BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780736|ref|YP_003065149.1| hypothetical protein CLIBASIA_03115 [Candidatus Liberibacter asiaticus str. psy62] (60 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780736|ref|YP_003065149.1| hypothetical protein CLIBASIA_03115 [Candidatus Liberibacter asiaticus str. psy62] Length = 60 Score = 117 bits (292), Expect = 5e-29, Method: Compositional matrix adjust. Identities = 60/60 (100%), Positives = 60/60 (100%) Query: 1 MINCMNKLLKDESGAAAIEYGMLVALIAVAIIAAVTMLGGSLKGTFEEAANRISNVKSAK 60 MINCMNKLLKDESGAAAIEYGMLVALIAVAIIAAVTMLGGSLKGTFEEAANRISNVKSAK Sbjct: 1 MINCMNKLLKDESGAAAIEYGMLVALIAVAIIAAVTMLGGSLKGTFEEAANRISNVKSAK 60 >gi|254780733|ref|YP_003065146.1| hypothetical protein CLIBASIA_03100 [Candidatus Liberibacter asiaticus str. psy62] Length = 56 Score = 61.2 bits (147), Expect = 3e-12, Method: Compositional matrix adjust. Identities = 30/47 (63%), Positives = 36/47 (76%) Query: 2 INCMNKLLKDESGAAAIEYGMLVALIAVAIIAAVTMLGGSLKGTFEE 48 +N + LKDESGA AIEYG+L +LIAVAIIA+VT LGG L FE+ Sbjct: 3 MNIVKDFLKDESGATAIEYGLLASLIAVAIIASVTTLGGKLSKVFED 49 >gi|254780734|ref|YP_003065147.1| Flp/Fap pilin component [Candidatus Liberibacter asiaticus str. psy62] Length = 62 Score = 59.3 bits (142), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 28/46 (60%), Positives = 35/46 (76%) Query: 2 INCMNKLLKDESGAAAIEYGMLVALIAVAIIAAVTMLGGSLKGTFE 47 ++ + L+DESGA AIEYG+LV+LIAV II +VT LGG LK FE Sbjct: 3 MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFE 48 >gi|254780732|ref|YP_003065145.1| hypothetical protein CLIBASIA_03095 [Candidatus Liberibacter asiaticus str. psy62] Length = 58 Score = 58.9 bits (141), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 30/57 (52%), Positives = 42/57 (73%), Gaps = 1/57 (1%) Query: 2 INCMNKLLKDESGAAAIEYGMLVALIAVAIIAAVTMLGGSLKGTFEEAANRISNVKS 58 ++ + L+DESGA AIEYG+L +LIAVAIIA+VT LGG L F + ++++ N KS Sbjct: 3 MHIVKNFLQDESGATAIEYGLLASLIAVAIIASVTTLGGKLTAVFADISSKL-NPKS 58 >gi|254780730|ref|YP_003065143.1| hypothetical protein CLIBASIA_03085 [Candidatus Liberibacter asiaticus str. psy62] Length = 120 Score = 56.2 bits (134), Expect = 1e-10, Method: Compositional matrix adjust. Identities = 24/46 (52%), Positives = 37/46 (80%) Query: 2 INCMNKLLKDESGAAAIEYGMLVALIAVAIIAAVTMLGGSLKGTFE 47 +N + K+LK+ SGA AIEYG+L +L++VAII+AV+ LG +KG ++ Sbjct: 3 MNIIKKILKNGSGATAIEYGLLASLVSVAIISAVSTLGDRMKGVYQ 48 >gi|254780735|ref|YP_003065148.1| hypothetical protein CLIBASIA_03110 [Candidatus Liberibacter asiaticus str. psy62] Length = 75 Score = 40.0 bits (92), Expect = 7e-06, Method: Compositional matrix adjust. Identities = 29/38 (76%), Positives = 33/38 (86%) Query: 18 IEYGMLVALIAVAIIAAVTMLGGSLKGTFEEAANRISN 55 EYGM+ ALIAVAIIAAVT LGGSLKG FEE AN++S+ Sbjct: 5 YEYGMMAALIAVAIIAAVTKLGGSLKGAFEEVANQMSH 42 >gi|254780473|ref|YP_003064886.1| cytochrome O ubiquinol oxidase subunit I [Candidatus Liberibacter asiaticus str. psy62] Length = 671 Score = 20.0 bits (40), Expect = 7.3, Method: Composition-based stats. Identities = 8/14 (57%), Positives = 12/14 (85%) Query: 23 LVALIAVAIIAAVT 36 +VAL+ V+II A+T Sbjct: 33 VVALVGVSIIFAIT 46 >gi|254780311|ref|YP_003064724.1| hypothetical protein CLIBASIA_00980 [Candidatus Liberibacter asiaticus str. psy62] Length = 177 Score = 20.0 bits (40), Expect = 7.9, Method: Compositional matrix adjust. Identities = 10/18 (55%), Positives = 11/18 (61%) Query: 7 KLLKDESGAAAIEYGMLV 24 KLL D SG + GMLV Sbjct: 102 KLLPDGSGEFTRKMGMLV 119 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.317 0.130 0.336 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,783 Number of Sequences: 1233 Number of extensions: 647 Number of successful extensions: 13 Number of sequences better than 100.0: 12 Number of HSP's better than 100.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of query: 60 length of database: 328,796 effective HSP length: 32 effective length of query: 28 effective length of database: 289,340 effective search space: 8101520 effective search space used: 8101520 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (20.8 bits) S2: 31 (16.5 bits)