BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254780739|ref|YP_003065152.1| hypothetical protein CLIBASIA_03130 [Candidatus Liberibacter asiaticus str. psy62] (64 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done >gi|114332075|ref|YP_748297.1| tetraacyldisaccharide 4'-kinase [Nitrosomonas eutropha C91] gi|122313241|sp|Q0AEA0|LPXK_NITEC RecName: Full=Tetraacyldisaccharide 4'-kinase; AltName: Full=Lipid A 4'-kinase gi|114309089|gb|ABI60332.1| lipid-A-disaccharide kinase [Nitrosomonas eutropha C91] Length = 396 Score = 110 bits (276), Expect = 7e-23, Method: Composition-based stats. Identities = 29/56 (51%), Positives = 39/56 (69%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +DP+LL+IL CPL KG L + EL+ K LAYPIR G+P+ML EAR++ D+ Sbjct: 337 MDPKLLDILACPLCKGPLIYKKDRLELICKADRLAYPIRDGIPVMLEDEARRLPDE 392 >gi|121611792|ref|YP_999599.1| tetraacyldisaccharide 4'-kinase [Verminephrobacter eiseniae EF01-2] gi|148839569|sp|A1WSH4|LPXK_VEREI RecName: Full=Tetraacyldisaccharide 4'-kinase; AltName: Full=Lipid A 4'-kinase gi|121556432|gb|ABM60581.1| lipid-A-disaccharide synthase [Verminephrobacter eiseniae EF01-2] Length = 430 Score = 110 bits (276), Expect = 8e-23, Method: Composition-based stats. Identities = 29/63 (46%), Positives = 44/63 (69%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 + E +DP+LL++LVCP+TKG L EL+S+ A LAYP+R G+P++L +EAR + Sbjct: 364 LPENHRPMDPKLLQLLVCPVTKGPLRYDRAAQELISRSARLAYPVRDGIPVLLENEARPL 423 Query: 61 DDQ 63 D+ Sbjct: 424 TDE 426 >gi|30250098|ref|NP_842168.1| tetraacyldisaccharide-1-P 4'-kinase [Nitrosomonas europaea ATCC 19718] gi|81584576|sp|Q82SY2|LPXK_NITEU RecName: Full=Tetraacyldisaccharide 4'-kinase; AltName: Full=Lipid A 4'-kinase gi|30139205|emb|CAD86075.1| Tetraacyldisaccharide-1-P 4'-kinase [Nitrosomonas europaea ATCC 19718] Length = 396 Score = 108 bits (272), Expect = 2e-22, Method: Composition-based stats. Identities = 30/56 (53%), Positives = 41/56 (73%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +DP+LL+ILVCPL KG+L + EL+ K LAYPIR G+P+ML EAR++ D+ Sbjct: 337 MDPKLLDILVCPLCKGSLIYKKDRLELICKADRLAYPIRDGIPVMLEDEARKLPDE 392 >gi|144899815|emb|CAM76679.1| protein containing DUF343 [Magnetospirillum gryphiswaldense MSR-1] Length = 67 Score = 108 bits (271), Expect = 3e-22, Method: Composition-based stats. Identities = 36/64 (56%), Positives = 46/64 (71%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 M E + IDP+LLEILVCP++KG L + EL+S KA LA+PIR G+PIML EAR + Sbjct: 1 MSERVAAIDPKLLEILVCPVSKGPLRYDAAANELISDKAGLAFPIRDGIPIMLPDEARSL 60 Query: 61 DDQG 64 D+ G Sbjct: 61 DNSG 64 >gi|330975224|gb|EGH75290.1| tetraacyldisaccharide 4'-kinase [Pseudomonas syringae pv. aptata str. DSM 50252] Length = 399 Score = 106 bits (267), Expect = 8e-22, Method: Composition-based stats. Identities = 31/63 (49%), Positives = 43/63 (68%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 M + +D +LL+IL CP+ KG L L ++ TEL+SK A LAYP+R G+P+ML SEAR + Sbjct: 332 MIASGSPMDTKLLDILACPVCKGPLKLSADKTELISKGAGLAYPVRDGIPVMLESEARTL 391 Query: 61 DDQ 63 Sbjct: 392 STD 394 >gi|158425856|ref|YP_001527148.1| hypothetical protein AZC_4232 [Azorhizobium caulinodans ORS 571] gi|158332745|dbj|BAF90230.1| putative uncharacterized conserved protein [Azorhizobium caulinodans ORS 571] Length = 108 Score = 105 bits (263), Expect = 3e-21, Method: Composition-based stats. Identities = 33/61 (54%), Positives = 44/61 (72%) Query: 2 RETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 + ++DP+LLEILVCP+TKG L EL+S+ A LAYPIR G+PIML EAR++D Sbjct: 43 QRPGQDVDPKLLEILVCPVTKGPLDYDRARQELISRSARLAYPIRDGIPIMLADEARRLD 102 Query: 62 D 62 + Sbjct: 103 E 103 >gi|154246155|ref|YP_001417113.1| hypothetical protein Xaut_2212 [Xanthobacter autotrophicus Py2] gi|154160240|gb|ABS67456.1| protein of unknown function DUF343 [Xanthobacter autotrophicus Py2] Length = 140 Score = 105 bits (263), Expect = 3e-21, Method: Composition-based stats. Identities = 34/61 (55%), Positives = 44/61 (72%) Query: 2 RETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 + ++DP+LLEILVCPLTK L E EL+S+ A LAYPIR G+PIML EAR++D Sbjct: 75 QRPGHDVDPKLLEILVCPLTKAPLEYDRERQELVSRAARLAYPIRDGIPIMLADEARKLD 134 Query: 62 D 62 + Sbjct: 135 E 135 >gi|88800330|ref|ZP_01115896.1| hypothetical protein MED297_00470 [Reinekea sp. MED297] gi|88776907|gb|EAR08116.1| hypothetical protein MED297_00470 [Reinekea sp. MED297] Length = 70 Score = 101 bits (254), Expect = 3e-20, Method: Composition-based stats. Identities = 30/58 (51%), Positives = 37/58 (63%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 ID QLL ILVCP+TK L + E EL+S A LAYP+R G+P+ML EAR + Sbjct: 1 MMIDKQLLAILVCPVTKAPLQIDKERNELISTAAKLAYPVRDGIPVMLEDEARALSQD 58 >gi|192359723|ref|YP_001981849.1| Tetraacyldisaccharide-1-P 4-kinase [Cellvibrio japonicus Ueda107] gi|190685888|gb|ACE83566.1| Tetraacyldisaccharide-1-P 4-kinase [Cellvibrio japonicus Ueda107] Length = 69 Score = 101 bits (253), Expect = 4e-20, Method: Composition-based stats. Identities = 29/63 (46%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 M ID +LL ILVCP++KG L E EL+ ++ LAYPIR G+P+ML EAR++ Sbjct: 1 MSVKFM-IDKKLLSILVCPVSKGELEYHPEQQELVCWQSGLAYPIRDGIPVMLEQEARKL 59 Query: 61 DDQ 63 + Sbjct: 60 TAE 62 >gi|253996023|ref|YP_003048087.1| hypothetical protein Mmol_0650 [Methylotenera mobilis JLW8] gi|253982702|gb|ACT47560.1| protein of unknown function DUF343 [Methylotenera mobilis JLW8] Length = 60 Score = 101 bits (252), Expect = 5e-20, Method: Composition-based stats. Identities = 30/56 (53%), Positives = 40/56 (71%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LL+ILVCP+TKG L EL+SK A LAYP+R G+P+ML EAR++ D Sbjct: 1 MDAKLLQILVCPVTKGPLVYNKATNELISKSARLAYPVRDGIPVMLEDEARKLTDD 56 >gi|288959150|ref|YP_003449491.1| hypothetical protein AZL_023090 [Azospirillum sp. B510] gi|288911458|dbj|BAI72947.1| hypothetical protein AZL_023090 [Azospirillum sp. B510] Length = 76 Score = 100 bits (251), Expect = 6e-20, Method: Composition-based stats. Identities = 35/57 (61%), Positives = 45/57 (78%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQG 64 +DP+LLEILVCPLTKG L ++ EL+S++A LAYPIR G+PIML+ EAR +D G Sbjct: 17 VDPKLLEILVCPLTKGPLRYDADRGELVSERAGLAYPIRDGIPIMLIDEARSLDKAG 73 >gi|56698244|ref|YP_168617.1| hypothetical protein SPO3421 [Ruegeria pomeroyi DSS-3] gi|81348945|sp|Q5LMZ1|Y3421_SILPO RecName: Full=UPF0434 protein SPO3421 gi|56679981|gb|AAV96647.1| conserved hypothetical protein [Ruegeria pomeroyi DSS-3] Length = 62 Score = 100 bits (250), Expect = 8e-20, Method: Composition-based stats. Identities = 32/62 (51%), Positives = 42/62 (67%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 M ET D ++LE LVCP+T L + EL+SK A LA+PIR+G+P+MLV EAR + Sbjct: 1 MSETPAAFDRRMLEALVCPVTHATLEYDAGAQELVSKGAKLAFPIRNGIPVMLVDEARPL 60 Query: 61 DD 62 DD Sbjct: 61 DD 62 >gi|220934547|ref|YP_002513446.1| protein of unknown function DUF343 [Thioalkalivibrio sp. HL-EbGR7] gi|254800062|sp|B8GR39|Y1374_THISH RecName: Full=UPF0434 protein Tgr7_1374 gi|219995857|gb|ACL72459.1| protein of unknown function DUF343 [Thioalkalivibrio sp. HL-EbGR7] Length = 64 Score = 100 bits (250), Expect = 8e-20, Method: Composition-based stats. Identities = 31/56 (55%), Positives = 41/56 (73%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LL+ILVCP+TKG L EL+S+ A LAYPIR G+P+ML EARQ+ D+ Sbjct: 1 MDKRLLDILVCPVTKGPLIYDKSHEELISRSARLAYPIRDGIPVMLEDEARQLTDE 56 >gi|83718675|ref|YP_441297.1| hypothetical protein BTH_I0741 [Burkholderia thailandensis E264] gi|167580074|ref|ZP_02372948.1| hypothetical protein BthaT_18113 [Burkholderia thailandensis TXDOH] gi|167618140|ref|ZP_02386771.1| hypothetical protein BthaB_17666 [Burkholderia thailandensis Bt4] gi|257140033|ref|ZP_05588295.1| hypothetical protein BthaA_12655 [Burkholderia thailandensis E264] gi|123537875|sp|Q2T0K2|Y741_BURTA RecName: Full=UPF0434 protein BTH_I0741 gi|83652500|gb|ABC36563.1| Protein of unknown function (DUF343) family [Burkholderia thailandensis E264] Length = 68 Score = 100 bits (250), Expect = 8e-20, Method: Composition-based stats. Identities = 29/52 (55%), Positives = 35/52 (67%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 +D +LLEILVCP+ KG L EL+ LAYPIR G+P+MLV EARQ Sbjct: 1 MDARLLEILVCPVCKGPLHYDRGAQELVCNADKLAYPIRDGIPVMLVDEARQ 52 >gi|296531918|ref|ZP_06894721.1| tetraacyldisaccharide 4'-kinase [Roseomonas cervicalis ATCC 49957] gi|296267784|gb|EFH13606.1| tetraacyldisaccharide 4'-kinase [Roseomonas cervicalis ATCC 49957] Length = 73 Score = 100 bits (250), Expect = 9e-20, Method: Composition-based stats. Identities = 33/55 (60%), Positives = 43/55 (78%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 +DP+LLEILVCP+TKG L E EL+S++A LAYPIR G+PIML EAR+++ Sbjct: 18 PVDPRLLEILVCPVTKGPLRYDRERGELVSEQAGLAYPIRDGIPIMLPDEARRLE 72 >gi|319763310|ref|YP_004127247.1| hypothetical protein Alide_2628 [Alicycliphilus denitrificans BC] gi|330825505|ref|YP_004388808.1| hypothetical protein Alide2_2945 [Alicycliphilus denitrificans K601] gi|317117871|gb|ADV00360.1| protein of unknown function DUF343 [Alicycliphilus denitrificans BC] gi|329310877|gb|AEB85292.1| protein of unknown function DUF343 [Alicycliphilus denitrificans K601] Length = 60 Score = 99 bits (249), Expect = 9e-20, Method: Composition-based stats. Identities = 31/56 (55%), Positives = 44/56 (78%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +DP+LLE+LVCP+TKG LT E EL+S+ A LAYP+R G+P++L +EAR + D+ Sbjct: 1 MDPKLLELLVCPVTKGPLTYDRERQELVSRSARLAYPVRDGIPVLLENEARTLTDE 56 >gi|254175402|ref|ZP_04882062.1| conserved hypothetical protein [Burkholderia mallei ATCC 10399] gi|254296387|ref|ZP_04963844.1| conserved hypothetical protein [Burkholderia pseudomallei 406e] gi|157806144|gb|EDO83314.1| conserved hypothetical protein [Burkholderia pseudomallei 406e] gi|160696446|gb|EDP86416.1| conserved hypothetical protein [Burkholderia mallei ATCC 10399] Length = 73 Score = 99 bits (249), Expect = 1e-19, Method: Composition-based stats. Identities = 29/53 (54%), Positives = 36/53 (67%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 ++D +LLEILVCP+ KG L EL+ LAYPIR G+P+MLV EARQ Sbjct: 5 SVDARLLEILVCPICKGPLHYDRGAQELVCHADKLAYPIRDGIPVMLVDEARQ 57 >gi|260432328|ref|ZP_05786299.1| conserved domain protein [Silicibacter lacuscaerulensis ITI-1157] gi|260416156|gb|EEX09415.1| conserved domain protein [Silicibacter lacuscaerulensis ITI-1157] Length = 61 Score = 99 bits (249), Expect = 1e-19, Method: Composition-based stats. Identities = 32/61 (52%), Positives = 40/61 (65%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 M ET D +LE LVCP T L ++ EL+SK A LAYPIR G+P+MLV EAR++ Sbjct: 1 MTETEPGFDRHMLEALVCPQTHTTLEYDAQRQELISKAAGLAYPIRDGIPVMLVDEARKL 60 Query: 61 D 61 D Sbjct: 61 D 61 >gi|254513875|ref|ZP_05125936.1| conserved hypothetical protein [gamma proteobacterium NOR5-3] gi|219676118|gb|EED32483.1| conserved hypothetical protein [gamma proteobacterium NOR5-3] Length = 61 Score = 99 bits (249), Expect = 1e-19, Method: Composition-based stats. Identities = 27/57 (47%), Positives = 37/57 (64%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LL ILVCP++K L E EL K + LAYP+R G+P+ML EARQ+ + Sbjct: 1 MLDKKLLSILVCPVSKAPLEYHEEAQELFCKASGLAYPVRDGIPVMLEEEARQLTND 57 >gi|121594648|ref|YP_986544.1| hypothetical protein Ajs_2306 [Acidovorax sp. JS42] gi|222110750|ref|YP_002553014.1| hypothetical protein Dtpsy_1553 [Acidovorax ebreus TPSY] gi|148841349|sp|A1W893|Y2306_ACISJ RecName: Full=UPF0434 protein Ajs_2306 gi|254800557|sp|B9MI82|Y1553_DIAST RecName: Full=UPF0434 protein Dtpsy_1553 gi|120606728|gb|ABM42468.1| protein of unknown function DUF343 [Acidovorax sp. JS42] gi|221730194|gb|ACM33014.1| protein of unknown function DUF343 [Acidovorax ebreus TPSY] Length = 60 Score = 99.5 bits (248), Expect = 1e-19, Method: Composition-based stats. Identities = 31/56 (55%), Positives = 44/56 (78%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +DP+LLE+LVCP+TKG LT E EL+S+ A LAYP+R G+P++L +EAR + D+ Sbjct: 1 MDPKLLELLVCPVTKGPLTYDRERQELISRSARLAYPVRDGIPVLLENEARPLSDE 56 >gi|126439680|ref|YP_001057977.1| hypothetical protein BURPS668_0926 [Burkholderia pseudomallei 668] gi|167737454|ref|ZP_02410228.1| hypothetical protein Bpse14_05283 [Burkholderia pseudomallei 14] gi|166918982|sp|A3N6K6|Y926_BURP6 RecName: Full=UPF0434 protein BURPS668_0926 gi|126219173|gb|ABN82679.1| conserved hypothetical protein [Burkholderia pseudomallei 668] Length = 68 Score = 99.5 bits (248), Expect = 1e-19, Method: Composition-based stats. Identities = 29/52 (55%), Positives = 35/52 (67%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 +D +LLEILVCP+ KG L EL+ LAYPIR G+P+MLV EARQ Sbjct: 1 MDARLLEILVCPICKGPLHYDRGAQELVCHADKLAYPIRDGIPVMLVDEARQ 52 >gi|154251763|ref|YP_001412587.1| hypothetical protein Plav_1310 [Parvibaculum lavamentivorans DS-1] gi|154155713|gb|ABS62930.1| protein of unknown function DUF343 [Parvibaculum lavamentivorans DS-1] Length = 70 Score = 99.5 bits (248), Expect = 1e-19, Method: Composition-based stats. Identities = 34/58 (58%), Positives = 43/58 (74%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +DP+LLEILVCP+TK L E EL+S+KA LA+PIR G+PIML EAR +DD+ Sbjct: 13 MEVDPKLLEILVCPVTKTTLRYDRERQELISEKARLAFPIRDGIPIMLTDEARSLDDE 70 >gi|297537857|ref|YP_003673626.1| hypothetical protein M301_0665 [Methylotenera sp. 301] gi|297257204|gb|ADI29049.1| protein of unknown function DUF343 [Methylotenera sp. 301] Length = 60 Score = 99.5 bits (248), Expect = 1e-19, Method: Composition-based stats. Identities = 29/57 (50%), Positives = 41/57 (71%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LL+ILVCP+TKG L EL+SK A LAYP++ G+P+ML EAR++ D+ Sbjct: 1 MMDTKLLQILVCPVTKGPLIFNKTTNELISKSAGLAYPVKDGIPVMLEEEARKLTDE 57 >gi|115522436|ref|YP_779347.1| hypothetical protein RPE_0408 [Rhodopseudomonas palustris BisA53] gi|122297892|sp|Q07UL7|Y408_RHOP5 RecName: Full=UPF0434 protein RPE_0408 gi|115516383|gb|ABJ04367.1| protein of unknown function DUF343 [Rhodopseudomonas palustris BisA53] Length = 66 Score = 99.2 bits (247), Expect = 2e-19, Method: Composition-based stats. Identities = 31/55 (56%), Positives = 41/55 (74%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 +D +LL+ILVCP+TKG L + EL+S+ A LAYPIR G+PIML EAR++D Sbjct: 12 AVDRKLLDILVCPITKGPLEFDAARQELISRGARLAYPIRDGIPIMLPEEARKID 66 >gi|115352645|ref|YP_774484.1| hypothetical protein Bamb_2594 [Burkholderia ambifaria AMMD] gi|134296731|ref|YP_001120466.1| hypothetical protein Bcep1808_2639 [Burkholderia vietnamiensis G4] gi|170698603|ref|ZP_02889671.1| protein of unknown function DUF343 [Burkholderia ambifaria IOP40-10] gi|171322124|ref|ZP_02910986.1| protein of unknown function DUF343 [Burkholderia ambifaria MEX-5] gi|172061506|ref|YP_001809158.1| hypothetical