RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780734|ref|YP_003065147.1| Flp/Fap pilin component [Candidatus Liberibacter asiaticus str. psy62] (62 letters) >gnl|CDD|171347 PRK11923, algU, RNA polymerase sigma factor AlgU; Provisional. Length = 193 Score = 24.8 bits (54), Expect = 5.1 Identities = 14/33 (42%), Positives = 20/33 (60%) Query: 22 GLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54 GL IA V+ V T+ ++ +A EAIDKA+ Sbjct: 154 GLSYEDIASVMQCPVGTVRSRIFRAREAIDKAL 186 >gnl|CDD|129436 TIGR00336, pyrE, orotate phosphoribosyltransferase. The conserved Lys (K) residue at position 101 of the seed alignment has been proposed as the active site for the enzyme. Length = 173 Score = 24.3 bits (53), Expect = 7.5 Identities = 9/24 (37%), Positives = 13/24 (54%) Query: 30 VVIITSVTTLGGKLKKAFEAIDKA 53 VV++ V T G + +A E I A Sbjct: 111 VVVVEDVITTGTSILEAVEIIQAA 134 >gnl|CDD|177576 PHA03286, PHA03286, envelope glycoprotein E; Provisional. Length = 492 Score = 24.1 bits (52), Expect = 9.3 Identities = 11/28 (39%), Positives = 13/28 (46%), Gaps = 1/28 (3%) Query: 13 ESGATAIEYGLLVSLIAVVIITSVTTLG 40 + G T I Y LLVS +A I V Sbjct: 382 KEGPTVI-YSLLVSSMAAGAILVVLLFA 408 >gnl|CDD|184151 PRK13570, PRK13570, anthranilate synthase component I; Provisional. Length = 455 Score = 23.8 bits (52), Expect = 9.6 Identities = 9/28 (32%), Positives = 13/28 (46%), Gaps = 3/28 (10%) Query: 33 ITSVTTLGGKLKKAFEAIDKAIVTTSPA 60 + S + G L+ A D A+ T PA Sbjct: 344 LVSEVS--GTLRPGLTAFD-ALKATLPA 368 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.317 0.131 0.336 Gapped Lambda K H 0.267 0.0675 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 913,239 Number of extensions: 42601 Number of successful extensions: 140 Number of sequences better than 10.0: 1 Number of HSP's gapped: 140 Number of HSP's successfully gapped: 17 Length of query: 62 Length of database: 5,994,473 Length adjustment: 34 Effective length of query: 28 Effective length of database: 5,259,801 Effective search space: 147274428 Effective search space used: 147274428 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.1 bits)