BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254780737|ref|YP_003065150.1| hypothetical protein CLIBASIA_03120 [Candidatus Liberibacter asiaticus str. psy62] (60 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done Results from round 1 >gi|254780737|ref|YP_003065150.1| hypothetical protein CLIBASIA_03120 [Candidatus Liberibacter asiaticus str. psy62] gi|254040414|gb|ACT57210.1| hypothetical protein CLIBASIA_03120 [Candidatus Liberibacter asiaticus str. psy62] Length = 60 Score = 122 bits (307), Expect = 1e-26, Method: Compositional matrix adjust. Identities = 60/60 (100%), Positives = 60/60 (100%) Query: 1 MARTQIALALSFFMITHSYYAFSQDEIKKNNPTLEKKPIVLMKHEIQEKKTLAAFTSFAS 60 MARTQIALALSFFMITHSYYAFSQDEIKKNNPTLEKKPIVLMKHEIQEKKTLAAFTSFAS Sbjct: 1 MARTQIALALSFFMITHSYYAFSQDEIKKNNPTLEKKPIVLMKHEIQEKKTLAAFTSFAS 60 >gi|315121901|ref|YP_004062390.1| hypothetical protein CKC_00755 [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495303|gb|ADR51902.1| hypothetical protein CKC_00755 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 206 Score = 57.0 bits (136), Expect = 7e-07, Method: Compositional matrix adjust. Identities = 28/53 (52%), Positives = 37/53 (69%), Gaps = 1/53 (1%) Query: 1 MARTQIALALSFFMITHSYYAFSQDEIKKNNPTLEK-KPIVLMKHEIQEKKTL 52 MAR QIAL LS MI +SY AFS DE KN+P+ + +PI+ +KH +EKK + Sbjct: 1 MARIQIALVLSTIMIAYSYPAFSNDETNKNDPSANRQRPILPLKHAKEEKKPI 53 Searching..................................................done Results from round 2 CONVERGED! >gi|254780737|ref|YP_003065150.1| hypothetical protein CLIBASIA_03120 [Candidatus Liberibacter asiaticus str. psy62] gi|254040414|gb|ACT57210.1| hypothetical protein CLIBASIA_03120 [Candidatus Liberibacter asiaticus str. psy62] Length = 60 Score = 89.8 bits (221), Expect = 1e-16, Method: Composition-based stats. Identities = 60/60 (100%), Positives = 60/60 (100%) Query: 1 MARTQIALALSFFMITHSYYAFSQDEIKKNNPTLEKKPIVLMKHEIQEKKTLAAFTSFAS 60 MARTQIALALSFFMITHSYYAFSQDEIKKNNPTLEKKPIVLMKHEIQEKKTLAAFTSFAS Sbjct: 1 MARTQIALALSFFMITHSYYAFSQDEIKKNNPTLEKKPIVLMKHEIQEKKTLAAFTSFAS 60 >gi|315121901|ref|YP_004062390.1| hypothetical protein CKC_00755 [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495303|gb|ADR51902.1| hypothetical protein CKC_00755 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 206 Score = 84.4 bits (207), Expect = 5e-15, Method: Composition-based stats. Identities = 28/53 (52%), Positives = 37/53 (69%), Gaps = 1/53 (1%) Query: 1 MARTQIALALSFFMITHSYYAFSQDEIKKNNPTLEK-KPIVLMKHEIQEKKTL 52 MAR QIAL LS MI +SY AFS DE KN+P+ + +PI+ +KH +EKK + Sbjct: 1 MARIQIALVLSTIMIAYSYPAFSNDETNKNDPSANRQRPILPLKHAKEEKKPI 53 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.313 0.131 0.349 Lambda K H 0.267 0.0384 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 922,196,515 Number of Sequences: 14124377 Number of extensions: 23987746 Number of successful extensions: 58931 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 58924 Number of HSP's gapped (non-prelim): 5 length of query: 60 length of database: 4,842,793,630 effective HSP length: 33 effective length of query: 27 effective length of database: 4,376,689,189 effective search space: 118170608103 effective search space used: 118170608103 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.4 bits) S2: 75 (33.6 bits)