protein BamMC406_2464 [Burkholderia ambifaria MC40-6] gi|122322392|sp|Q0BCH3|Y2594_BURCM RecName: Full=UPF0434 protein Bamb_2594 gi|166988488|sp|A4JH78|Y2639_BURVG RecName: Full=UPF0434 protein Bcep1808_2639 gi|226701598|sp|B1YVD8|Y2464_BURA4 RecName: Full=UPF0434 protein BamMC406_2464 gi|115282633|gb|ABI88150.1| protein of unknown function DUF343 [Burkholderia ambifaria AMMD] gi|134139888|gb|ABO55631.1| protein of unknown function DUF343 [Burkholderia vietnamiensis G4] gi|170136456|gb|EDT04716.1| protein of unknown function DUF343 [Burkholderia ambifaria IOP40-10] gi|171092564|gb|EDT37878.1| protein of unknown function DUF343 [Burkholderia ambifaria MEX-5] gi|171994023|gb|ACB64942.1| protein of unknown function DUF343 [Burkholderia ambifaria MC40-6] Length = 67 Score = 99.2 bits (247), Expect = 2e-19, Method: Composition-based stats. Identities = 29/52 (55%), Positives = 35/52 (67%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 +D +LLEILVCP+ KG L EL+ LAYPIR G+P+MLV EARQ Sbjct: 1 MDARLLEILVCPICKGPLHYDRAAQELICNADKLAYPIRDGIPVMLVDEARQ 52 >gi|167561815|ref|ZP_02354731.1| hypothetical protein BoklE_04568 [Burkholderia oklahomensis EO147] gi|167569039|ref|ZP_02361913.1| hypothetical protein BoklC_04278 [Burkholderia oklahomensis C6786] Length = 68 Score = 99.2 bits (247), Expect = 2e-19, Method: Composition-based stats. Identities = 29/52 (55%), Positives = 35/52 (67%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 +D +LLEILVCP+ KG L EL+ LAYPIR G+P+MLV EARQ Sbjct: 1 MDARLLEILVCPICKGPLHYDRGAQELVCNADKLAYPIRDGIPVMLVDEARQ 52 >gi|53718516|ref|YP_107502.1| hypothetical protein BPSL0877 [Burkholderia pseudomallei K96243] gi|53725860|ref|YP_103837.1| hypothetical protein BMA2274 [Burkholderia mallei ATCC 23344] gi|67642110|ref|ZP_00440871.1| conserved domain protein [Burkholderia mallei GB8 horse 4] gi|76810385|ref|YP_332494.1| tetraacyldisaccharide-1-P 4-kinase [Burkholderia pseudomallei 1710b] gi|121601253|ref|YP_991918.1| hypothetical protein BMASAVP1_A0570 [Burkholderia mallei SAVP1] gi|124384226|ref|YP_001027033.1| hypothetical protein BMA10229_A1047 [Burkholderia mallei NCTC 10229] gi|126449612|ref|YP_001081682.1| hypothetical protein BMA10247_2152 [Burkholderia mallei NCTC 10247] gi|126454062|ref|YP_001065210.1| hypothetical protein BURPS1106A_0929 [Burkholderia pseudomallei 1106a] gi|134279589|ref|ZP_01766301.1| conserved hypothetical protein [Burkholderia pseudomallei 305] gi|167003881|ref|ZP_02269660.1| conserved hypothetical protein [Burkholderia mallei PRL-20] gi|167718405|ref|ZP_02401641.1| hypothetical protein BpseD_05250 [Burkholderia pseudomallei DM98] gi|167814572|ref|ZP_02446252.1| hypothetical protein Bpse9_05470 [Burkholderia pseudomallei 91] gi|167823044|ref|ZP_02454515.1| hypothetical protein Bpseu9_05171 [Burkholderia pseudomallei 9] gi|167844606|ref|ZP_02470114.1| hypothetical protein BpseB_04896 [Burkholderia pseudomallei B7210] gi|167893139|ref|ZP_02480541.1| hypothetical protein Bpse7_05193 [Burkholderia pseudomallei 7894] gi|167901597|ref|ZP_02488802.1| hypothetical protein BpseN_04918 [Burkholderia pseudomallei NCTC 13177] gi|167909836|ref|ZP_02496927.1| hypothetical protein Bpse112_05039 [Burkholderia pseudomallei 112] gi|167917861|ref|ZP_02504952.1| hypothetical protein BpseBC_04848 [Burkholderia pseudomallei BCC215] gi|217419837|ref|ZP_03451343.1| conserved hypothetical protein [Burkholderia pseudomallei 576] gi|237811125|ref|YP_002895576.1| tetraacyldisaccharide 4'-kinase (Lipid A 4'-kinase) [Burkholderia pseudomallei MSHR346] gi|254181535|ref|ZP_04888132.1| conserved hypothetical protein [Burkholderia pseudomallei 1655] gi|254187493|ref|ZP_04894005.1| conserved hypothetical protein [Burkholderia pseudomallei Pasteur 52237] gi|254196612|ref|ZP_04903036.1| conserved hypothetical protein [Burkholderia pseudomallei S13] gi|254202543|ref|ZP_04908906.1| conserved hypothetical protein [Burkholderia mallei FMH] gi|254207879|ref|ZP_04914229.1| conserved hypothetical protein [Burkholderia mallei JHU] gi|254261785|ref|ZP_04952839.1| conserved hypothetical protein [Burkholderia pseudomallei 1710a] gi|254298211|ref|ZP_04965663.1| conserved hypothetical protein [Burkholderia pseudomallei 406e] gi|254356224|ref|ZP_04972500.1| conserved hypothetical protein [Burkholderia mallei 2002721280] gi|81380248|sp|Q63WL4|Y877_BURPS RecName: Full=UPF0434 protein BPSL0877 gi|81604375|sp|Q62HI3|Y2274_BURMA RecName: Full=UPF0434 protein BMA2274 gi|123600043|sp|Q3JVA9|Y1082_BURP1 RecName: Full=UPF0434 protein BURPS1710b_1082 gi|166918985|sp|A3NS89|Y929_BURP0 RecName: Full=UPF0434 protein BURPS1106A_0929 gi|166987447|sp|A1V115|Y2370_BURMS RecName: Full=UPF0434 protein BMASAVP1_A0570 gi|166990771|sp|A2S514|Y3347_BURM9 RecName: Full=UPF0434 protein BMA10229_A1047 gi|167012963|sp|A3MN46|Y4652_BURM7 RecName: Full=UPF0434 protein BMA10247_2152 gi|52208930|emb|CAH34869.1| conserved hypothetical protein [Burkholderia pseudomallei K96243] gi|52429283|gb|AAU49876.1| conserved hypothetical protein [Burkholderia mallei ATCC 23344] gi|76579838|gb|ABA49313.1| Tetraacyldisaccharide-1-P 4-kinase [Burkholderia pseudomallei 1710b] gi|121230063|gb|ABM52581.1| conserved hypothetical protein [Burkholderia mallei SAVP1] gi|124292246|gb|ABN01515.1| conserved hypothetical protein [Burkholderia mallei NCTC 10229] gi|126227704|gb|ABN91244.1| conserved hypothetical protein [Burkholderia pseudomallei 1106a] gi|126242482|gb|ABO05575.1| conserved hypothetical protein [Burkholderia mallei NCTC 10247] gi|134248789|gb|EBA48871.1| conserved hypothetical protein [Burkholderia pseudomallei 305] gi|147746790|gb|EDK53867.1| conserved hypothetical protein [Burkholderia mallei FMH] gi|147751773|gb|EDK58840.1| conserved hypothetical protein [Burkholderia mallei JHU] gi|148025221|gb|EDK83375.1| conserved hypothetical protein [Burkholderia mallei 2002721280] gi|157808364|gb|EDO85534.1| conserved hypothetical protein [Burkholderia pseudomallei 406e] gi|157935173|gb|EDO90843.1| conserved hypothetical protein [Burkholderia pseudomallei Pasteur 52237] gi|169653355|gb|EDS86048.1| conserved hypothetical protein [Burkholderia pseudomallei S13] gi|184212073|gb|EDU09116.1| conserved hypothetical protein [Burkholderia pseudomallei 1655] gi|217397141|gb|EEC37157.1| conserved hypothetical protein [Burkholderia pseudomallei 576] gi|237506867|gb|ACQ99185.1| tetraacyldisaccharide 4'-kinase (Lipid A 4'-kinase) [Burkholderia pseudomallei MSHR346] gi|238523190|gb|EEP86630.1| conserved domain protein [Burkholderia mallei GB8 horse 4] gi|243060674|gb|EES42860.1| conserved hypothetical protein [Burkholderia mallei PRL-20] gi|254220474|gb|EET09858.1| conserved hypothetical protein [Burkholderia pseudomallei 1710a] Length = 68 Score = 99.2 bits (247), Expect = 2e-19, Method: Composition-based stats. Identities = 29/52 (55%), Positives = 35/52 (67%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 +D +LLEILVCP+ KG L EL+ LAYPIR G+P+MLV EARQ Sbjct: 1 MDARLLEILVCPICKGPLHYDRGAQELVCHADKLAYPIRDGIPVMLVDEARQ 52 >gi|289207780|ref|YP_003459846.1| hypothetical protein TK90_0595 [Thioalkalivibrio sp. K90mix] gi|288943411|gb|ADC71110.1| protein of unknown function DUF343 [Thioalkalivibrio sp. K90mix] Length = 64 Score = 99.2 bits (247), Expect = 2e-19, Method: Composition-based stats. Identities = 30/56 (53%), Positives = 39/56 (69%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LL+ILVCP+TKG L E EL+S A LAYPIR +P+ML EAR + D+ Sbjct: 1 MDKRLLDILVCPVTKGPLKYDRENQELISVSAGLAYPIRDEIPVMLEDEARALSDE 56 >gi|209965779|ref|YP_002298694.1| hypothetical protein RC1_2500 [Rhodospirillum centenum SW] gi|209959245|gb|ACI99881.1| conserved domain protein [Rhodospirillum centenum SW] Length = 67 Score = 98.8 bits (246), Expect = 2e-19, Method: Composition-based stats. Identities = 35/54 (64%), Positives = 43/54 (79%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 +DP+LLEILVCPLTKG L ++ EL+S +A LAYPIR G+PIMLV EAR +D Sbjct: 7 VDPKLLEILVCPLTKGPLRYDADRQELVSDQAKLAYPIRDGIPIMLVDEARPLD 60 >gi|241765213|ref|ZP_04763197.1| protein of unknown function DUF343 [Acidovorax delafieldii 2AN] gi|241365142|gb|EER60014.1| protein of unknown function DUF343 [Acidovorax delafieldii 2AN] Length = 60 Score = 98.8 bits (246), Expect = 2e-19, Method: Composition-based stats. Identities = 30/56 (53%), Positives = 43/56 (76%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLE+LVCP+TKG LT E EL+S+ A LAYP+R G+P++L +EAR + D+ Sbjct: 1 MDSKLLELLVCPVTKGPLTYDRERQELVSRSARLAYPVRDGIPVLLENEARTLTDE 56 >gi|332531101|ref|ZP_08407017.1| hypothetical protein HGR_14129 [Hylemonella gracilis ATCC 19624] gi|332039447|gb|EGI75857.1| hypothetical protein HGR_14129 [Hylemonella gracilis ATCC 19624] Length = 62 Score = 98.8 bits (246), Expect = 2e-19, Method: Composition-based stats. Identities = 30/58 (51%), Positives = 42/58 (72%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 ++D +LLE+LVCP+TKG L + EL S+ A LAYPIR G+P++L SEAR + D+ Sbjct: 1 MSLDTRLLELLVCPVTKGPLEYDRDKQELRSRSARLAYPIRDGIPVLLESEARTLSDE 58 >gi|91785015|ref|YP_560221.1| hypothetical protein Bxe_A0765 [Burkholderia xenovorans LB400] gi|186475305|ref|YP_001856775.1| hypothetical protein Bphy_0537 [Burkholderia phymatum STM815] gi|187925171|ref|YP_001896813.1| protein of unknown function DUF343 [Burkholderia phytofirmans PsJN] gi|209521024|ref|ZP_03269758.1| protein of unknown function DUF343 [Burkholderia sp. H160] gi|295677493|ref|YP_003606017.1| protein of unknown function DUF343 [Burkholderia sp. CCGE1002] gi|296157204|ref|ZP_06840040.1| protein of unknown function DUF343 [Burkholderia sp. Ch1-1] gi|123062599|sp|Q13US0|Y3631_BURXL RecName: Full=UPF0434 protein Bxeno_A3631 gi|226703743|sp|B2T6M2|Y3197_BURPP RecName: Full=UPF0434 protein Bphyt_3197 gi|226707706|sp|B2JDV3|Y537_BURP8 RecName: Full=UPF0434 protein Bphy_0537 gi|91688969|gb|ABE32169.1| Conserved hypothetical protein [Burkholderia xenovorans LB400] gi|184191764|gb|ACC69729.1| protein of unknown function DUF343 [Burkholderia phymatum STM815] gi|187716365|gb|ACD17589.1| protein of unknown function DUF343 [Burkholderia phytofirmans PsJN] gi|209498558|gb|EDZ98679.1| protein of unknown function DUF343 [Burkholderia sp. H160] gi|295437336|gb|ADG16506.1| protein of unknown function DUF343 [Burkholderia sp. CCGE1002] gi|295892540|gb|EFG72322.1| protein of unknown function DUF343 [Burkholderia sp. Ch1-1] Length = 67 Score = 98.8 bits (246), Expect = 2e-19, Method: Composition-based stats. Identities = 29/52 (55%), Positives = 36/52 (69%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 +D +LLEILVCP+ KG L+ EL+ LAYPIR G+P+MLV EARQ Sbjct: 1 MDARLLEILVCPICKGPLSYDRAAQELICNADKLAYPIRDGIPVMLVDEARQ 52 >gi|91974934|ref|YP_567593.1| hypothetical protein RPD_0454 [Rhodopseudomonas palustris BisB5] gi|123722189|sp|Q13DZ7|Y454_RHOPS RecName: Full=UPF0434 protein RPD_0454 gi|91681390|gb|ABE37692.1| protein of unknown function DUF343 [Rhodopseudomonas palustris BisB5] Length = 65 Score = 98.8 bits (246), Expect = 2e-19, Method: Composition-based stats. Identities = 31/54 (57%), Positives = 41/54 (75%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 ++D +LLEILVCP+TKG L + EL+S+ A LAYPIR G+PIML EAR++ Sbjct: 11 SVDRKLLEILVCPVTKGPLEFDAARQELISRGAKLAYPIRDGIPIMLPEEARKL 64 >gi|331006898|ref|ZP_08330146.1| hypothetical protein IMCC1989_844 [gamma proteobacterium IMCC1989] gi|330419298|gb|EGG93716.1| hypothetical protein IMCC1989_844 [gamma proteobacterium IMCC1989] Length = 70 Score = 98.4 bits (245), Expect = 3e-19, Method: Composition-based stats. Identities = 27/56 (48%), Positives = 43/56 (76%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +L+++LVCP+TK +L E EL++ + L+YPIR G+P+ML SEARQ++D+ Sbjct: 1 MDKKLIDLLVCPVTKSSLQYDKEKQELVALASGLSYPIRDGIPVMLESEARQLNDE 56 >gi|329894418|ref|ZP_08270265.1| UPF0434 protein YcaR [gamma proteobacterium IMCC3088] gi|328923065|gb|EGG30389.1| UPF0434 protein YcaR [gamma proteobacterium IMCC3088] Length = 61 Score = 98.4 bits (245), Expect = 3e-19, Method: Composition-based stats. Identities = 29/57 (50%), Positives = 38/57 (66%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEILVCP+TK L + EL+ K + LAYPIR G+P+ML SEAR + Sbjct: 1 MLDKKLLEILVCPVTKAPLEYDEQAQELVCKASGLAYPIRDGIPVMLESEARLLTAD 57 >gi|170693525|ref|ZP_02884684.1| protein of unknown function DUF343 [Burkholderia graminis C4D1M] gi|307730803|ref|YP_003908027.1| hypothetical protein BC1003_2783 [Burkholderia sp. CCGE1003] gi|323527167|ref|YP_004229320.1| hypothetical protein BC1001_2846 [Burkholderia sp. CCGE1001] gi|170141680|gb|EDT09849.1| protein of unknown function DUF343 [Burkholderia graminis C4D1M] gi|307585338|gb|ADN58736.1| protein of unknown function DUF343 [Burkholderia sp. CCGE1003] gi|323384169|gb|ADX56260.1| protein of unknown function DUF343 [Burkholderia sp. CCGE1001] Length = 67 Score = 98.4 bits (245), Expect = 3e-19, Method: Composition-based stats. Identities = 29/52 (55%), Positives = 36/52 (69%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 +D +LLEILVCP+ KG L+ EL+ LAYPIR G+P+MLV EARQ Sbjct: 1 MDARLLEILVCPICKGPLSYDRSAQELICNADKLAYPIRDGIPVMLVDEARQ 52 >gi|78067346|ref|YP_370115.1| hypothetical protein Bcep18194_A5877 [Burkholderia sp. 383] gi|167585669|ref|ZP_02378057.1| hypothetical protein BuboB_10051 [Burkholderia ubonensis Bu] gi|123567792|sp|Q39DJ5|Y5877_BURS3 RecName: Full=UPF0434 protein Bcep18194_A5877 gi|77968091|gb|ABB09471.1| protein of unknown function DUF343 [Burkholderia sp. 383] Length = 64 Score = 98.4 bits (245), Expect = 3e-19, Method: Composition-based stats. Identities = 29/52 (55%), Positives = 35/52 (67%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 +D +LLEILVCP+ KG L EL+ LAYPIR G+P+MLV EARQ Sbjct: 1 MDARLLEILVCPICKGPLHYDRAAQELICNADKLAYPIRDGIPVMLVDEARQ 52 >gi|242317551|ref|ZP_04816567.1| conserved hypothetical protein [Burkholderia pseudomallei 1106b] gi|242140790|gb|EES27192.1| conserved hypothetical protein [Burkholderia pseudomallei 1106b] Length = 68 Score = 98.4 bits (245), Expect = 3e-19, Method: Composition-based stats. Identities = 29/52 (55%), Positives = 35/52 (67%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 +D +LLEILVCP+ KG L EL+ LAYPIR G+P+MLV EARQ Sbjct: 1 MDARLLEILVCPICKGPLHYDRGXQELVCHADKLAYPIRDGIPVMLVDEARQ 52 >gi|161523930|ref|YP_001578942.1| hypothetical protein Bmul_0750 [Burkholderia multivorans ATCC 17616] gi|189351309|ref|YP_001946937.1| tetraacyldisaccharide 4'-kinase [Burkholderia multivorans ATCC 17616] gi|221199217|ref|ZP_03572261.1| tetraacyldisaccharide 4'-kinase (Lipid A 4'-kinase) [Burkholderia multivorans CGD2M] gi|221206586|ref|ZP_03579598.1| tetraacyldisaccharide 4'-kinase (Lipid A 4'-kinase) [Burkholderia