/50 (24%), Positives = 24/50 (48%) Query: 6 VKDFLKDESGATAIEYGLLASLIAVAIIASVTTLGGKLSKVFEDIEKGIK 55 + +++K+E +E S + + I + TLG KL + ++ IK Sbjct: 1002 ISNYIKEELNVLNVECSNDTSCLDFSAIPNYKTLGVKLGYNLKKVQNKIK 1051 >gnl|CDD|178300 PLN02697, PLN02697, lycopene epsilon cyclase. Length = 529 Score = 24.0 bits (52), Expect = 10.0 Identities = 7/20 (35%), Positives = 14/20 (70%) Query: 1 MKMNIVKDFLKDESGATAIE 20 ++M +V+ + D +GAT I+ Sbjct: 505 LRMQLVRHLISDPTGATMIK 524 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.317 0.135 0.344 Gapped Lambda K H 0.267 0.0716 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 841,990 Number of extensions: 37253 Number of successful extensions: 124 Number of sequences better than 10.0: 1 Number of HSP's gapped: 124 Number of HSP's successfully gapped: 16 Length of query: 56 Length of database: 5,994,473 Length adjustment: 28 Effective length of query: 28 Effective length of database: 5,389,449 Effective search space: 150904572 Effective search space used: 150904572 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.1 bits)