RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780735|ref|YP_003065148.1| hypothetical protein CLIBASIA_03110 [Candidatus Liberibacter asiaticus str. psy62] (75 letters) >d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Length = 221 Score = 23.1 bits (48), Expect = 6.4 Identities = 8/28 (28%), Positives = 12/28 (42%), Gaps = 1/28 (3%) Query: 48 PVTRPVTPTSTEMPPRSRYNTG-IGYGR 74 P RP+ MP R+ +G G+ Sbjct: 16 PAGRPMPYAIRPMPEDRRFGYAIVGLGK 43 >d2bs2a1 a.7.3.1 (A:458-655) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Length = 198 Score = 23.1 bits (49), Expect = 6.7 Identities = 9/40 (22%), Positives = 16/40 (40%), Gaps = 6/40 (15%) Query: 36 VANQMSHQTTKPPVT-RPVTPTSTEMPPRSRYNTGIGYGR 74 +A+ + + T P + + E+ P R GYG Sbjct: 108 LASWPNPEQTLPTLEYEALDVNEMEIAPGYR-----GYGA 142 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.316 0.129 0.368 Gapped Lambda K H 0.267 0.0569 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 260,551 Number of extensions: 8630 Number of successful extensions: 22 Number of sequences better than 10.0: 1 Number of HSP's gapped: 22 Number of HSP's successfully gapped: 4 Length of query: 75 Length of database: 2,407,596 Length adjustment: 42 Effective length of query: 33 Effective length of database: 1,830,936 Effective search space: 60420888 Effective search space used: 60420888 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.2 bits)