multivorans CGD2] gi|221211442|ref|ZP_03584421.1| tetraacyldisaccharide 4'-kinase (Lipid A 4'-kinase) [Burkholderia multivorans CGD1] gi|226701445|sp|A9AGK3|Y2510_BURM1 RecName: Full=UPF0434 protein Bmul_0750/BMULJ_02510 gi|160341359|gb|ABX14445.1| protein of unknown function DUF343 [Burkholderia multivorans ATCC 17616] gi|189335331|dbj|BAG44401.1| tetraacyldisaccharide 4'-kinase [Burkholderia multivorans ATCC 17616] gi|221168803|gb|EEE01271.1| tetraacyldisaccharide 4'-kinase (Lipid A 4'-kinase) [Burkholderia multivorans CGD1] gi|221173241|gb|EEE05676.1| tetraacyldisaccharide 4'-kinase (Lipid A 4'-kinase) [Burkholderia multivorans CGD2] gi|221180502|gb|EEE12905.1| tetraacyldisaccharide 4'-kinase (Lipid A 4'-kinase) [Burkholderia multivorans CGD2M] Length = 64 Score = 98.0 bits (244), Expect = 4e-19, Method: Composition-based stats. Identities = 28/52 (53%), Positives = 35/52 (67%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 +D +LLEILVCP+ KG L EL+ LAYP+R G+P+MLV EARQ Sbjct: 1 MDARLLEILVCPICKGPLHYDRAAQELICNADKLAYPVRDGIPVMLVDEARQ 52 >gi|113866632|ref|YP_725121.1| hypothetical protein H16_A0605 [Ralstonia eutropha H16] gi|123329543|sp|Q0KE18|Y605_RALEH RecName: Full=UPF0434 protein H16_A0605 gi|113525408|emb|CAJ91753.1| conserved hypothetical protein [Ralstonia eutropha H16] Length = 68 Score = 98.0 bits (244), Expect = 4e-19, Method: Composition-based stats. Identities = 29/52 (55%), Positives = 34/52 (65%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 +D +LLEILVCPL KG L EL+ LAYPIR G+P+ML EARQ Sbjct: 1 MDNRLLEILVCPLCKGKLEYDRAAQELICHADKLAYPIRDGIPVMLADEARQ 52 >gi|167835693|ref|ZP_02462576.1| hypothetical protein Bpse38_04313 [Burkholderia thailandensis MSMB43] Length = 65 Score = 98.0 bits (244), Expect = 4e-19, Method: Composition-based stats. Identities = 29/52 (55%), Positives = 35/52 (67%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 +D +LLEILVCP+ KG L EL+ LAYPIR G+P+MLV EARQ Sbjct: 1 MDARLLEILVCPICKGPLHYDRGAQELVCNADKLAYPIRDGIPVMLVDEARQ 52 >gi|298293373|ref|YP_003695312.1| hypothetical protein Snov_3419 [Starkeya novella DSM 506] gi|296929884|gb|ADH90693.1| protein of unknown function DUF343 [Starkeya novella DSM 506] Length = 76 Score = 98.0 bits (244), Expect = 4e-19, Method: Composition-based stats. Identities = 32/60 (53%), Positives = 42/60 (70%) Query: 3 ETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 + IDP+LLE+LVCP+TKG L EL+S++A +AYPIR G+PIML EAR + D Sbjct: 11 RSGHEIDPKLLELLVCPVTKGPLDYDRAAHELISRQARIAYPIRDGIPIMLADEARPLTD 70 >gi|71737808|ref|YP_273872.1| tetraacyldisaccharide 4'-kinase [Pseudomonas syringae pv. phaseolicola 1448A] gi|71558361|gb|AAZ37572.1| Tetraacyldisaccharide-1-P 4''''-kinase [Pseudomonas syringae pv. phaseolicola 1448A] Length = 68 Score = 98.0 bits (244), Expect = 4e-19, Method: Composition-based stats. Identities = 31/63 (49%), Positives = 43/63 (68%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 M + +D +LL+IL CP+ KG L L ++ TEL+SK A LAYP+R G+P+ML SEAR + Sbjct: 1 MIASGSPMDTKLLDILACPVCKGPLKLSADKTELISKGAGLAYPVRDGIPVMLESEARTL 60 Query: 61 DDQ 63 Sbjct: 61 STD 63 >gi|255261362|ref|ZP_05340704.1| conserved domain protein [Thalassiobium sp. R2A62] gi|255103697|gb|EET46371.1| conserved domain protein [Thalassiobium sp. R2A62] Length = 61 Score = 98.0 bits (244), Expect = 4e-19, Method: Composition-based stats. Identities = 30/61 (49%), Positives = 41/61 (67%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 M + DP++LE LVCP T L+ + EL+SK A LA+PIR+G+P+MLV EAR + Sbjct: 1 MSDFENAFDPKMLEFLVCPETHATLSYDAARQELVSKGAKLAFPIRNGIPVMLVDEARTL 60 Query: 61 D 61 D Sbjct: 61 D 61 >gi|254480028|ref|ZP_05093276.1| conserved hypothetical protein [marine gamma proteobacterium HTCC2148] gi|214039590|gb|EEB80249.1| conserved hypothetical protein [marine gamma proteobacterium HTCC2148] Length = 61 Score = 97.6 bits (243), Expect = 5e-19, Method: Composition-based stats. Identities = 27/57 (47%), Positives = 38/57 (66%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 ID +LL ILVCP++K L + EL+ K + LAYP+R G+P+ML +EARQ+ Sbjct: 1 MIDKKLLSILVCPVSKAPLEYDQDKDELVCKASGLAYPVRDGIPVMLETEARQLTAD 57 >gi|85714120|ref|ZP_01045109.1| hypothetical protein NB311A_08188 [Nitrobacter sp. Nb-311A] gi|85699246|gb|EAQ37114.1| hypothetical protein NB311A_08188 [Nitrobacter sp. Nb-311A] Length = 100 Score = 97.6 bits (243), Expect = 5e-19, Method: Composition-based stats. Identities = 32/55 (58%), Positives = 41/55 (74%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 +DP+LLEILVCP+TKG L EL+S+ A LAYPIR G+PIML EAR+++ Sbjct: 46 TVDPKLLEILVCPVTKGPLEFDGRRQELISRSARLAYPIRDGIPIMLPEEARKIE 100 >gi|148251914|ref|YP_001236499.1| hypothetical protein BBta_0300 [Bradyrhizobium sp. BTAi1] gi|226703723|sp|A5E8U9|Y300_BRASB RecName: Full=UPF0434 protein BBta_0300 gi|146404087|gb|ABQ32593.1| hypothetical protein BBta_0300 [Bradyrhizobium sp. BTAi1] Length = 65 Score = 97.6 bits (243), Expect = 5e-19, Method: Composition-based stats. Identities = 32/60 (53%), Positives = 43/60 (71%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 + ++DP+LLEILVCP+TKG L + EL+S+ A LAYPIR G+PIML EAR++ Sbjct: 5 LDRPANSVDPKLLEILVCPMTKGPLEYDAAKQELISRSAKLAYPIRDGIPIMLPEEARKI 64 >gi|330991707|ref|ZP_08315657.1| UPF0434 protein [Gluconacetobacter sp. SXCC-1] gi|329761175|gb|EGG77669.1| UPF0434 protein [Gluconacetobacter sp. SXCC-1] Length = 85 Score = 97.6 bits (243), Expect = 5e-19, Method: Composition-based stats. Identities = 34/63 (53%), Positives = 44/63 (69%), Gaps = 2/63 (3%) Query: 1 MRE--TIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEAR 58 M E T +DP+LL ILVCP+TKG L E EL+SK+A LA+P+R G+PIML EAR Sbjct: 22 MTEKPTAPPLDPRLLSILVCPVTKGPLVYDREAGELISKRAGLAFPVRDGIPIMLPDEAR 81 Query: 59 QVD 61 ++ Sbjct: 82 HIE 84 >gi|315126706|ref|YP_004068709.1| hypothetical protein PSM_A1631 [Pseudoalteromonas sp. SM9913] gi|315015220|gb|ADT68558.1| hypothetical protein PSM_A1631 [Pseudoalteromonas sp. SM9913] Length = 65 Score = 97.6 bits (243), Expect = 5e-19, Method: Composition-based stats. Identities = 25/58 (43%), Positives = 37/58 (63%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 D +LLEI+ CP+ KG L E EL+S A LAYP+R +P++L +EAR++ + Sbjct: 1 MAFDTKLLEIIACPVCKGKLRFDKENQELISTAAKLAYPVRDDIPVLLENEARELSLE 58 >gi|162146014|ref|YP_001600472.1| hypothetical protein GDI_0182 [Gluconacetobacter diazotrophicus PAl 5] gi|209544393|ref|YP_002276622.1| hypothetical protein Gdia_2252 [Gluconacetobacter diazotrophicus PAl 5] gi|226696093|sp|A9H298|Y182_GLUDA RecName: Full=UPF0434 protein GDI0182/Gdia_2252 gi|161784588|emb|CAP54125.1| conserved hypothetical protein [Gluconacetobacter diazotrophicus PAl 5] gi|209532070|gb|ACI52007.1| protein of unknown function DUF343 [Gluconacetobacter diazotrophicus PAl 5] Length = 63 Score = 97.2 bits (242), Expect = 6e-19, Method: Composition-based stats. Identities = 34/62 (54%), Positives = 44/62 (70%), Gaps = 1/62 (1%) Query: 1 MRETIFN-IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 M ET +DP+LL +LVCP+TKG L E EL+S++A LA+PIR G+PIML EAR Sbjct: 1 MTETAQAPLDPRLLSVLVCPVTKGPLIYDREAGELISRQAGLAFPIRDGIPIMLPDEARP 60 Query: 60 VD 61 +D Sbjct: 61 LD 62 >gi|254780739|ref|YP_003065152.1| hypothetical protein CLIBASIA_03130 [Candidatus Liberibacter asiaticus str. psy62] gi|254040416|gb|ACT57212.1| hypothetical protein CLIBASIA_03130 [Candidatus Liberibacter asiaticus str. psy62] Length = 64 Score = 97.2 bits (242), Expect = 6e-19, Method: Composition-based stats. Identities = 64/64 (100%), Positives = 64/64 (100%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV Sbjct: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 Query: 61 DDQG 64 DDQG Sbjct: 61 DDQG 64 >gi|121604824|ref|YP_982153.1| hypothetical protein Pnap_1922 [Polaromonas naphthalenivorans CJ2] gi|148841341|sp|A1VNK4|Y1922_POLNA RecName: Full=UPF0434 protein Pnap_1922 gi|120593793|gb|ABM37232.1| protein of unknown function DUF343 [Polaromonas naphthalenivorans CJ2] Length = 60 Score = 97.2 bits (242), Expect = 6e-19, Method: Composition-based stats. Identities = 30/56 (53%), Positives = 43/56 (76%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLE+LVCP+TKG+L E EL+S+ A LAYP+R G+P+ML +EAR + D+ Sbjct: 1 MDTKLLELLVCPVTKGHLEYDREKHELISRSARLAYPVRDGIPVMLENEARTLTDE 56 >gi|146337470|ref|YP_001202518.1| hypothetical protein BRADO0313 [Bradyrhizobium sp. ORS278] gi|226703727|sp|A4YK44|Y313_BRASO RecName: Full=UPF0434 protein BRADO0313 gi|146190276|emb|CAL74270.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278] Length = 65 Score = 97.2 bits (242), Expect = 6e-19, Method: Composition-based stats. Identities = 33/61 (54%), Positives = 44/61 (72%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 + ++DP+LLEILVCP+TKG L + EL+S+ A LAYPIR G+PIML EAR++ Sbjct: 5 LERPANSVDPKLLEILVCPMTKGPLEYDAARQELISRSAKLAYPIRDGIPIMLPEEARKI 64 Query: 61 D 61 D Sbjct: 65 D 65 >gi|94309479|ref|YP_582689.1| hypothetical protein Rmet_0534 [Cupriavidus metallidurans CH34] gi|148841368|sp|Q1LR06|Y534_RALME RecName: Full=UPF0434 protein Rmet_0534 gi|93353331|gb|ABF07420.1| conserved hypothetical protein [Cupriavidus metallidurans CH34] Length = 69 Score = 97.2 bits (242), Expect = 6e-19, Method: Composition-based stats. Identities = 29/52 (55%), Positives = 34/52 (65%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 +D +LLEILVCPL KG L EL+ LAYPIR G+P+ML EARQ Sbjct: 1 MDNRLLEILVCPLCKGKLEYDRAAQELICHADKLAYPIRDGIPVMLADEARQ 52 >gi|241758505|ref|ZP_04756624.1| tetraacyldisaccharide 4'-kinase [Neisseria flavescens SK114] gi|241321340|gb|EER57488.1| tetraacyldisaccharide 4'-kinase [Neisseria flavescens SK114] Length = 66 Score = 97.2 bits (242), Expect = 7e-19, Method: Composition-based stats. Identities = 27/56 (48%), Positives = 40/56 (71%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 ++ + L+ILVCP+TKG L + EL S++A LAYPIR G+P ML +EAR + ++ Sbjct: 1 MEKKFLDILVCPVTKGKLEYHQDKQELWSRQAKLAYPIRDGIPYMLENEARALSEE 56 >gi|90579513|ref|ZP_01235322.1| hypothetical protein VAS14_01086 [Vibrio angustum S14] gi|90439087|gb|EAS64269.1| hypothetical protein VAS14_01086 [Vibrio angustum S14] Length = 59 Score = 97.2 bits (242), Expect = 7e-19, Method: Composition-based stats. Identities = 25/56 (44%), Positives = 36/56 (64%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ KG L+ E EL+ K LAYPI+ G+P++L EAR + Sbjct: 1 MDHRLLEIVACPVCKGKLSYDKENNELVCKFDRLAYPIKDGIPVLLEPEARTLSSD 56 >gi|296117202|ref|ZP_06835795.1| hypothetical protein GXY_15342 [Gluconacetobacter hansenii ATCC 23769] gi|295976297|gb|EFG83082.1| hypothetical protein GXY_15342 [Gluconacetobacter hansenii ATCC 23769] Length = 64 Score = 96.8 bits (241), Expect = 8e-19, Method: Composition-based stats. Identities = 33/59 (55%), Positives = 42/59 (71%) Query: 4 TIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 T +DP+LL +LVCP+TKG L E EL+SK A LA+PIR G+PIML EAR++ D Sbjct: 6 TFPPLDPRLLSVLVCPVTKGPLVYDREAGELISKGAGLAFPIRDGIPIMLPDEARRLTD 64 >gi|182679646|ref|YP_001833792.1| hypothetical protein Bind_2731 [Beijerinckia indica subsp. indica ATCC 9039] gi|182635529|gb|ACB96303.1| protein of unknown function DUF343 [Beijerinckia indica subsp. indica ATCC 9039] Length = 85 Score = 96.8 bits (241), Expect = 8e-19, Method: Composition-based stats. Identities = 34/55 (61%), Positives = 41/55 (74%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 IDP+LLEILVCPLTK L + EL+S+ A LAYPIR G+PIML EAR ++D Sbjct: 31 IDPRLLEILVCPLTKTTLEYDASRQELISRAAKLAYPIRDGIPIMLPEEARPLED 85 >gi|221066459|ref|ZP_03542564.1| protein of unknown function DUF343 [Comamonas testosteroni KF-1] gi|264678967|ref|YP_003278874.1| hypothetical protein CtCNB1_2832 [Comamonas testosteroni CNB-2] gi|299530070|ref|ZP_07043497.1| hypothetical protein CTS44_04824 [Comamonas testosteroni S44] gi|220711482|gb|EED66850.1| protein of unknown function DUF343 [Comamonas testosteroni KF-1] gi|262209480|gb|ACY33578.1| hypothetical conserved protein [Comamonas testosteroni CNB-2] gi|298722050|gb|EFI62980.1| hypothetical protein CTS44_04824 [Comamonas testosteroni S44] Length = 63 Score = 96.8 bits (241), Expect = 8e-19, Method: Composition-based stats. Identities = 29/56 (51%), Positives = 40/56 (71%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLE+LVCP+TKG L E EL+S A LAYP+R G+P++L +EAR + D Sbjct: 1 MDAKLLELLVCPVTKGPLRFDREHQELISHSARLAYPVRDGIPVLLENEARTLSDD 56 >gi|88706723|ref|ZP_01104425.1| protein containing DUF343 [Congregibacter litoralis KT71] gi|88699044|gb|EAQ96161.1| protein containing DUF343 [Congregibacter litoralis KT71] Length = 61 Score = 96.8 bits (241), Expect = 8e-19, Method: Composition-based stats. Identities = 26/57 (45%), Positives = 35/57 (61%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LL ILVCP++K L EL K + LAYP+R G+P+ML EARQ+ Sbjct: 1 MLDKKLLSILVCPVSKAPLEYHEASEELFCKASGLAYPVRDGIPVMLEEEARQLTAD 57 >gi|107023483|ref|YP_621810.1| hypothetical protein Bcen_1934 [Burkholderia cenocepacia AU 1054] gi|116690566|ref|YP_836189.1| hypothetical protein Bcen2424_2546 [Burkholderia cenocepacia HI2424] gi|170733906|ref|YP_001765853.1| hypothetical protein Bcenmc03_2570 [Burkholderia cenocepacia MC0-3] gi|206561097|ref|YP_002231862.1| hypothetical protein BCAL2760 [Burkholderia cenocepacia J2315] gi|123244766|sp|Q1BU68|Y1934_BURCA RecName: Full=UPF0434 protein Bcen_1934 gi|148841354|sp|A0K9W9|Y2546_BURCH RecName: Full=UPF0434 protein Bcen2424_2546 gi|226701494|sp|B4E9F9|Y2698_BURCJ RecName: Full=UPF0434 protein BceJ2315_26980 gi|226701616|sp|B1JXF6|Y2570_BURCC RecName: Full=UPF0434 protein Bcenmc03_2570 gi|105893672|gb|ABF76837.1| protein of unknown function DUF343 [Burkholderia cenocepacia AU 1054] gi|116648655|gb|ABK09296.1| protein of unknown function DUF343 [Burkholderia cenocepacia HI2424] gi|169817148|gb|ACA91731.1| protein of unknown function DUF343 [Burkholderia cenocepacia MC0-3] gi|198037139|emb|CAR53060.1| conserved hypothetical protein [Burkholderia cenocepacia J2315] Length = 64 Score = 96.8 bits (241), Expect = 8e-19, Method: Composition-based stats. Identities = 28/52 (53%), Positives = 35/52 (67%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 +D +LLEI+VCP+ KG L EL+ LAYPIR G+P+MLV EARQ Sbjct: 1 MDARLLEIIVCPICKGPLHYDRAAQELICNADKLAYPIRDGIPVMLVDEARQ 52 >gi|86747420|ref|YP_483916.1| hypothetical protein RPB_0294 [Rhodopseudomonas palustris HaA2] gi|123293307|sp|Q2J3F5|Y294_RHOP2 RecName: Full=UPF0434 protein RPB_0294 gi|86570448|gb|ABD05005.1| Protein of unknown function DUF343 [Rhodopseudomonas palustris HaA2] Length = 65 Score = 96.8 bits (241), Expect = 9e-19, Method: Composition-based stats. Identities = 31/54 (57%), Positives = 41/54 (75%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 ++D +LLEILVCP+TKG L + EL+S+ A LAYPIR G+PIML EAR++ Sbjct: 11 SVDRKLLEILVCPVTKGPLEFDAARQELISRGAKLAYPIRDGIPIMLPEEARKL 64 >gi|78485303|ref|YP_391228.1| hypothetical protein Tcr_0959 [Thiomicrospira crunogena XCL-2] gi|123555613|sp|Q31H19|Y959_THICR RecName: Full=UPF0434 protein Tcr_0959 gi|78363589|gb|ABB41554.1| conserved hypothetical protein with DUF 343 [Thiomicrospira crunogena XCL-2] Length = 67 Score = 96.8 bits (241), Expect = 9e-19, Method: Composition-based stats. Identities = 29/56 (51%), Positives = 40/56 (71%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +DP+LL+ILVCP+TK L L EL+S A+LA+P+R G+PIML EAR + + Sbjct: 1 MDPKLLDILVCPVTKTPLQLDKAQQELISTAANLAFPVRDGIPIMLEEEARTLTAE 56 >gi|27375713|ref|NP_767242.1| hypothetical protein bsr0602 [Bradyrhizobium japonicum USDA 110] gi|81740208|sp|Q89WS6|Y601_BRAJA RecName: Full=UPF0434 protein bsr0601 gi|27348851|dbj|BAC45867.1| bsr0601 [Bradyrhizobium japonicum USDA 110] Length = 65 Score = 96.8 bits (241), Expect = 9e-19, Method: Composition-based stats. Identities = 35/55 (63%), Positives = 43/55 (78%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 ++DP+LLEILVCPLTKG L S EL+S+ A LAYPIR G+PIML EAR++D Sbjct: 11 SVDPKLLEILVCPLTKGPLEFDSAKQELISRSAKLAYPIRDGIPIMLPEEARKID 65 >gi|323138538|ref|ZP_08073606.1| protein of unknown function DUF343 [Methylocystis sp. ATCC 49242] gi|322396172|gb|EFX98705.1| protein of unknown function DUF343 [Methylocystis sp. ATCC 49242] Length = 75 Score = 96.8 bits (241), Expect = 1e-18, Method: Composition-based stats. Identities = 35/54 (64%), Positives = 40/54 (74%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 IDP+LLEILVCPLTK L EL+S+ A LAYPIR G+PIML EARQ+D Sbjct: 22 IDPRLLEILVCPLTKTTLEYDRTKQELISRSARLAYPIRDGIPIMLPEEARQID 75 >gi|238028446|ref|YP_002912677.1| hypothetical protein bglu_1g29100 [Burkholderia glumae BGR1] gi|237877640|gb|ACR29973.1| Hypothetical protein bglu_1g29100 [Burkholderia glumae BGR1] Length = 68 Score = 96.5 bits (240), Expect = 1e-18, Method: Composition-based stats. Identities = 28/52 (53%), Positives = 35/52 (67%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 +D +LLEI+VCP+ KG L EL+ LAYPIR G+P+MLV EARQ Sbjct: 1 MDARLLEIIVCPICKGPLHHDRAAQELICHADKLAYPIRDGIPVMLVDEARQ 52 >gi|213969769|ref|ZP_03397904.1| Tetraacyldisaccharide-1-P 4''''-kinase [Pseudomonas syringae pv. tomato T1] gi|213925577|gb|EEB59137.1| Tetraacyldisaccharide-1-P 4''''-kinase [Pseudomonas syringae pv. tomato T1] Length = 68 Score = 96.5 bits (240), Expect = 1e-18, Method: Composition-based stats. Identities = 31/63 (49%), Positives = 43/63 (68%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 M + +D +LL+IL CP+ KG L L ++ TEL+SK A LAYP+R G+P+ML SEAR + Sbjct: 1 MIASGSPMDTKLLDILACPICKGPLKLSADKTELISKGAGLAYPVRDGIPVMLESEARTL 60 Query: 61 DDQ 63 Sbjct: 61 TTD 63 >gi|89075811|ref|ZP_01162195.1| hypothetical protein SKA34_15598 [Photobacterium sp. SKA34] gi|89048432|gb|EAR54008.1| hypothetical protein SKA34_15598 [Photobacterium sp. SKA34] Length = 59 Score = 96.5 bits (240), Expect = 1e-18, Method: Composition-based stats. Identities = 24/56 (42%), Positives = 36/56 (64%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ KG L+ + EL+ K LAYPI+ G+P++L EAR + Sbjct: 1 MDHRLLEIVACPVCKGKLSYDKKNNELVCKFDRLAYPIKDGIPVLLEPEARTLSSD 56 >gi|148556567|ref|YP_001264149.1| hypothetical protein Swit_3665 [Sphingomonas wittichii RW1] gi|148501757|gb|ABQ70011.1| protein of unknown function DUF343 [Sphingomonas wittichii RW1] Length = 61 Score = 96.5 bits (240), Expect = 1e-18, Method: Composition-based stats. Identities = 29/61 (47%), Positives = 41/61 (67%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 M + ++DP+LL ILVCP+T+ L EL+S A LA+PIR+GVP+ML+ EAR + Sbjct: 1 MNDRTTSLDPELLAILVCPVTRTPLRYDEAAGELVSDAAGLAFPIRNGVPVMLIEEARAL 60 Query: 61 D 61 Sbjct: 61 S 61 >gi|90421790|ref|YP_530160.1| hypothetical protein RPC_0266 [Rhodopseudomonas palustris BisB18] gi|122477645|sp|Q21CP5|Y266_RHOPB RecName: Full=UPF0434 protein RPC_0266 gi|90103804|gb|ABD85841.1| protein of unknown function DUF343 [Rhodopseudomonas palustris BisB18] Length = 66 Score = 96.5 bits (240), Expect = 1e-18, Method: Composition-based stats. Identities = 30/53 (56%), Positives = 40/53 (75%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 +D +LL+ILVCP+TKG L + EL+S+ A LAYPIR G+PIML EAR++ Sbjct: 13 VDRKLLDILVCPITKGPLEFDAARQELISRGAKLAYPIRDGIPIMLPEEARKL 65 >gi|319793943|ref|YP_004155583.1| hypothetical protein Varpa_3287 [Variovorax paradoxus EPS] gi|315596406|gb|ADU37472.1| protein of unknown function DUF343 [Variovorax paradoxus EPS] Length = 60 Score = 96.5 bits (240), Expect = 1e-18, Method: Composition-based stats. Identities = 30/56 (53%), Positives = 43/56 (76%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLE+LVCP+TKG LT +E EL S+ A LAYP+R G+P++L +EAR + D+ Sbjct: 1 MDTKLLELLVCPVTKGPLTWNAEKQELCSRSARLAYPVRDGIPVLLENEARTLSDE 56 >gi|283138912|gb|ADB12515.1| hypothetical protein [uncultured bacterium 9F08] Length = 59 Score = 96.1 bits (239), Expect = 1e-18, Method: Composition-based stats. Identities = 27/53 (50%), Positives = 34/53 (64%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 +D +LLEILVCP+ KG L EL+ K LAYPIR +P+ML EAR + Sbjct: 1 MDKKLLEILVCPVCKGPLIYNKAHQELICKADRLAYPIRDDIPVMLEEEARTL 53 >gi|326317452|ref|YP_004235124.1| hypothetical protein Acav_2645 [Acidovorax avenae subsp. avenae ATCC 19860] gi|323374288|gb|ADX46557.1| protein of unknown function DUF343 [Acidovorax avenae subsp. avenae ATCC 19860] Length = 60 Score = 96.1 bits (239), Expect = 1e-18, Method: Composition-based stats. Identities = 31/55 (56%), Positives = 43/55 (78%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 +DP+LLE+LVCP+TKG LT E EL+S+ A LAYP+R G+P++L +EAR + D Sbjct: 1 MDPKLLELLVCPVTKGPLTYDRERDELVSRSARLAYPVRDGIPVLLETEARTLTD 55 >gi|253998353|ref|YP_003050416.1| hypothetical protein Msip34_0641 [Methylovorus sp. SIP3-4] gi|253985032|gb|ACT49889.1| protein of unknown function DUF343 [Methylovorus sp. SIP3-4] Length = 59 Score = 96.1 bits (239), Expect = 1e-18, Method: Composition-based stats. Identities = 29/55 (52%), Positives = 38/55 (69%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 +D +LL+ILVCP+ KG L E EL+ K LAYPIR G+P+ML EAR++ D Sbjct: 1 MDAKLLDILVCPVCKGPLVFKKEAQELVCKPCRLAYPIRDGIPVMLEEEARRLAD 55 >gi|330818110|ref|YP_004361815.1| hypothetical protein bgla_1g32530 [Burkholderia gladioli BSR3] gi|327370503|gb|AEA61859.1| hypothetical protein bgla_1g32530 [Burkholderia gladioli BSR3] Length = 68 Score = 96.1 bits (239), Expect = 2e-18, Method: Composition-based stats. Identities = 28/52 (53%), Positives = 35/52 (67%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 +D +LLEI+VCP+ KG L EL+ LAYPIR G+P+MLV EARQ Sbjct: 1 MDARLLEIIVCPICKGPLQHDRAAQELICHADKLAYPIRDGIPVMLVDEARQ 52 >gi|332716428|ref|YP_004443894.1| hypothetical protein AGROH133_11978 [Agrobacterium sp. H13-3] gi|325063113|gb|ADY66803.1| hypothetical protein AGROH133_11978 [Agrobacterium sp. H13-3] Length = 62 Score = 96.1 bits (239), Expect = 2e-18, Method: Composition-based stats. Identities = 37/62 (59%), Positives = 48/62 (77%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 M + + N DP+LLE+LVCPLTKG L+ EL+S+ A LAYPIR GVPIML+SEAR++ Sbjct: 1 MDDRMSNADPKLLELLVCPLTKGRLSYDRARNELVSESAGLAYPIRDGVPIMLISEARKL 60 Query: 61 DD 62 +D Sbjct: 61 ED 62 >gi|217978023|ref|YP_002362170.1| protein of unknown function DUF343 [Methylocella silvestris BL2] gi|217503399|gb|ACK50808.1| protein of unknown function DUF343 [Methylocella silvestris BL2] Length = 69 Score = 96.1 bits (239), Expect = 2e-18, Method: Composition-based stats. Identities = 33/55 (60%), Positives = 40/55 (72%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 +DP+LLEILVCP TK L +E EL+S+ A LAYPIR G+PIML EAR + D Sbjct: 15 VDPRLLEILVCPRTKTTLEYDAENQELISRAAKLAYPIRDGIPIMLPEEARPLQD 69 >gi|83945807|ref|ZP_00958150.1| hypothetical protein OA2633_11238 [Oceanicaulis alexandrii HTCC2633] gi|83850810|gb|EAP88672.1| hypothetical protein OA2633_11238 [Oceanicaulis alexandrii HTCC2633] Length = 65 Score = 96.1 bits (239), Expect = 2e-18, Method: Composition-based stats. Identities = 34/61 (55%), Positives = 43/61 (70%) Query: 2 RETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 + +DP+LLEILVCP+++G L EL+SK+A LAYPIR GVPIML EAR +D Sbjct: 5 KTEQSALDPKLLEILVCPVSRGPLEYDRAANELISKEARLAYPIREGVPIMLPEEARNLD 64 Query: 62 D 62 D Sbjct: 65 D 65 >gi|170747270|ref|YP_001753530.1| hypothetical protein Mrad2831_0837 [Methylobacterium radiotolerans JCM 2831] gi|170653792|gb|ACB22847.1| protein of unknown function DUF343 [Methylobacterium radiotolerans JCM 2831] Length = 68 Score = 96.1 bits (239), Expect = 2e-18, Method: Composition-based stats. Identities = 35/55 (63%), Positives = 41/55 (74%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 +DP+LLEILVCPLTKG L S EL+S+ A LAYPIR G+PIML EAR + D Sbjct: 14 VDPKLLEILVCPLTKGTLEYDSARQELISRSAKLAYPIRDGIPIMLPEEARPLID 68 >gi|120611232|ref|YP_970910.1| hypothetical protein Aave_2563 [Acidovorax citrulli AAC00-1] gi|148841355|sp|A1TQ98|Y2563_ACIAC RecName: Full=UPF0434 protein Aave_2563 gi|120589696|gb|ABM33136.1| protein of unknown function DUF343 [Acidovorax citrulli AAC00-1] Length = 60 Score = 95.7 bits (238), Expect = 2e-18, Method: Composition-based stats. Identities = 31/55 (56%), Positives = 43/55 (78%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 +DP+LLE+LVCP+TKG LT E EL+S+ A LAYP+R G+P++L +EAR + D Sbjct: 1 MDPKLLELLVCPVTKGPLTYDRERDELVSRSARLAYPVRDGIPVLLETEARPLTD 55 >gi|90416727|ref|ZP_01224657.1| hypothetical protein GB2207_03729 [marine gamma proteobacterium HTCC2207] gi|90331480|gb|EAS46716.1| hypothetical protein GB2207_03729 [marine gamma proteobacterium HTCC2207] Length = 69 Score = 95.7 bits (238), Expect = 2e-18, Method: Composition-based stats. Identities = 25/56 (44%), Positives = 36/56 (64%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LL ILVCP++K L EL+ + + LAYPI G+P+ML SEAR++ Sbjct: 6 VDKKLLSILVCPVSKAPLEYDKAKQELVCRASGLAYPISEGIPVMLESEARKLTAD 61 >gi|254786778|ref|YP_003074207.1| hypothetical protein TERTU_2813 [Teredinibacter turnerae T7901] gi|259646910|sp|C5BMQ2|Y2813_TERTT RecName: Full=UPF0434 protein TERTU_2813 gi|237685270|gb|ACR12534.1| conserved domain protein [Teredinibacter turnerae T7901] Length = 64 Score = 95.7 bits (238), Expect = 2e-18, Method: Composition-based stats. Identities = 26/57 (45%), Positives = 40/57 (70%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 ID +LL ILVCP++K L +++ EL+ + LAYPIR G+P+ML +EAR++ + Sbjct: 1 MIDQKLLSILVCPVSKAPLEFVADKQELVCAASGLAYPIRDGIPVMLETEARELTLE 57 >gi|194288707|ref|YP_002004614.1| hypothetical protein RALTA_A0561 [Cupriavidus taiwanensis LMG 19424] gi|226707737|sp|B3R0X9|Y561_CUPTR RecName: Full=UPF0434 protein RALTA_A0561 gi|193222542|emb|CAQ68545.1| conserved hypothetical protein, DUF343 [Cupriavidus taiwanensis LMG 19424] Length = 67 Score = 95.7 bits (238), Expect = 2e-18, Method: Composition-based stats. Identities = 29/52 (55%), Positives = 34/52 (65%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 +D +LLEILVCPL KG L EL+ LAYPIR G+P+ML EARQ Sbjct: 1 MDNRLLEILVCPLCKGKLEYDRAAQELICHADKLAYPIRDGIPVMLADEARQ 52 >gi|307943870|ref|ZP_07659214.1| conserved domain protein [Roseibium sp. TrichSKD4] gi|307773500|gb|EFO32717.1| conserved domain protein [Roseibium sp. TrichSKD4] Length = 71 Score = 95.7 bits (238), Expect = 2e-18, Method: Composition-based stats. Identities = 32/55 (58%), Positives = 43/55 (78%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 +D +LLE+LVCP+TK L +EG EL+S+ A LAYPIR+G+PIML EAR +D+ Sbjct: 17 LDRKLLELLVCPVTKTTLHYDAEGQELVSRAAKLAYPIRNGIPIMLPEEARALDE 71 >gi|83645481|ref|YP_433916.1| hypothetical protein HCH_02705 [Hahella chejuensis KCTC 2396] gi|123533351|sp|Q2SIN3|Y2705_HAHCH RecName: Full=UPF0434 protein HCH_02705 gi|83633524|gb|ABC29491.1| uncharacterized conserved protein [Hahella chejuensis KCTC 2396] Length = 60 Score = 95.7 bits (238), Expect = 2e-18, Method: Composition-based stats. Identities = 25/56 (44%), Positives = 35/56 (62%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LL IL CP+ KG+L E EL+ K +A+PIR G+P+ML EAR + Sbjct: 1 MDKKLLAILACPVCKGDLKYDREKQELVCKNDGMAFPIRDGIPVMLEKEARTLTTD 56 >gi|91788810|ref|YP_549762.1| hypothetical protein Bpro_2950 [Polaromonas sp. JS666] gi|122967658|sp|Q129C8|Y2950_POLSJ RecName: Full=UPF0434 protein Bpro_2950 gi|91698035|gb|ABE44864.1| protein of unknown function DUF343 [Polaromonas sp. JS666] Length = 60 Score = 95.7 bits (238), Expect = 2e-18, Method: Composition-based stats. Identities = 30/56 (53%), Positives = 42/56 (75%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLE+LVCP+TKG L E EL+S+ A LAYP+R G+P++L SEAR + D+ Sbjct: 1 MDTKLLELLVCPVTKGPLVYDREKQELISRSARLAYPVRDGLPVLLESEARTLTDE 56 >gi|17937403|ref|NP_534192.1| hypothetical protein Atu3696 [Agrobacterium tumefaciens str. C58] gi|81489029|sp|Q8U9N0|Y3696_AGRT5 RecName: Full=UPF0434 protein Atu3696 gi|17742118|gb|AAL44508.