RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780735|ref|YP_003065148.1| hypothetical protein CLIBASIA_03110 [Candidatus Liberibacter asiaticus str. psy62] (75 letters) >gnl|CDD|113726 pfam04964, Flp_Fap, Flp/Fap pilin component. Length = 47 Score = 46.4 bits (111), Expect = 2e-06 Identities = 19/36 (52%), Positives = 25/36 (69%) Query: 6 EYGMMAALIAVAIIAAVTKLGGSLKGAFEEVANQMS 41 EYG++AALIAV IIA VT LG +LK F + ++ Sbjct: 12 EYGLIAALIAVVIIAYVTTLGTALKTKFTSIGTALT 47 >gnl|CDD|33638 COG3847, Flp, Flp pilus assembly protein, pilin Flp [Intracellular trafficking and secretion]. Length = 58 Score = 40.2 bits (94), Expect = 1e-04 Identities = 19/36 (52%), Positives = 26/36 (72%) Query: 6 EYGMMAALIAVAIIAAVTKLGGSLKGAFEEVANQMS 41 EYG++AALIAV IIA + LG +LKGAF + ++ Sbjct: 19 EYGLIAALIAVVIIAGGSTLGTALKGAFTAIGAALT 54 >gnl|CDD|31687 COG1498, SIK1, Protein implicated in ribosomal biogenesis, Nop56p homolog [Translation, ribosomal structure and biogenesis]. Length = 395 Score = 26.5 bits (58), Expect = 1.5 Identities = 17/65 (26%), Positives = 26/65 (40%), Gaps = 7/65 (10%) Query: 8 GMMAALIA--VAIIAAVTKLGG-----SLKGAFEEVANQMSHQTTKPPVTRPVTPTSTEM 60 G +A +A +AI A + G SL+ E+ ++ + KPP E Sbjct: 314 GKIARALAAKLAIAARIDAFSGEPDGISLREELEKRIEKLKEKPPKPPTKAKPERDKKER 373 Query: 61 PPRSR 65 P R R Sbjct: 374 PGRYR 378 >gnl|CDD|39657 KOG4456, KOG4456, KOG4456, Inner centromere protein (INCENP), C-terminal domain [Cell cycle control, cell division, chromosome partitioning]. Length = 134 Score = 25.5 bits (55), Expect = 3.5 Identities = 7/29 (24%), Positives = 13/29 (44%) Query: 34 EEVANQMSHQTTKPPVTRPVTPTSTEMPP 62 E+ A + + P ++ +TPT P Sbjct: 11 EKPAKAATAKPAPPVMSYKMTPTRVHKPK 39 >gnl|CDD|37555 KOG2344, KOG2344, KOG2344, Exocyst component protein and related proteins [Intracellular trafficking, secretion, and vesicular transport]. Length = 623 Score = 25.3 bits (55), Expect = 3.8 Identities = 7/28 (25%), Positives = 14/28 (50%) Query: 23 TKLGGSLKGAFEEVANQMSHQTTKPPVT 50 +LG ++ F E + + ++K PV Sbjct: 355 KRLGEGVRSIFVEFESAIRKDSSKTPVP 382 >gnl|CDD|40002 KOG4805, KOG4805, KOG4805, Uncharacterized conserved protein [Function unknown]. Length = 719 Score = 24.0 bits (51), Expect = 8.5 Identities = 7/32 (21%), Positives = 12/32 (37%) Query: 30 KGAFEEVANQMSHQTTKPPVTRPVTPTSTEMP 61 A + T T+P P+++ MP Sbjct: 44 TTFNSTPAVSCATPLTVSLATKPSEPSASSMP 75 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.316 0.129 0.368 Gapped Lambda K H 0.267 0.0779 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 867,527 Number of extensions: 33314 Number of successful extensions: 113 Number of sequences better than 10.0: 1 Number of HSP's gapped: 113 Number of HSP's successfully gapped: 9 Length of query: 75 Length of database: 6,263,737 Length adjustment: 46 Effective length of query: 29 Effective length of database: 5,269,723 Effective search space: 152821967 Effective search space used: 152821967 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (22.9 bits)