RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780737|ref|YP_003065150.1| hypothetical protein CLIBASIA_03120 [Candidatus Liberibacter asiaticus str. psy62] (60 letters) >2ory_A Lipase; alpha/beta hydrolase; 2.20A {Photobacterium SP} Length = 346 Score = 27.0 bits (59), Expect = 1.1 Identities = 11/36 (30%), Positives = 15/36 (41%), Gaps = 4/36 (11%) Query: 5 QIALALSFFMITHSYYAFSQDEIKKNNPTLEKKPIV 40 Q+ LA S+ SYY + K N L K + Sbjct: 7 QLMLAFSY----MSYYGITHTGSAKKNAELILKKMK 38 >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 25.3 bits (55), Expect = 3.5 Identities = 9/60 (15%), Positives = 23/60 (38%), Gaps = 21/60 (35%) Query: 7 ALALSFFMITHSYYAF---------SQDEIKKNN--PT-------LEKKPIVLMKHEIQE 48 A+ + FF+ Y A+ +D ++ N P+ L ++ + + + + Sbjct: 299 AITVLFFIGVRCYEAYPNTSLPPSILEDSLENNEGVPSPMLSISNLTQE--QVQDY-VNK 355 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.321 0.128 0.345 Gapped Lambda K H 0.267 0.0582 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 454,916 Number of extensions: 14693 Number of successful extensions: 41 Number of sequences better than 10.0: 1 Number of HSP's gapped: 41 Number of HSP's successfully gapped: 4 Length of query: 60 Length of database: 5,693,230 Length adjustment: 31 Effective length of query: 29 Effective length of database: 4,941,666 Effective search space: 143308314 Effective search space used: 143308314 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.4 bits)