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58] Length = 62 Score = 95.7 bits (238), Expect = 2e-18, Method: Composition-based stats. Identities = 36/62 (58%), Positives = 49/62 (79%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 M + + N+DP+LLE+LVCPLTKG L+ EL+S+ A LAYPIR GVPIML+SEAR++ Sbjct: 1 MDDRMSNVDPKLLELLVCPLTKGRLSYDRTHNELISESARLAYPIRDGVPIMLISEARKI 60 Query: 61 DD 62 ++ Sbjct: 61 EE 62 >gi|292490657|ref|YP_003526096.1| hypothetical protein Nhal_0525 [Nitrosococcus halophilus Nc4] gi|291579252|gb|ADE13709.1| protein of unknown function DUF343 [Nitrosococcus halophilus Nc4] Length = 59 Score = 95.7 bits (238), Expect = 2e-18, Method: Composition-based stats. Identities = 27/56 (48%), Positives = 36/56 (64%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEIL CP+ K +L EL+ K LAYPIR +P+ML EARQ+D + Sbjct: 1 MDKKLLEILACPVCKSSLVYQKANQELICKACRLAYPIRDDIPVMLEEEARQLDPE 56 >gi|89901925|ref|YP_524396.1| hypothetical protein Rfer_3156 [Rhodoferax ferrireducens T118] gi|122478573|sp|Q21TN8|Y3156_RHOFD RecName: Full=UPF0434 protein Rfer_3156 gi|89346662|gb|ABD70865.1| protein of unknown function DUF343 [Rhodoferax ferrireducens T118] Length = 60 Score = 95.7 bits (238), Expect = 2e-18, Method: Composition-based stats. Identities = 32/56 (57%), Positives = 41/56 (73%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLE+LVCP+TKG L E EL S+ A LAYP+R GVPI+L SEAR + D+ Sbjct: 1 MDTRLLELLVCPVTKGPLEYNREKQELTSRSARLAYPVRDGVPILLESEARTLSDE 56 >gi|39933346|ref|NP_945622.1| hypothetical protein RPA0269 [Rhodopseudomonas palustris CGA009] gi|192288701|ref|YP_001989306.1| hypothetical protein Rpal_0270 [Rhodopseudomonas palustris TIE-1] gi|81564358|sp|Q6ND40|Y269_RHOPA RecName: Full=UPF0434 protein RPA0269 gi|226701500|sp|B3Q881|Y270_RHOPT RecName: Full=UPF0434 protein Rpal_0270 gi|39652971|emb|CAE25713.1| DUF343 [Rhodopseudomonas palustris CGA009] gi|192282450|gb|ACE98830.1| protein of unknown function DUF343 [Rhodopseudomonas palustris TIE-1] Length = 65 Score = 95.7 bits (238), Expect = 2e-18, Method: Composition-based stats. Identities = 31/59 (52%), Positives = 40/59 (67%) Query: 2 RETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 E +D +LL+ILVCP+TKG L EL+S+ A LAYPIR G+PIML EAR++ Sbjct: 6 SERPDTVDRKLLDILVCPVTKGPLEFDPARQELISRGAKLAYPIRDGIPIMLPEEARKL 64 >gi|222087562|ref|YP_002546099.1| hypothetical protein Arad_4458 [Agrobacterium radiobacter K84] gi|254803914|sp|B9JCQ5|Y4458_AGRRK RecName: Full=UPF0434 protein Arad_4458 gi|221725010|gb|ACM28166.1| conserved hypothetical protein [Agrobacterium radiobacter K84] Length = 62 Score = 95.3 bits (237), Expect = 2e-18, Method: Composition-based stats. Identities = 36/62 (58%), Positives = 50/62 (80%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 M T+ +D +LL++LVCPLTKG+L+ E EL+S+KA LAYPIR G+PIML+SEAR++ Sbjct: 1 MDVTVSKVDTKLLDLLVCPLTKGSLSYDREKNELVSEKARLAYPIRDGIPIMLISEARRI 60 Query: 61 DD 62 +D Sbjct: 61 ED 62 >gi|312795272|ref|YP_004028194.1| conserved cytosolic protein [Burkholderia rhizoxinica HKI 454] gi|312167047|emb|CBW74050.1| conserved cytosolic protein [Burkholderia rhizoxinica HKI 454] Length = 64 Score = 95.3 bits (237), Expect = 2e-18, Method: Composition-based stats. Identities = 29/52 (55%), Positives = 34/52 (65%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 +D +LLEILVCPL KG L EL+ LAYPIR G+P+ML EARQ Sbjct: 1 MDARLLEILVCPLCKGPLHHDRNAQELICHADKLAYPIRDGIPVMLADEARQ 52 >gi|239815621|ref|YP_002944531.1| hypothetical protein Vapar_2640 [Variovorax paradoxus S110] gi|259646879|sp|C5CKW1|Y2640_VARPS RecName: Full=UPF0434 protein Vapar_2640 gi|239802198|gb|ACS19265.1| protein of unknown function DUF343 [Variovorax paradoxus S110] Length = 60 Score = 95.3 bits (237), Expect = 2e-18, Method: Composition-based stats. Identities = 30/56 (53%), Positives = 42/56 (75%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLE+LVCP+TKG LT E EL S+ A LAYP+R G+P++L +EAR + D+ Sbjct: 1 MDTKLLELLVCPVTKGPLTWNPEKQELCSRSARLAYPVRDGIPVLLENEARTLSDE 56 >gi|218461969|ref|ZP_03502060.1| hypothetical protein RetlK5_21903 [Rhizobium etli Kim 5] gi|218663216|ref|ZP_03519146.1| hypothetical protein RetlI_29721 [Rhizobium etli IE4771] Length = 62 Score = 95.3 bits (237), Expect = 2e-18, Method: Composition-based stats. Identities = 38/62 (61%), Positives = 50/62 (80%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 M E + +DP+LLE+LVCPL+KG L+ E EL+S+KA LAYPIR G+PIMLVSEAR++ Sbjct: 1 MDEKLSRVDPKLLELLVCPLSKGRLSYDREHNELVSEKAHLAYPIRDGIPIMLVSEARRL 60 Query: 61 DD 62 D+ Sbjct: 61 DE 62 >gi|268590148|ref|ZP_06124369.1| tetraacyldisaccharide 4'-kinase [Providencia rettgeri DSM 1131] gi|291314423|gb|EFE54876.1| tetraacyldisaccharide 4'-kinase [Providencia rettgeri DSM 1131] Length = 59 Score = 95.3 bits (237), Expect = 2e-18, Method: Composition-based stats. Identities = 28/58 (48%), Positives = 39/58 (67%), Gaps = 1/58 (1%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD-DQG 64 +D +LLEI+ CP+ G L+ E EL+ K LAYPIR G+P++L +EAR V D+G Sbjct: 1 MDHRLLEIVACPVCHGKLSYNKENLELICKFDHLAYPIRDGIPVLLENEARPVSLDEG 58 >gi|73540298|ref|YP_294818.1| hypothetical protein Reut_A0592 [Ralstonia eutropha JMP134] gi|123625769|sp|Q475F9|Y592_RALEJ RecName: Full=UPF0434 protein Reut_A0592 gi|72117711|gb|AAZ59974.1| Protein of unknown function DUF343 [Ralstonia eutropha JMP134] Length = 67 Score = 95.3 bits (237), Expect = 3e-18, Method: Composition-based stats. Identities = 29/52 (55%), Positives = 34/52 (65%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 +D +LLEILVCPL KG L EL+ LAYPIR G+P+ML EARQ Sbjct: 1 MDNRLLEILVCPLCKGKLEYDRAAQELICHADKLAYPIRDGIPVMLADEARQ 52 >gi|330445706|ref|ZP_08309358.1| hypothetical protein PMSV_633 [Photobacterium leiognathi subsp. mandapamensis svers.1.1.] gi|328489897|dbj|GAA03855.1| hypothetical protein PMSV_633 [Photobacterium leiognathi subsp. mandapamensis svers.1.1.] Length = 59 Score = 95.3 bits (237), Expect = 3e-18, Method: Composition-based stats. Identities = 25/56 (44%), Positives = 34/56 (60%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ KG L E EL+ K LAYPI G+P++L EAR + Sbjct: 1 MDHRLLEIVACPVCKGKLNYDKEKNELVCKFDRLAYPINDGIPVLLEPEARTLSSD 56 >gi|190893825|ref|YP_001980367.1| hypothetical protein RHECIAT_CH0004260 [Rhizobium etli CIAT 652] gi|218675242|ref|ZP_03524911.1| hypothetical protein RetlG_29478 [Rhizobium etli GR56] gi|226706155|sp|B3PR35|Y4260_RHIE6 RecName: Full=UPF0434 protein RHECIAT_CH0004260 gi|190699104|gb|ACE93189.1| hypothetical conserved protein [Rhizobium etli CIAT 652] Length = 62 Score = 95.3 bits (237), Expect = 3e-18, Method: Composition-based stats. Identities = 38/62 (61%), Positives = 50/62 (80%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 M E + +DP+LLE+LVCPL+KG L+ E EL+S+KA LAYPIR G+PIMLVSEAR++ Sbjct: 1 MDEKLSRVDPKLLELLVCPLSKGRLSYDREHNELVSEKARLAYPIRDGIPIMLVSEARRL 60 Query: 61 DD 62 D+ Sbjct: 61 DE 62 >gi|23016010|ref|ZP_00055771.1| COG2835: Uncharacterized conserved protein [Magnetospirillum magnetotacticum MS-1] Length = 65 Score = 95.3 bits (237), Expect = 3e-18, Method: Composition-based stats. Identities = 28/63 (44%), Positives = 36/63 (57%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 M E + D +LL+ILV P T L + EL+ K LAYPIR G+PIML EAR + Sbjct: 1 MPERVSAFDTKLLDILVAPGTHAPLRYDAAAQELVDDKGGLAYPIRDGIPIMLADEARSI 60 Query: 61 DDQ 63 + Sbjct: 61 EGD 63 >gi|227823704|ref|YP_002827677.1| hypothetical protein NGR_c31900 [Sinorhizobium fredii NGR234] gi|254801631|sp|C3M9Z9|Y3190_RHISN RecName: Full=UPF0434 protein NGR_c31900 gi|227342706|gb|ACP26924.1| hypothetical protein NGR_c31900 [Sinorhizobium fredii NGR234] Length = 62 Score = 95.3 bits (237), Expect = 3e-18, Method: Composition-based stats. Identities = 39/62 (62%), Positives = 48/62 (77%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 M +DP+LLE+LVCPLTKG L +E EL+S+KA LAYPIR GVPIMLVSEAR++ Sbjct: 1 MDANASRVDPKLLELLVCPLTKGRLRYDAEAHELVSEKARLAYPIRDGVPIMLVSEARKI 60 Query: 61 DD 62 +D Sbjct: 61 ED 62 >gi|254503845|ref|ZP_05115996.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11] gi|222439916|gb|EEE46595.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11] Length = 63 Score = 95.3 bits (237), Expect = 3e-18, Method: Composition-based stats. Identities = 32/56 (57%), Positives = 43/56 (76%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 ID +LLE+LVCP+TK L +E EL+S+ A LAYPIR+G+PIML EAR+++D Sbjct: 8 PIDRKLLELLVCPVTKATLEYDAEAQELISRTAKLAYPIRNGIPIMLPDEARKLED 63 >gi|104780771|ref|YP_607269.1| hypothetical protein PSEEN1604 [Pseudomonas entomophila L48] gi|148841331|sp|Q1ID00|Y1604_PSEE4 RecName: Full=UPF0434 protein PSEEN1604 gi|95109758|emb|CAK14463.1| conserved hypothetical protein [Pseudomonas entomophila L48] Length = 61 Score = 95.3 bits (237), Expect = 3e-18, Method: Composition-based stats. Identities = 33/56 (58%), Positives = 44/56 (78%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LL+IL CP+TKG L L ++ TEL+SK A LAYPIR G+P+ML SEAR + D+ Sbjct: 1 MDTKLLDILACPITKGPLKLSADKTELISKGAGLAYPIRDGIPVMLESEARTLTDE 56 >gi|225075486|ref|ZP_03718685.1| hypothetical protein NEIFLAOT_00494 [Neisseria flavescens NRL30031/H210] gi|224953121|gb|EEG34330.1| hypothetical protein NEIFLAOT_00494 [Neisseria flavescens NRL30031/H210] Length = 60 Score = 95.3 bits (237), Expect = 3e-18, Method: Composition-based stats. Identities = 27/56 (48%), Positives = 40/56 (71%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 ++ + L+ILVCP+TKG L + EL S++A LAYPIR G+P ML +EAR + ++ Sbjct: 1 MEKKFLDILVCPVTKGKLEYHQDKQELWSRQAKLAYPIRDGIPYMLENEARALSEE 56 >gi|26988631|ref|NP_744056.1| hypothetical protein PP_1901 [Pseudomonas putida KT2440] gi|148549019|ref|YP_001269121.1| hypothetical protein Pput_3813 [Pseudomonas putida F1] gi|167032487|ref|YP_001667718.1| hypothetical protein PputGB1_1477 [Pseudomonas putida GB-1] gi|170720698|ref|YP_001748386.1| hypothetical protein PputW619_1512 [Pseudomonas putida W619] gi|325276001|ref|ZP_08141825.1| hypothetical protein G1E_21296 [Pseudomonas sp. TJI-51] gi|81441503|sp|Q88LM8|Y1901_PSEPK RecName: Full=UPF0434 protein PP_1901 gi|166990912|sp|A5W727|Y3813_PSEP1 RecName: Full=UPF0434 protein Pput_3813 gi|189038721|sp|B0KF42|Y1477_PSEPG RecName: Full=UPF0434 protein PputGB1_1477 gi|226734674|sp|B1J507|Y1512_PSEPW RecName: Full=UPF0434 protein PputW619_1512 gi|24983411|gb|AAN67520.1|AE016380_8 conserved hypothetical protein [Pseudomonas putida KT2440] gi|148513077|gb|ABQ79937.1| protein of unknown function DUF343 [Pseudomonas putida F1] gi|166858975|gb|ABY97382.1| protein of unknown function DUF343 [Pseudomonas putida GB-1] gi|169758701|gb|ACA72017.1| protein of unknown function DUF343 [Pseudomonas putida W619] gi|313499946|gb|ADR61312.1| Hypothetical protein, conserved [Pseudomonas putida BIRD-1] gi|324098867|gb|EGB96889.1| hypothetical protein G1E_21296 [Pseudomonas sp. TJI-51] Length = 61 Score = 94.9 bits (236), Expect = 3e-18, Method: Composition-based stats. Identities = 33/56 (58%), Positives = 43/56 (76%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LL+IL CP+TKG L L ++ TEL+SK A LAYPIR G+P+ML SEAR + D Sbjct: 1 MDTKLLDILACPITKGPLKLSADKTELISKGAGLAYPIRDGIPVMLESEARTLTDD 56 >gi|77460395|ref|YP_349902.1| hypothetical protein Pfl01_4174 [Pseudomonas fluorescens Pf0-1] gi|330811010|ref|YP_004355472.1| hypothetical protein PSEBR_a4067 [Pseudomonas brassicacearum subsp. brassicacearum NFM421] gi|123603671|sp|Q3K8J3|Y4174_PSEPF RecName: Full=UPF0434 protein Pfl01_4174 gi|77384398|gb|ABA75911.1| conserved hypothetical protein [Pseudomonas fluorescens Pf0-1] gi|327379118|gb|AEA70468.1| Conserved hypothetical protein [Pseudomonas brassicacearum subsp. brassicacearum NFM421] Length = 61 Score = 94.9 bits (236), Expect = 3e-18, Method: Composition-based stats. Identities = 31/56 (55%), Positives = 41/56 (73%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LL+IL CP+ KG L L ++ TEL+SK A LAYPIR G+P+ML SEAR + Sbjct: 1 MDTKLLDILACPVCKGPLKLSADKTELISKGAGLAYPIRDGIPVMLESEARTLTTD 56 >gi|99079897|ref|YP_612051.1| hypothetical protein TM1040_0056 [Ruegeria sp. TM1040] gi|122398496|sp|Q1GKM7|Y056_SILST RecName: Full=UPF0434 protein TM1040_0056 gi|99036177|gb|ABF62789.1| protein of unknown function DUF343 [Ruegeria sp. TM1040] Length = 61 Score = 94.9 bits (236), Expect = 3e-18, Method: Composition-based stats. Identities = 29/61 (47%), Positives = 42/61 (68%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 M ET D +LE LVCP+T+ L +E EL+S+ A+LA+PIR+G+P+ML EAR + Sbjct: 1 MNETTPAFDRHMLEALVCPVTQTVLEYDAEAQELVSRAANLAFPIRNGIPVMLTDEARPL 60 Query: 61 D 61 + Sbjct: 61 E 61 >gi|209883502|ref|YP_002287359.1| tetraacyldisaccharide 4'-kinase [Oligotropha carboxidovorans OM5] gi|209871698|gb|ACI91494.1| tetraacyldisaccharide 4'-kinase [Oligotropha carboxidovorans OM5] Length = 67 Score = 94.9 bits (236), Expect = 3e-18, Method: Composition-based stats. Identities = 33/55 (60%), Positives = 42/55 (76%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 +D +LLEILVCP+TKG L +E EL+S+ A LAYPIR G+PIML EAR++D Sbjct: 13 PVDSKLLEILVCPVTKGVLEYNAERQELISRSAKLAYPIRDGIPIMLPEEARKLD 67 >gi|163745440|ref|ZP_02152800.1| hypothetical protein OIHEL45_07615 [Oceanibulbus indolifex HEL-45] gi|161382258|gb|EDQ06667.1| hypothetical protein OIHEL45_07615 [Oceanibulbus indolifex HEL-45] Length = 60 Score = 94.9 bits (236), Expect = 3e-18, Method: Composition-based stats. Identities = 28/60 (46%), Positives = 40/60 (66%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 M + D ++LE L+CP ++ LT +E EL+SK A LAYPIR+G+P+ML EAR + Sbjct: 1 MTDATIQFDRRMLEALICPRSQTTLTYDAEKQELVSKAAGLAYPIRNGIPVMLPDEARTL 60 >gi|83309108|ref|YP_419372.1| hypothetical protein amb0009 [Magnetospirillum magneticum AMB-1] gi|82943949|dbj|BAE48813.1| Uncharacterized conserved protein [Magnetospirillum magneticum AMB-1] Length = 65 Score = 94.9 bits (236), Expect = 3e-18, Method: Composition-based stats. Identities = 31/64 (48%), Positives = 38/64 (59%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 M E + D +LL+ILV P T L + EL+ KA LAYPIR G+PIMLV EAR Sbjct: 1 MPERVSAFDTKLLDILVAPGTHAPLRYDAGAQELIDDKACLAYPIRDGIPIMLVDEARST 60 Query: 61 DDQG 64 + G Sbjct: 61 EGDG 64 >gi|328541882|ref|YP_004301991.1| Tetraacyldisaccharide 4'-kinase [polymorphum gilvum SL003B-26A1] gi|326411633|gb|ADZ68696.1| Tetraacyldisaccharide 4'-kinase [Polymorphum gilvum SL003B-26A1] Length = 63 Score = 94.9 bits (236), Expect = 3e-18, Method: Composition-based stats. Identities = 30/55 (54%), Positives = 42/55 (76%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 +D +LLE+LVCP+TK L +E EL+S+ A LAYPIR G+PIML EAR++++ Sbjct: 9 VDRKLLELLVCPVTKTTLEYDAERQELISRAARLAYPIRDGIPIMLPEEARKLEE 63 >gi|260469703|ref|ZP_05813864.1| protein of unknown function DUF343 [Mesorhizobium opportunistum WSM2075] gi|259028523|gb|EEW29838.1| protein of unknown function DUF343 [Mesorhizobium opportunistum WSM2075] Length = 79 Score = 94.9 bits (236), Expect = 3e-18, Method: Composition-based stats. Identities = 32/60 (53%), Positives = 41/60 (68%) Query: 4 TIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +DP+LLE+L CPLTKG L E EL+S+ A LAYP+R G+PIML SEAR + + Sbjct: 8 RKSTVDPKLLELLACPLTKGPLAWDPERGELISRVAKLAYPVRDGIPIMLPSEARTISAE 67 >gi|257487565|ref|ZP_05641606.1| tetraacyldisaccharide-1-P 4''''-kinase [Pseudomonas syringae pv. tabaci ATCC 11528] gi|289624523|ref|ZP_06457477.1| tetraacyldisaccharide-1-P 4''''-kinase [Pseudomonas syringae pv. aesculi str. NCPPB3681] gi|289649335|ref|ZP_06480678.1| tetraacyldisaccharide-1-P 4''''-kinase [Pseudomonas syringae pv. aesculi str. 2250] gi|289671951|ref|ZP_06492841.1| tetraacyldisaccharide-1-P 4''''-kinase [Pseudomonas syringae pv. syringae FF5] gi|298486208|ref|ZP_07004271.1| Protein ycaR [Pseudomonas savastanoi pv. savastanoi NCPPB 3335] gi|302187290|ref|ZP_07263963.1| tetraacyldisaccharide-1-P 4''''-kinase [Pseudomonas syringae pv. syringae 642] gi|148841332|sp|Q48L53|Y1629_PSE14 RecName: Full=UPF0434 protein PSPPH_1629 gi|298159215|gb|EFI00273.1| Protein ycaR [Pseudomonas savastanoi pv. savastanoi NCPPB 3335] gi|320325299|gb|EFW81366.1| tetraacyldisaccharide-1-P 4''''-kinase [Pseudomonas syringae pv. glycinea str. B076] gi|320327716|gb|EFW83724.1| tetraacyldisaccharide-1-P 4''''-kinase [Pseudomonas syringae pv. glycinea str. race 4] gi|330869282|gb|EGH03991.1| tetraacyldisaccharide 4'-kinase [Pseudomonas syringae pv. aesculi str. 0893_23] gi|330877777|gb|EGH11926.1| tetraacyldisaccharide 4'-kinase [Pseudomonas syringae pv. glycinea str. race 4] gi|330891483|gb|EGH24144.1| tetraacyldisaccharide 4'-kinase [Pseudomonas syringae pv. mori str. 301020] gi|330900154|gb|EGH31573.1| tetraacyldisaccharide 4'-kinase [Pseudomonas syringae pv. japonica str. M301072PT] gi|330942719|gb|EGH45261.1| tetraacyldisaccharide 4'-kinase [Pseudomonas syringae pv. pisi str. 1704B] gi|330952673|gb|EGH52933.1| tetraacyldisaccharide 4'-kinase [Pseudomonas syringae Cit 7] gi|330973870|gb|EGH73936.1| tetraacyldisaccharide 4'-kinase [Pseudomonas syringae pv. aceris str. M302273PT] gi|330985580|gb|EGH83683.1| tetraacyldisaccharide 4'-kinase [Pseudomonas syringae pv. lachrymans str. M301315] gi|331012619|gb|EGH92675.1| tetraacyldisaccharide 4'-kinase [Pseudomonas syringae pv. tabaci ATCC 11528] Length = 61 Score = 94.9 bits (236), Expect = 3e-18, Method: Composition-based stats. Identities = 30/56 (53%), Positives = 41/56 (73%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LL+IL CP+ KG L L ++ TEL+SK A LAYP+R G+P+ML SEAR + Sbjct: 1 MDTKLLDILACPVCKGPLKLSADKTELISKGAGLAYPVRDGIPVMLESEARTLSTD 56 >gi|332534995|ref|ZP_08410811.1| UPF0434 protein YcaR [Pseudoalteromonas haloplanktis ANT/505] gi|332035562|gb|EGI72055.1| UPF0434 protein YcaR [Pseudoalteromonas haloplanktis ANT/505] Length = 65 Score = 94.9 bits (236), Expect = 3e-18, Method: Composition-based stats. Identities = 24/58 (41%), Positives = 37/58 (63%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 D +LLEI+ CP+ KG L E EL+S A LAYP++ +P++L +EAR++ + Sbjct: 1 MAFDTKLLEIIACPVCKGKLRFDRENNELISTAAKLAYPVQDDIPVLLENEARELSLE 58 >gi|58039230|ref|YP_191194.1| hypothetical protein GOX0764 [Gluconobacter oxydans 621H] gi|81352272|sp|Q5FSV8|Y764_GLUOX RecName: Full=UPF0434 protein GOX0764 gi|58001644|gb|AAW60538.1| Hypothetical protein GOX0764 [Gluconobacter oxydans 621H] Length = 59 Score = 94.9 bits (236), Expect = 3e-18, Method: Composition-based stats. Identities = 33/54 (61%), Positives = 42/54 (77%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 +DP+LL +LVCP+TKG LT E EL+S +A LA+PIR G+PIML EARQ+D Sbjct: 5 LDPRLLSLLVCPVTKGPLTYDRETQELISPRAKLAFPIRDGIPIMLPEEARQID 58 >gi|74317524|ref|YP_315264.1| tetraacyldisaccharide-1-P 4'-kinase [Thiobacillus denitrificans ATCC 25259] gi|123611797|sp|Q3SIR6|Y1506_THIDA RecName: Full=UPF0434 protein Tbd_1506 gi|74057019|gb|AAZ97459.1| tetraacyldisaccharide-1-P 4'-kinase [Thiobacillus denitrificans ATCC 25259] Length = 62 Score = 94.9 bits (236), Expect = 4e-18, Method: Composition-based stats. Identities = 26/56 (46%), Positives = 34/56 (60%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 ++P+LLEILVCP+ KG L EL+ LAYP+R +P+ML EAR V Sbjct: 1 MNPKLLEILVCPVCKGQLEWKKSAHELVCPACRLAYPVRDDIPVMLPEEARAVGPD 56 >gi|114571478|ref|YP_758158.1| hypothetical protein Mmar10_2939 [Maricaulis maris MCS10] gi|122314972|sp|Q0AKH3|Y2939_MARMM RecName: Full=UPF0434 protein Mmar10_2939 gi|114341940|gb|ABI67220.1| protein of unknown function DUF343 [Maricaulis maris MCS10] Length = 63 Score = 94.9 bits (236), Expect = 4e-18, Method: Composition-based stats. Identities = 33/56 (58%), Positives = 43/56 (76%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 ++DP+LLEILVCP+T+ L E EL+S+ A LAYP+R G+PIML EARQ+DD Sbjct: 8 DVDPKLLEILVCPVTRETLRYDREAHELISEGAGLAYPVRDGIPIMLPDEARQLDD 63 >gi|86359557|ref|YP_471449.1| hypothetical protein RHE_CH03977 [Rhizobium etli CFN 42] gi|218679566|ref|ZP_03527463.1| hypothetical protein RetlC8_12006 [Rhizobium etli CIAT 894] gi|123510495|sp|Q2K364|Y3977_RHIEC RecName: Full=UPF0434 protein RHE_CH03977 gi|86283659|gb|ABC92722.1| hypothetical conserved protein [Rhizobium etli CFN 42] Length = 62 Score = 94.9 bits (236), Expect = 4e-18, Method: Composition-based stats. Identities = 38/62 (61%), Positives = 50/62 (80%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 M E + +DP+LLE+LVCPL+KG L+ E EL+S+KA LAYPIR G+PIMLVSEAR++ Sbjct: 1 MDEKLSRVDPKLLELLVCPLSKGRLSYDREHNELVSEKAQLAYPIRDGIPIMLVSEARRL 60 Query: 61 DD 62 D+ Sbjct: 61 DE 62 >gi|86136928|ref|ZP_01055506.1| hypothetical protein MED193_14677 [Roseobacter sp. MED193] gi|85826252|gb|EAQ46449.1| hypothetical protein MED193_14677 [Roseobacter sp. MED193] Length = 62 Score = 94.9 bits (236), Expect = 4e-18, Method: Composition-based stats. Identities = 33/62 (53%), Positives = 44/62 (70%), Gaps = 1/62 (1%) Query: 1 MRETIF-NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 M +T D ++LE LVCP T+G L +E ELLSK A+LA+PIR+G+P+MLV EAR Sbjct: 1 MSDTKSATFDRRMLEALVCPQTQGTLEYNAETQELLSKAANLAFPIRNGIPVMLVDEART 60 Query: 60 VD 61 +D Sbjct: 61 LD 62 >gi|258541112|ref|YP_003186545.1| hypothetical protein APA01_00070 [Acetobacter pasteurianus IFO 3283-01] gi|329114725|ref|ZP_08243482.1| UPF0434 protein [Acetobacter pomorum DM001] gi|256632190|dbj|BAH98165.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01] gi|256635247|dbj|BAI01216.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-03] gi|256638302|dbj|BAI04264.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-07] gi|256641356|dbj|BAI07311.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-22] gi|256644411|dbj|BAI10359.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-26] gi|256647466|dbj|BAI13407.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-32] gi|256650519|dbj|BAI16453.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01-42C] gi|256653510|dbj|BAI19437.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-12] gi|326695856|gb|EGE47540.1| UPF0434 protein [Acetobacter pomorum DM001] Length = 61 Score = 94.9 bits (236), Expect = 4e-18, Method: Composition-based stats. Identities = 34/62 (54%), Positives = 46/62 (74%), Gaps = 1/62 (1%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 M +T +D +LL +LVCP+TKG LT +E EL+SKKA LA+PIR G+PIML EAR++ Sbjct: 1 MSDTP-PLDSRLLSVLVCPVTKGPLTYNAETNELISKKAGLAFPIRDGIPIMLPDEARRL 59 Query: 61 DD 62 + Sbjct: 60 ES 61 >gi|77360600|ref|YP_340175.1| hypothetical protein PSHAa1659 [Pseudoalteromonas haloplanktis TAC125] gi|123588182|sp|Q3IGX7|Y1659_PSEHT RecName: Full=UPF0434 protein PSHAa1659 gi|76875511|emb|CAI86732.1| conserved protein of unknown function [Pseudoalteromonas haloplanktis TAC125] Length = 65 Score = 94.5 bits (235), Expect = 4e-18, Method: Composition-based stats. Identities = 24/58 (41%), Positives = 36/58 (62%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 D +LLEI+ CP+ KG L E +EL+S A LAYP+ +P++L +EAR++ Sbjct: 1 MAFDTKLLEIIACPVCKGKLRFDKENSELISTAAKLAYPVIDDIPVLLENEARELSLD 58 >gi|313200427|ref|YP_004039085.1| hypothetical protein MPQ_0667 [Methylovorus sp. MP688] gi|312439743|gb|ADQ83849.1| conserved hypothetical protein [Methylovorus sp. MP688] Length = 59 Score = 94.5 bits (235), Expect = 4e-18, Method: Composition-based stats. Identities = 29/55 (52%), Positives = 37/55 (67%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 +D +LL+ILVCP+ KG L E EL K LAYPIR G+P+ML EAR++ D Sbjct: 1 MDAKLLDILVCPVCKGPLVFKKEAQELACKPCRLAYPIRDGIPVMLEDEARRLAD 55 >gi|209551344|ref|YP_002283261.1| hypothetical protein Rleg2_3773 [Rhizobium leguminosarum bv. trifolii WSM2304] gi|226706044|sp|B5ZTJ9|Y3773_RHILW RecName: Full=UPF0434 protein Rleg2_3773 gi|209537100|gb|ACI57035.1| protein of unknown function DUF343 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 62 Score = 94.5 bits (235), Expect = 4e-18, Method: Composition-based stats. Identities = 37/62 (59%), Positives = 50/62 (80%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 M E + +DP+LL++LVCPL+KG L+ E EL+S+KA LAYPIR G+PIMLVSEAR++ Sbjct: 1 MDEKLSRVDPKLLDLLVCPLSKGRLSYDREHNELVSEKARLAYPIRDGIPIMLVSEARRL 60 Query: 61 DD 62 D+ Sbjct: 61 DE 62 >gi|316931750|ref|YP_004106732.1| hypothetical protein Rpdx1_0358 [Rhodopseudomonas palustris DX-1] gi|315599464|gb|ADU41999.1| protein of unknown function DUF343 [Rhodopseudomonas palustris DX-1] Length = 65 Score = 94.5 bits (235), Expect = 4e-18, Method: Composition-based stats. Identities = 31/59 (52%), Positives = 41/59 (69%) Query: 2 RETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 E +D +LL+ILVCP+TKG L + EL+S+ A LAYPIR G+PIML EAR++ Sbjct: 6 SERPDAVDRKLLDILVCPITKGPLEFDAARQELISRGAKLAYPIRDGIPIMLPEEARKI 64 >gi|160899006|ref|YP_001564588.1| hypothetical protein Daci_3569 [Delftia acidovorans SPH-1] gi|226705802|sp|A9BWI3|Y3569_DELAS RecName: Full=UPF0434 protein Daci_3569 gi|160364590|gb|ABX36203.1| protein of unknown function DUF343 [Delftia acidovorans SPH-1] Length = 60 Score = 94.5 bits (235), Expect = 4e-18, Method: Composition-based stats. Identities = 30/56 (53%), Positives = 42/56 (75%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLE+LVCP+TKG L E EL+S+ A LAYP+R G+P++L +EAR +DD Sbjct: 1 MDAKLLELLVCPVTKGPLRFDREHQELVSRSARLAYPVRDGIPVLLEAEARTLDDD 56 >gi|241206781|ref|YP_002977877.1| hypothetical protein Rleg_4097 [Rhizobium leguminosarum bv. trifolii WSM1325] gi|240860671|gb|ACS58338.1| protein of unknown function DUF343 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 62 Score = 94.5 bits (235), Expect = 4e-18, Method: Composition-based stats. Identities = 37/62 (59%), Positives = 50/62 (80%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 M E + +DP+LL++LVCPL+KG L+ E EL+S+KA LAYPIR G+PIMLVSEAR++ Sbjct: 1 MDEKLSRVDPKLLDLLVCPLSKGRLSYDREQNELVSEKARLAYPIRDGIPIMLVSEARRL 60 Query: 61 DD 62 D+ Sbjct: 61 DE 62 >gi|254512353|ref|ZP_05124420.1| conserved hypothetical protein [Rhodobacteraceae bacterium KLH11] gi|221536064|gb|EEE39052.1| conserved hypothetical protein [Rhodobacteraceae bacterium KLH11] Length = 61 Score = 94.5 bits (235), Expect = 4e-18, Method: Composition-based stats. Identities = 30/61 (49%), Positives = 39/61 (63%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 M + D +LE L+CP T L +E EL+SK A LA+PIRSG+P+MLV EAR + Sbjct: 1 MSDPEHAFDRHMLEALICPQTHTTLHYDAEQQELVSKAAGLAFPIRSGIPVMLVDEARVL 60 Query: 61 D 61 D Sbjct: 61 D 61 >gi|107102529|ref|ZP_01366447.1| hypothetical protein PaerPA_01003593 [Pseudomonas aeruginosa PACS2] Length = 66 Score = 94.5 bits (235), Expect = 4e-18, Method: Composition-based stats. Identities = 35/63 (55%), Positives = 47/63 (74%), Gaps = 2/63 (3%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 M+++ DP+LL+IL CPLTKG L L + TEL+SK+A LAYPIR G+P+ML SEAR + Sbjct: 1 MKDSAM--DPKLLDILACPLTKGPLVLSEDKTELISKQAGLAYPIRDGIPVMLESEARSL 58 Query: 61 DDQ 63 + Sbjct: 59 NVD 61 >gi|332186986|ref|ZP_08388727.1| trm112p-like family protein [Sphingomonas sp. S17] gi|332012996|gb|EGI55060.1| trm112p-like family protein [Sphingomonas sp. S17] Length = 55 Score = 94.5 bits (235), Expect = 4e-18, Method: Composition-based stats. Identities = 30/55 (54%), Positives = 39/55 (70%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 ++DP LLE LVCP+T+ L EL+S+ A LAYPIR GVP+MLV EAR++ Sbjct: 1 MSLDPWLLERLVCPVTRTPLRYDEAAQELVSEAAGLAYPIRDGVPVMLVEEAREL 55 >gi|119478766|ref|ZP_01618605.1| hypothetical protein GP2143_00070 [marine gamma proteobacterium HTCC2143] gi|119448345|gb|EAW29600.1| hypothetical protein GP2143_00070 [marine gamma proteobacterium HTCC2143] Length = 61 Score = 94.5 bits (235), Expect = 4e-18, Method: Composition-based stats. Identities = 27/57 (47%), Positives = 38/57 (66%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 ID +LL +LVCP++K L E EL+ + + LAYPIR +P+ML SEARQ+ + Sbjct: 1 MIDKKLLSLLVCPVSKAPLDYDEEKQELICRASGLAYPIRDDIPVMLESEARQLTTE 57 >gi|92115715|ref|YP_575444.1| hypothetical protein Nham_0083 [Nitrobacter hamburgensis X14] gi|122418952|sp|Q1QS13|Y083_NITHX RecName: Full=UPF0434 protein Nham_0083 gi|91798609|gb|ABE60984.1| protein of unknown function DUF343 [Nitrobacter hamburgensis X14] Length = 65 Score = 94.5 bits (235), Expect = 4e-18, Method: Composition-based stats. Identities = 31/55 (56%), Positives = 40/55 (72%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 +D +LLEILVCP+TKG L EL+S+ A LAYPIR G+PIML EAR+++ Sbjct: 11 TVDRKLLEILVCPVTKGPLEFDGARQELISRSAKLAYPIREGIPIMLPEEARKIE 65 >gi|89067295|ref|ZP_01154808.1| hypothetical protein OG2516_10661 [Oceanicola granulosus HTCC2516] gi|89046864|gb|EAR52918.1| hypothetical protein OG2516_10661 [Oceanicola granulosus HTCC2516] Length = 62 Score = 94.5 bits (235), Expect = 4e-18, Method: Composition-based stats. Identities = 34/60 (56%), Positives = 43/60 (71%) Query: 2 RETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 ET D ++LE LVCP T+ LT SE EL+S+ A LAYPIR+G+P+MLV EARQ+D Sbjct: 3 EETFPQFDRRMLEALVCPQTQAPLTYDSERQELVSRAAHLAYPIRAGIPVMLVDEARQLD 62 >gi|254472395|ref|ZP_05085795.1| conserved hypothetical protein [Pseudovibrio sp. JE062] gi|211958678|gb|EEA93878.1| conserved hypothetical protein [Pseudovibrio sp. JE062] Length = 63 Score = 94.5 bits (235), Expect = 5e-18, Method: Composition-based stats. Identities = 33/63 (52%), Positives = 45/63 (71%), Gaps = 1/63 (1%) Query: 1 MRE-TIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 M E +D +LLE+LVCP+TK L +E EL+S+ A LAYPIR+G+PIML EAR+ Sbjct: 1 MSEFEAPQLDRRLLELLVCPVTKTTLEYNAENQELISRAAKLAYPIRNGIPIMLEEEARK 60 Query: 60 VDD 62 ++D Sbjct: 61 LED 63 >gi|88860178|ref|ZP_01134817.1| hypothetical protein PTD2_19240 [Pseudoalteromonas tunicata D2] gi|88818172|gb|EAR27988.1| hypothetical protein PTD2_19240 [Pseudoalteromonas tunicata D2] Length = 65 Score = 94.5 bits (235), Expect = 5e-18, Method: Composition-based stats. Identities = 26/58 (44%), Positives = 37/58 (63%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 D +LLEI+ CP+TKG L EL+S +A LAYPIR +P++L +EAR++ Sbjct: 1 MAFDIKLLEIIACPVTKGKLRYDKANAELISTQAKLAYPIREDIPVLLENEARELGHD 58 >gi|259417162|ref|ZP_05741081.1| tetraacyldisaccharide 4'-kinase [Silicibacter sp. TrichCH4B] gi|259346068|gb|EEW57882.1| tetraacyldisaccharide 4'-kinase [Silicibacter sp. TrichCH4B] Length = 61 Score = 94.1 bits (234), Expect = 5e-18, Method: Composition-based stats. Identities = 28/61 (45%), Positives = 42/61 (68%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 M +T D +LE LVCP+T+ L +E EL+S+ A+LA+PIR+G+P+ML EAR + Sbjct: 1 MNDTTPAFDRHMLEALVCPVTQTVLEYDAEAQELISRSANLAFPIRNGIPVMLTDEARPL 60 Query: 61 D 61 + Sbjct: 61 E 61 >gi|49082388|gb|AAT50594.1| PA2980 [synthetic construct] Length = 62 Score = 94.1 bits (234), Expect = 5e-18, Method: Composition-based stats. Identities = 34/56 (60%), Positives = 44/56 (78%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +DP+LL+IL CPLTKG L L + TEL+SK+A LAYPIR G+P+ML SEAR ++ Sbjct: 1 MDPKLLDILACPLTKGPLVLSEDKTELISKQAGLAYPIRDGIPVMLESEARSLNVD 56 >gi|332974677|gb|EGK11594.1| tetraacyldisaccharide 4'-kinase [Kingella kingae ATCC 23330] Length = 67 Score = 94.1 bits (234), Expect = 5e-18, Method: Composition-based stats. Identities = 29/62 (46%), Positives = 42/62 (67%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 M + N+D + L++L+CP+TK L ++ EL SK A LA+PIR G+PIML +EAR + Sbjct: 1 MTQEKSNMDKKYLDLLICPITKQPLQYHADKQELWSKVAKLAFPIRDGIPIMLENEARAL 60 Query: 61 DD 62 D Sbjct: 61 TD 62 >gi|330962636|gb|EGH62896.1| tetraacyldisaccharide 4'-kinase [Pseudomonas syringae pv. maculicola str. ES4326] Length = 61 Score = 94.1 bits (234), Expect = 5e-18, Method: Composition-based stats. Identities = 29/56 (51%), Positives = 41/56 (73%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LL+IL CP+ KG L L ++ TEL+SK A LAYP+R G+P+ML +EAR + Sbjct: 1 MDTKLLDILACPVCKGPLKLSADKTELISKGAGLAYPVRDGIPVMLETEARTLTTD 56 >gi|225023285|ref|ZP_03712477.1| hypothetical protein EIKCOROL_00137 [Eikenella corrodens ATCC 23834] gi|224943930|gb|EEG25139.1| hypothetical protein EIKCOROL_00137 [Eikenella corrodens ATCC 23834] Length = 60 Score = 94.1 bits (234), Expect = 5e-18, Method: Composition-based stats. Identities = 28/56 (50%), Positives = 41/56 (73%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D + L++LVCPLTKG L + EL S++A LA+PIR G+PIML +EAR + ++ Sbjct: 1 MDKKYLDLLVCPLTKGTLEYHAGRQELWSRQAKLAFPIRDGIPIMLENEARPLTEE 56 >gi|260425686|ref|ZP_05779666.1| conserved domain protein [Citreicella sp. SE45] gi|260423626|gb|EEX16876.1| conserved domain protein [Citreicella sp. SE45] Length = 68 Score = 94.1 bits (234), Expect = 5e-18, Method: Composition-based stats. Identities = 29/56 (51%), Positives = 37/56 (66%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 D ++LE LVCP T L E EL+SK A +AYPIR G+P+ML EAR++DD Sbjct: 13 PFDRRMLEALVCPATHATLEYDPERQELVSKNARIAYPIRDGIPVMLFDEARRLDD 68 >gi|91776440|ref|YP_546196.1| hypothetical protein Mfla_2088 [Methylobacillus flagellatus KT] gi|122399573|sp|Q1GZI2|Y2088_METFK RecName: Full=UPF0434 protein Mfla_2088 gi|91710427|gb|ABE50355.1| protein of unknown function DUF343 [Methylobacillus flagellatus KT] Length = 60 Score = 94.1 bits (234), Expect = 5e-18, Method: Composition-based stats. Identities = 27/56 (48%), Positives = 37/56 (66%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEILVCP+ KG L EL+ K LAYPI+ G+P+ML EAR++ + Sbjct: 1 MDAKLLEILVCPICKGPLHYKKNEQELICKPCRLAYPIQDGIPVMLEDEARKLPAE 56 >gi|237747409|ref|ZP_04577889.1| conserved hypothetical protein [Oxalobacter formigenes HOxBLS] gi|229378760|gb|EEO28851.1| conserved hypothetical protein [Oxalobacter formigenes HOxBLS] Length = 61 Score = 94.1 bits (234), Expect = 6e-18, Method: Composition-based stats. Identities = 28/54 (51%), Positives = 36/54 (66%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 ++ +LLEILVCPL KG L E EL+ LAYPIR G+PIM V +AR ++ Sbjct: 1 MNAKLLEILVCPLCKGPLKYDRERQELICGADRLAYPIRDGIPIMWVDQARSLE 54 >gi|254438945|ref|ZP_05052439.1| conserved hypothetical protein [Octadecabacter antarcticus 307] gi|198254391|gb|EDY78705.1| conserved hypothetical protein [Octadecabacter antarcticus 307] Length = 62 Score = 94.1 bits (234), Expect = 6e-18, Method: Composition-based stats. Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 M + DP++LE LVCP +G LT + EL SK A LAYPIR G+P++LV EAR + Sbjct: 1 MTDER-TFDPKMLEALVCPQCQGRLTYDAAAQELTSKAAHLAYPIRGGIPVLLVDEARVI 59 Query: 61 DDQ 63 D Sbjct: 60 DQD 62 >gi|110635599|ref|YP_675807.1| hypothetical protein Meso_3270 [Mesorhizobium sp. BNC1] gi|123057466|sp|Q11D83|Y3270_MESSB RecName: Full=UPF0434 protein Meso_3270 gi|110286583|gb|ABG64642.1| protein of unknown function DUF343 [Chelativorans sp. BNC1] Length = 71 Score = 94.1 bits (234), Expect = 6e-18, Method: Composition-based stats. Identities = 31/57 (54%), Positives = 40/57 (70%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +IDP+LLE+L CP+TKG L EL+S KA LAYP+R GVP+ML EAR ++ Sbjct: 11 SIDPKLLELLACPVTKGPLKWDPAKNELISAKAGLAYPVRDGVPVMLPGEARPLEPD 67 >gi|167949031|ref|ZP_02536105.1| tetraacyldisaccharide 4'-kinase [Endoriftia persephone 'Hot96_1+Hot96_2'] Length = 62 Score = 94.1 bits (234), Expect = 6e-18, Method: Composition-based stats. Identities = 24/56 (42%), Positives = 36/56 (64%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEIL CP+ KG L + EL+ + LA+P+R G+P+ML EAR++ Sbjct: 1 MDKKLLEILACPVCKGKLYYDKKAAELICRADRLAFPVRDGIPVMLQEEARELAAD 56 >gi|319637925|ref|ZP_07992691.1| hypothetical protein HMPREF0604_00314 [Neisseria mucosa C102] gi|317401080|gb|EFV81735.1| hypothetical protein HMPREF0604_00314 [Neisseria mucosa C102] Length = 60 Score = 94.1 bits (234), Expect = 6e-18, Method: Composition-based stats. Identities = 26/56 (46%), Positives = 40/56 (71%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 ++ + L+ILVCP+TKG L + EL S++A LAYPI+ G+P ML +EAR + ++ Sbjct: 1 MEKKFLDILVCPVTKGKLEYHQDKQELWSRQAKLAYPIKDGIPYMLENEARALSEE 56 >gi|70729163|ref|YP_258899.1| hypothetical protein PFL_1779 [Pseudomonas fluorescens Pf-5] gi|123656972|sp|Q4KFT4|Y1779_PSEF5 RecName: Full=UPF0434 protein PFL_1779 gi|68343462|gb|AAY91068.1| Protein of unknown function (DUF343) superfamily [Pseudomonas fluorescens Pf-5] Length = 61 Score = 94.1 bits (234), Expect = 6e-18, Method: Composition-based stats. Identities = 31/56 (55%), Positives = 42/56 (75%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LL+IL CP+ KG L L ++ TEL+SK A LAYPIR G+P+ML SEAR + + Sbjct: 1 MDTKLLDILACPICKGPLKLSADKTELISKGAGLAYPIRDGIPVMLESEARTLTTE 56 >gi|229591206|ref|YP_002873325.1| hypothetical protein PFLU3771 [Pseudomonas fluorescens SBW25] gi|312961636|ref|ZP_07776134.1| UPF0434 protein [Pseudomonas fluorescens WH6] gi|259647016|sp|C3JY28|Y3771_PSEFS RecName: Full=UPF0434 protein PFLU_3771 gi|229363072|emb|CAY50057.1| conserved hypothetical protein [Pseudomonas fluorescens SBW25] gi|311283895|gb|EFQ62478.1| UPF0434 protein [Pseudomonas fluorescens WH6] Length = 61 Score = 94.1 bits (234), Expect = 6e-18, Method: Composition-based stats. Identities = 31/56 (55%), Positives = 41/56 (73%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LL+IL CP+ KG L L ++ TEL+SK A LAYPIR G+P+ML SEAR + Sbjct: 1 MDTKLLDILACPICKGPLKLSADKTELISKGAGLAYPIRDGIPVMLESEARTLTTD 56 >gi|148261116|ref|YP_001235243.1| hypothetical protein Acry_2125 [Acidiphilium cryptum JF-5] gi|326404517|ref|YP_004284599.1| hypothetical protein ACMV_23700 [Acidiphilium multivorum AIU301] gi|146402797|gb|ABQ31324.1| protein of unknown function DUF343 [Acidiphilium cryptum JF-5] gi|325051379|dbj|BAJ81717.1| hypothetical protein ACMV_23700 [Acidiphilium multivorum AIU301] Length = 61 Score = 94.1 bits (234), Expect = 6e-18, Method: Composition-based stats. Identities = 38/55 (69%), Positives = 43/55 (78%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 IDP+LLEILVCPLTKG L E EL+S KA LA+PIR G+PIMLV EARQ+D Sbjct: 6 PIDPRLLEILVCPLTKGPLIYDREAGELISTKAGLAFPIRDGIPIMLVDEARQID 60 >gi|15966939|ref|NP_387292.1| hypothetical protein SMc03803 [Sinorhizobium meliloti 1021] gi|81633734|sp|Q92L94|Y3186_RHIME RecName: Full=UPF0434 protein R03186 gi|15076212|emb|CAC47765.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021] Length = 62 Score = 93.8 bits (233), Expect = 6e-18, Method: Composition-based stats. Identities = 39/62 (62%), Positives = 48/62 (77%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 M +DP+LLE+LVCPLTKG L+ E EL+S+KA LAYPIR GVPIMLVSEAR++ Sbjct: 1 MDINASKVDPKLLELLVCPLTKGRLSYDPEANELVSEKARLAYPIRDGVPIMLVSEARKI 60 Query: 61 DD 62 +D Sbjct: 61 ED 62 >gi|170738829|ref|YP_001767484.1| hypothetical protein M446_0487 [Methylobacterium sp. 4-46] gi|226707625|sp|B0UM25|Y487_METS4 RecName: Full=UPF0434 protein M446_0487 gi|168193103|gb|ACA15050.1| protein of unknown function DUF343 [Methylobacterium sp. 4-46] Length = 66 Score = 93.8 bits (233), Expect = 7e-18, Method: Composition-based stats. Identities = 34/55 (61%), Positives = 41/55 (74%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 IDP+LLE+LVCPLTKG L S EL+S+ A LAYPIR G+PIML EAR + + Sbjct: 12 IDPKLLELLVCPLTKGRLEYDSARQELISRSAKLAYPIRDGIPIMLPEEARPLAE 66 >gi|119472938|ref|ZP_01614811.1| hypothetical protein ATW7_13388 [Alteromonadales bacterium TW-7] gi|119444656|gb|EAW25965.1| hypothetical protein ATW7_13388 [Alteromonadales bacterium TW-7] Length = 65 Score = 93.8 bits (233), Expect = 7e-18, Method: Composition-based stats. Identities = 22/58 (37%), Positives = 38/58 (65%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 D +LL+I+ CP+ KG L + +EL+S A LAYP++ +P++L +EAR++ + Sbjct: 1 MAFDTKLLDIIACPVCKGKLRFDKDNSELISTAAKLAYPVKDDIPVLLENEARELSLE 58 >gi|329910414|ref|ZP_08275299.1| hypothetical protein IMCC9480_151 [Oxalobacteraceae bacterium IMCC9480] gi|327546182|gb|EGF31228.1| hypothetical protein IMCC9480_151 [Oxalobacteraceae bacterium IMCC9480] Length = 62 Score = 93.8 bits (233), Expect = 7e-18, Method: Composition-based stats. Identities = 26/52 (50%), Positives = 34/52 (65%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 +D +LL+ILVCP+ KG L + EL+ LAYPIR G+PIM EAR+ Sbjct: 1 MDTRLLDILVCPICKGPLEFDKKAQELICHADRLAYPIRDGIPIMWADEARE 52 >gi|54309550|ref|YP_130570.1| hypothetical protein PBPRA2383 [Photobacterium profundum SS9] gi|90413113|ref|ZP_01221110.1| hypothetical protein P3TCK_00760 [Photobacterium profundum 3TCK] gi|81399269|sp|Q6LPK8|Y2383_PHOPR RecName: Full=UPF0434 protein PBPRA2383 gi|46913986|emb|CAG20768.1| conserved hypothetical protein [Photobacterium profundum SS9] gi|90325956|gb|EAS42402.1| hypothetical protein P3TCK_00760 [Photobacterium profundum 3TCK] Length = 59 Score = 93.8 bits (233), Expect = 7e-18, Method: Composition-based stats. Identities = 24/56 (42%), Positives = 35/56 (62%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ KG L E EL+ K LAYPI+ G+P+++ EAR + Sbjct: 1 MDHRLLEIVACPVCKGKLNYDKEKNELICKFDRLAYPIQDGIPVLIEPEARTLSSD 56 >gi|307301712|ref|ZP_07581471.1| protein of unknown function DUF343 [Sinorhizobium meliloti BL225C] gi|307316265|ref|ZP_07595709.1| protein of unknown function DUF343 [Sinorhizobium meliloti AK83] gi|306898105|gb|EFN28847.1| protein of unknown function DUF343 [Sinorhizobium meliloti AK83] gi|306903410|gb|EFN33999.1| protein of unknown function DUF343 [Sinorhizobium meliloti BL225C] Length = 66 Score = 93.8 bits (233), Expect = 7e-18, Method: Composition-based stats. Identities = 39/62 (62%), Positives = 48/62 (77%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 M +DP+LLE+LVCPLTKG L+ E EL+S+KA LAYPIR GVPIMLVSEAR++ Sbjct: 5 MDINASKVDPKLLELLVCPLTKGRLSYDPEANELVSEKARLAYPIRDGVPIMLVSEARKI 64 Query: 61 DD 62 +D Sbjct: 65 ED 66 >gi|254670325|emb|CBA05711.1| conserved hypothetical protein [Neisseria meningitidis alpha153] gi|308388860|gb|ADO31180.1| Tetraacyldisaccharide 4'-kinase [Neisseria meningitidis alpha710] gi|325129796|gb|EGC52604.1| hypothetical protein NMBOX9930304_1390 [Neisseria meningitidis OX99.30304] gi|325133811|gb|EGC56467.1| hypothetical protein NMBM13399_1535 [Neisseria meningitidis M13399] gi|325135734|gb|EGC58346.1| hypothetical protein NMBM0579_1442 [Neisseria meningitidis M0579] gi|325202530|gb|ADY97984.1| conserved hypothetical protein [Neisseria meningitidis M01-240149] Length = 60 Score = 93.8 bits (233), Expect = 7e-18, Method: Composition-based stats. Identities = 26/56 (46%), Positives = 40/56 (71%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 ++ + L+ILVCP+TKG L + EL S++A LAYPI+ G+P ML +EAR + ++ Sbjct: 1 MEKKFLDILVCPVTKGRLEYHQDKQELWSRQAKLAYPIKDGIPYMLENEARTLSEE 56 >gi|150398241|ref|YP_001328708.1| hypothetical protein Smed_3047 [Sinorhizobium medicae WSM419] gi|166988574|sp|A6UDZ3|Y3047_SINMW RecName: Full=UPF0434 protein Smed_3047 gi|150029756|gb|ABR61873.1| protein of unknown function DUF343 [Sinorhizobium medicae WSM419] Length = 62 Score = 93.8 bits (233), Expect = 7e-18, Method: Composition-based stats. Identities = 37/62 (59%), Positives = 48/62 (77%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 M +DP+LLE+LVCPLTKG L+ E EL+S+KA LAYPIR GVPIML+SEAR++ Sbjct: 1 MDVNASKVDPKLLELLVCPLTKGRLSYDPEANELVSEKARLAYPIRDGVPIMLISEARKI 60 Query: 61 DD 62 ++ Sbjct: 61 EE 62 >gi|152983287|ref|YP_001354268.1| hypothetical protein mma_2578 [Janthinobacterium sp. Marseille] gi|166987520|sp|A6T171|Y2578_JANMA RecName: Full=UPF0434 protein mma_2578 gi|151283364|gb|ABR91774.1| Uncharacterized conserved protein [Janthinobacterium sp. Marseille] Length = 60 Score = 93.8 bits (233), Expect = 7e-18, Method: Composition-based stats. Identities = 26/53 (49%), Positives = 35/53 (66%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 +D +LL+ILVCP+ KG L + EL+ K LAYPIR G+PIM +AR + Sbjct: 1 MDARLLDILVCPICKGPLEHDKKAQELICKADKLAYPIRDGIPIMWADQARDL 53 >gi|262275605|ref|ZP_06053414.1| hypothetical protein VHA_002586 [Grimontia hollisae CIP 101886] gi|262219413|gb|EEY70729.1| hypothetical protein VHA_002586 [Grimontia hollisae CIP 101886] Length = 60 Score = 93.8 bits (233), Expect = 8e-18, Method: Composition-based stats. Identities = 27/56 (48%), Positives = 36/56 (64%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP KG L E EL+ K LAYPIR G+P+ML +EAR++ Sbjct: 1 MDHRLLEIVACPACKGKLNYNKEKNELVCKFDRLAYPIREGIPVMLTTEAREMSSD 56 >gi|88607123|ref|YP_504685.1| hypothetical protein APH_0052 [Anaplasma phagocytophilum HZ] gi|123495878|sp|Q2GLR6|Y052_ANAPZ RecName: Full=UPF0434 protein APH_0052 gi|88598186|gb|ABD43656.1| conserved hypothetical protein [Anaplasma phagocytophilum HZ] Length = 71 Score = 93.8 bits (233), Expect = 8e-18, Method: Composition-based stats. Identities = 31/57 (54%), Positives = 43/57 (75%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D ++LEILVCPLT G L+ +E EL+S +A LAYP+R G+PIMLV EAR++ + Sbjct: 1 MLDKKVLEILVCPLTGGKLSYDTERAELISHEAGLAYPVRDGIPIMLVDEARKLQPE 57 >gi|28870997|ref|NP_793616.1| hypothetical protein PSPTO_3844 [Pseudomonas syringae pv. tomato str. DC3000] gi|301382845|ref|ZP_07231263.1| hypothetical protein PsyrptM_09437 [Pseudomonas syringae pv. tomato Max13] gi|302062849|ref|ZP_07254390.1| hypothetical protein PsyrptK_22922 [Pseudomonas syringae pv. tomato K40] gi|302131674|ref|ZP_07257664.1| hypothetical protein PsyrptN_09787 [Pseudomonas syringae pv. tomato NCPPB 1108] gi|81730167|sp|Q87YF6|Y3844_PSESM RecName: Full=UPF0434 protein PSPTO_3844 gi|28854246|gb|AAO57311.1| conserved protein of unknown function [Pseudomonas syringae pv. tomato str. DC3000] gi|330878263|gb|EGH12412.1| hypothetical protein PSYMP_20859 [Pseudomonas syringae pv. morsprunorum str. M302280PT] gi|330966260|gb|EGH66520.1| hypothetical protein PSYAC_16756 [Pseudomonas syringae pv. actinidiae str. M302091] gi|331019168|gb|EGH99224.1| hypothetical protein PLA106_24273 [Pseudomonas syringae pv. lachrymans str. M302278PT] Length = 61 Score = 93.8 bits (233), Expect = 8e-18, Method: Composition-based stats. Identities = 30/56 (53%), Positives = 41/56 (73%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LL+IL CP+ KG L L ++ TEL+SK A LAYP+R G+P+ML SEAR + Sbjct: 1 MDTKLLDILACPICKGPLKLSADKTELISKGAGLAYPVRDGIPVMLESEARTLTTD 56 >gi|317047564|ref|YP_004115212.1| hypothetical protein Pat9b_1335 [Pantoea sp. At-9b] gi|316949181|gb|ADU68656.1| protein of unknown function DUF343 [Pantoea sp. At-9b] Length = 60 Score = 93.4 bits (232), Expect = 8e-18, Method: Composition-based stats. Identities = 23/56 (41%), Positives = 36/56 (64%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ G L E EL+ K LA+P+R G+P++L +EAR + + Sbjct: 1 MDHRLLEIVACPVCNGKLYYNKEQQELICKPDGLAFPVRDGIPVLLENEARTLSVE 56 >gi|90020944|ref|YP_526771.1| acetoacetyl-CoA reductase [Saccharophagus degradans 2-40] gi|122996358|sp|Q21L70|Y1297_SACD2 RecName: Full=UPF0434 protein Sde_1297 gi|89950544|gb|ABD80559.1| protein of unknown function DUF343 [Saccharophagus degradans 2-40] Length = 63 Score = 93.4 bits (232), Expect = 8e-18, Method: Composition-based stats. Identities = 25/57 (43%), Positives = 35/57 (61%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LL +LVCP+TK L EL+ + LAYPIR G+P+ML EAR + + Sbjct: 1 MLDQKLLSLLVCPVTKAPLIYDEPKQELVCVASGLAYPIRDGIPVMLEGEARVLSQE 57 >gi|119505420|ref|ZP_01627493.1| Acetoacetyl-CoA reductase [marine gamma proteobacterium HTCC2080] gi|119458698|gb|EAW39800.1| Acetoacetyl-CoA reductase [marine gamma proteobacterium HTCC2080] Length = 61 Score = 93.4 bits (232), Expect = 9e-18, Method: Composition-based stats. Identities = 28/57 (49%), Positives = 39/57 (68%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +DP+LLEILVCP++K L E EL+ + + LAYPIR +P+ML SEAR + + Sbjct: 1 MLDPKLLEILVCPVSKAPLEYQPEQQELVCRASGLAYPIRDDIPVMLESEARSLSLE 57 >gi|15598176|ref|NP_251670.1| hypothetical protein PA2980 [Pseudomonas aeruginosa PAO1] gi|116050982|ref|YP_790193.1| hypothetical protein PA14_25520 [Pseudomonas aeruginosa UCBPP-PA14] gi|218890821|ref|YP_002439685.1| hypothetical protein PLES_20821 [Pseudomonas aeruginosa LESB58] gi|254235954|ref|ZP_04929277.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719] gi|254241687|ref|ZP_04935009.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192] gi|296388527|ref|ZP_06878002.1| hypothetical protein PaerPAb_10268 [Pseudomonas aeruginosa PAb1] gi|313108222|ref|ZP_07794301.1| hypothetical protein PA39016_001320004 [Pseudomonas aeruginosa 39016] gi|81540571|sp|Q9HZM4|Y2980_PSEAE RecName: Full=UPF0434 protein PA2980 gi|122260111|sp|Q02PE3|Y2552_PSEAB RecName: Full=UPF0434 protein PA14_25520 gi|226701158|sp|B7V148|Y2082_PSEA8 RecName: Full=UPF0434 protein PLES_20821 gi|9949079|gb|AAG06368.1|AE004723_12 conserved hypothetical protein [Pseudomonas aeruginosa PAO1] gi|115586203|gb|ABJ12218.1| conserved hypothetical protein [Pseudomonas aeruginosa UCBPP-PA14] gi|126167885|gb|EAZ53396.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719] gi|126195065|gb|EAZ59128.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192] gi|218771044|emb|CAW26809.1| conserved hypothetical protein [Pseudomonas aeruginosa LESB58] gi|310880803|gb|EFQ39397.1| hypothetical protein PA39016_001320004 [Pseudomonas aeruginosa 39016] Length = 61 Score = 93.4 bits (232), Expect = 9e-18, Method: Composition-based stats. Identities = 34/56 (60%), Positives = 44/56 (78%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +DP+LL+IL CPLTKG L L + TEL+SK+A LAYPIR G+P+ML SEAR ++ Sbjct: 1 MDPKLLDILACPLTKGPLVLSEDKTELISKQAGLAYPIRDGIPVMLESEARSLNVD 56 >gi|153010607|ref|YP_001371821.1| hypothetical protein Oant_3286 [Ochrobactrum anthropi ATCC 49188] gi|166990758|sp|A6X438|Y3286_OCHA4 RecName: Full=UPF0434 protein Oant_3286 gi|151562495|gb|ABS15992.1| protein of unknown function DUF343 [Ochrobactrum anthropi ATCC 49188] Length = 64 Score = 93.4 bits (232), Expect = 9e-18, Method: Composition-based stats. Identities = 35/56 (62%), Positives = 44/56 (78%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 NID +LLE+LVCPLTKG L +E EL+S+KA LAYP+R G+PIML SEAR + + Sbjct: 9 NIDVRLLELLVCPLTKGPLEYDAEHGELISRKAKLAYPVRGGIPIMLPSEARSLTE 64 >gi|260222821|emb|CBA32772.1| UPF0434 protein Bpro_2950 [Curvibacter putative symbiont of Hydra magnipapillata] Length = 60 Score = 93.4 bits (232), Expect = 9e-18, Method: Composition-based stats. Identities = 28/55 (50%), Positives = 41/55 (74%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 +D +L+E+LVCP+TKG L E EL+S+ A LAYP+R G+P++L +EAR + D Sbjct: 1 MDTRLIELLVCPVTKGPLEFDREKQELISRSARLAYPVRDGIPVLLENEARVLTD 55 >gi|302381321|ref|YP_003817144.1| hypothetical protein Bresu_0206 [Brevundimonas subvibrioides ATCC 15264] gi|302191949|gb|ADK99520.1| protein of unknown function DUF343 [Brevundimonas subvibrioides ATCC 15264] Length = 64 Score = 93.4 bits (232), Expect = 1e-17, Method: Composition-based stats. Identities = 34/64 (53%), Positives = 44/64 (68%), Gaps = 3/64 (4%) Query: 1 MRETI---FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEA 57 M +T ++DP+LLE+LVCP+T+G L EL+SK A LA+PIR GVPIML EA Sbjct: 1 MSDTFNTPSSVDPRLLEVLVCPVTRGRLDYDRAANELISKSAKLAFPIRDGVPIMLPEEA 60 Query: 58 RQVD 61 R +D Sbjct: 61 RALD 64 >gi|116254295|ref|YP_770133.1| hypothetical protein RL4569 [Rhizobium leguminosarum bv. viciae 3841] gi|148841367|sp|Q1MAI6|Y4569_RHIL3 RecName: Full=UPF0434 protein RL4569 gi|115258943|emb|CAK10052.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae 3841] Length = 62 Score = 93.4 bits (232), Expect = 1e-17, Method: Composition-based stats. Identities = 37/62 (59%), Positives = 50/62 (80%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 M E + +DP+LL++LVCPL+KG L+ E EL+S+KA LAYPIR G+PIML+SEAR++ Sbjct: 1 MDEKLSRVDPKLLDLLVCPLSKGRLSYDREHNELVSEKARLAYPIRDGIPIMLMSEARRL 60 Query: 61 DD 62 DD Sbjct: 61 DD 62 >gi|114769836|ref|ZP_01447446.1| hypothetical protein OM2255_09716 [alpha proteobacterium HTCC2255] gi|114549541|gb|EAU52423.1| hypothetical protein OM2255_09716 [alpha proteobacterium HTCC2255] Length = 57 Score = 93.4 bits (232), Expect = 1e-17, Method: Composition-based stats. Identities = 33/57 (57%), Positives = 45/57 (78%) Query: 5 IFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 + IDP++LEILVCP+T G+LT +E EL+S A LAYPIR+G+P+ML EAR++D Sbjct: 1 MIQIDPKMLEILVCPITFGSLTYNAETQELISNSAKLAYPIRNGIPVMLPDEARKID 57 >gi|114326916|ref|YP_744073.1| cytosolic protein [Granulibacter bethesdensis CGDNIH1] gi|122328099|sp|Q0BVK2|Y252_GRABC RecName: Full=UPF0434 protein GbCGDNIH1_0252 gi|114315090|gb|ABI61150.1| conserved cytosolic protein [Granulibacter bethesdensis CGDNIH1] Length = 79 Score = 93.4 bits (232), Expect = 1e-17, Method: Composition-based stats. Identities = 31/56 (55%), Positives = 42/56 (75%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 +DP+LLEILVCP+T+ L + EL+S+KA LAYPIR G+PIML EAR++ + Sbjct: 24 TVDPRLLEILVCPVTRDTLVYDAAAGELISRKAGLAYPIRDGIPIMLPEEARRLPE 79 >gi|254292397|ref|YP_003058420.1| hypothetical protein Hbal_0021 [Hirschia baltica ATCC 49814] gi|254040928|gb|ACT57723.1| protein of unknown function DUF343 [Hirschia baltica ATCC 49814] Length = 70 Score = 93.4 bits (232), Expect = 1e-17, Method: Composition-based stats. Identities = 35/55 (63%), Positives = 46/55 (83%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 IDP+LLE+L+CP ++G L+ E EL+SKKA+LAYPIR GVPIML+ EAR++DD Sbjct: 15 IDPRLLEVLICPASRGPLSYDKETNELISKKANLAYPIREGVPIMLIDEARELDD 69 >gi|163796434|ref|ZP_02190394.1| hypothetical protein BAL199_10742 [alpha proteobacterium BAL199] gi|159178284|gb|EDP62828.1| hypothetical protein BAL199_10742 [alpha proteobacterium BAL199] Length = 80 Score = 93.4 bits (232), Expect = 1e-17, Method: Composition-based stats. Identities = 33/56 (58%), Positives = 42/56 (75%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEILVCP+TK L+ E EL+S+ A LA+PIR GVPIMLV EAR +D + Sbjct: 16 VDSKLLEILVCPITKRQLSYDREAGELISESARLAFPIRDGVPIMLVDEARSLDAE 71 >gi|183598368|ref|ZP_02959861.1| hypothetical protein PROSTU_01760 [Providencia stuartii ATCC 25827] gi|188020544|gb|EDU58584.1| hypothetical protein PROSTU_01760 [Providencia stuartii ATCC 25827] Length = 59 Score = 93.4 bits (232), Expect = 1e-17, Method: Composition-based stats. Identities = 29/58 (50%), Positives = 40/58 (68%), Gaps = 1/58 (1%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD-DQG 64 +D +LLEI+ CP+ G L+ E EL+ K LAYPIR G+P++L SEAR+V D+G Sbjct: 1 MDHRLLEIIACPICHGKLSYNKENLELICKFDHLAYPIRDGIPVLLESEARKVALDEG 58 >gi|220921605|ref|YP_002496906.1| hypothetical protein Mnod_1613 [Methylobacterium nodulans ORS 2060] gi|254800584|sp|B8IPV3|Y1613_METNO RecName: Full=UPF0434 protein Mnod_1613 gi|219946211|gb|ACL56603.1| protein of unknown function DUF343 [Methylobacterium nodulans ORS 2060] Length = 66 Score = 93.4 bits (232), Expect = 1e-17, Method: Composition-based stats. Identities = 35/55 (63%), Positives = 41/55 (74%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 IDP+LLE+LVCPLTKG L S EL+S+ A LAYPIR G+PIML EAR + D Sbjct: 12 IDPKLLELLVCPLTKGRLEYDSARQELISRSAKLAYPIRDGIPIMLPEEARPLAD 66 >gi|114799656|ref|YP_762216.1| hypothetical protein HNE_3545 [Hyphomonas neptunium ATCC 15444] gi|122941982|sp|Q0BWC7|Y3545_HYPNA RecName: Full=UPF0434 protein HNE_3545 gi|114739830|gb|ABI77955.1| conserved hypothetical protein [Hyphomonas neptunium ATCC 15444] Length = 85 Score = 93.0 bits (231), Expect = 1e-17, Method: Composition-based stats. Identities = 32/55 (58%), Positives = 39/55 (70%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 +DP+LLEIL+CP T+ L EL+SK A LAYPIR G+PIML EAR +DD Sbjct: 21 VDPRLLEILICPATRQPLAYDRARHELVSKNARLAYPIRGGIPIMLEEEARDLDD 75 >gi|152987989|ref|YP_001347553.1| hypothetical protein PSPA7_2181 [Pseudomonas aeruginosa PA7] gi|166987406|sp|A6V3B8|Y2181_PSEA7 RecName: Full=UPF0434 protein PSPA7_2181 gi|150963147|gb|ABR85172.1| conserved hypothetical protein [Pseudomonas aeruginosa PA7] Length = 61 Score = 93.0 bits (231), Expect = 1e-17, Method: Composition-based stats. Identities = 33/56 (58%), Positives = 44/56 (78%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +DP+LL+IL CPLTKG L L + +EL+SK+A LAYPIR G+P+ML SEAR ++ Sbjct: 1 MDPKLLDILACPLTKGPLVLSEDKSELISKQAGLAYPIRDGIPVMLESEARALNVD 56 >gi|62179514|ref|YP_215931.1| hypothetical protein SC0944 [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] gi|62127147|gb|AAX64850.1| putative inner membrane protein [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] gi|322713981|gb|EFZ05552.1| hypothetical protein SCA50_1022 [Salmonella enterica subsp. enterica serovar Choleraesuis str. A50] Length = 75 Score = 93.0 bits (231), Expect = 1e-17, Method: Composition-based stats. Identities = 23/57 (40%), Positives = 36/57 (63%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ G L E EL+ K +LA+P+R G+P++L +EAR + Sbjct: 15 TMDHRLLEIIACPVCNGKLWYNQEQQELICKLDNLAFPLRDGIPVLLENEARALTSD 71 >gi|45441021|ref|NP_992560.1| hypothetical protein YP_1194 [Yersinia pestis biovar Microtus str. 91001] gi|45435880|gb|AAS61437.1| conserved hypothetical protein [Yersinia pestis biovar Microtus str. 91001] Length = 77 Score = 93.0 bits (231), Expect = 1e-17, Method: Composition-based stats. Identities = 24/56 (42%), Positives = 36/56 (64%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ G L E EL+ K +LAYP+R G+P++L +EAR + Sbjct: 18 MDHRLLEIVACPVCNGKLYFNKENLELVCKVDNLAYPVRDGIPVLLENEARPLSID 73 >gi|313668851|ref|YP_004049135.1| hypothetical protein NLA_15670 [Neisseria lactamica ST-640] gi|313006313|emb|CBN87776.1| conserved hypothetical protein [Neisseria lactamica 020-06] Length = 60 Score = 93.0 bits (231), Expect = 1e-17, Method: Composition-based stats. Identities = 26/56 (46%), Positives = 40/56 (71%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 ++ + L+ILVCP+TKG L + EL S++A LAYPI+ G+P ML +EAR + ++ Sbjct: 1 MEKKFLDILVCPVTKGRLEYHQDKQELWSRQAKLAYPIKDGIPYMLENEARALSEE 56 >gi|15676572|ref|NP_273716.1| hypothetical protein NMB0674 [Neisseria meningitidis MC58] gi|59800697|ref|YP_207409.1| hypothetical protein NGO0244 [Neisseria gonorrhoeae FA 1090] gi|194097957|ref|YP_002001003.1| UPF0434 protein [Neisseria gonorrhoeae NCCP11945] gi|218767795|ref|YP_002342307.1| hypothetical protein NMA0874 [Neisseria meningitidis Z2491] gi|239998431|ref|ZP_04718355.1| hypothetical protein Ngon3_02990 [Neisseria gonorrhoeae 35/02] gi|240013556|ref|ZP_04720469.1| hypothetical protein NgonD_02728 [Neisseria gonorrhoeae DGI18] gi|240015995|ref|ZP_04722535.1| hypothetical protein NgonFA_02321 [Neisseria gonorrhoeae FA6140] gi|240080135|ref|ZP_04724678.1| hypothetical protein NgonF_02334 [Neisseria gonorrhoeae FA19] gi|240112349|ref|ZP_04726839.1| hypothetical protein NgonM_01978 [Neisseria gonorrhoeae MS11] gi|240115089|ref|ZP_04729151.1| hypothetical protein NgonPID1_02366 [Neisseria gonorrhoeae PID18] gi|240117373|ref|ZP_04731435.1| hypothetical protein NgonPID_02766 [Neisseria gonorrhoeae PID1] gi|240120175|ref|ZP_04733137.1| hypothetical protein NgonPI_00010 [Neisseria gonorrhoeae PID24-1] gi|240122928|ref|ZP_04735884.1| hypothetical protein NgonP_03139 [Neisseria gonorrhoeae PID332] gi|240125181|ref|ZP_04738067.1| hypothetical protein NgonSK_02994 [Neisseria gonorrhoeae SK-92-679] gi|240127637|ref|ZP_04740298.1| hypothetical protein NgonS_03151 [Neisseria gonorrhoeae SK-93-1035] gi|254493149|ref|ZP_05106320.1| conserved hypothetical protein [Neisseria gonorrhoeae 1291] gi|255065578|ref|ZP_05317433.1| tetraacyldisaccharide 4'-kinase [Neisseria sicca ATCC 29256] gi|260441095|ref|ZP_05794911.1| hypothetical protein NgonDG_08432 [Neisseria gonorrhoeae DGI2] gi|261365450|ref|ZP_05978333.1| tetraacyldisaccharide 4'-kinase [Neisseria mucosa ATCC 25996] gi|261377923|ref|ZP_05982496.1| tetraacyldisaccharide 4'-kinase [Neisseria cinerea ATCC 14685] gi|268594292|ref|ZP_06128459.1| conserved hypothetical protein [Neisseria gonorrhoeae 35/02] gi|268596286|ref|ZP_06130453.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19] gi|268598406|ref|ZP_06132573.1| conserved hypothetical protein [Neisseria gonorrhoeae MS11] gi|268600761|ref|ZP_06134928.1| conserved hypothetical protein [Neisseria gonorrhoeae PID18] gi|268603068|ref|ZP_06137235.1| tetraacyldisaccharide 4'-kinase [Neisseria gonorrhoeae PID1] gi|268681547|ref|ZP_06148409.1| tetraacyldisaccharide 4'-kinase [Neisseria gonorrhoeae PID332] gi|268683776|ref|ZP_06150638.1| tetraacyldisaccharide 4'-kinase [Neisseria gonorrhoeae SK-92-679] gi|268686016|ref|ZP_06152878.1| tetraacyldisaccharide 4'-kinase [Neisseria gonorrhoeae SK-93-1035] gi|291044428|ref|ZP_06570137.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2] gi|293399608|ref|ZP_06643761.1| hypothetical protein NGNG_01596 [Neisseria gonorrhoeae F62] gi|294671082|ref|ZP_06735937.1| hypothetical protein NEIELOOT_02790 [Neisseria elongata subsp. glycolytica ATCC 29315] gi|296315033|ref|ZP_06864974.1| tetraacyldisaccharide 4'-kinase [Neisseria polysaccharea ATCC 43768] gi|75356373|sp|Q5F9Z0|Y244_NEIG1 RecName: Full=UPF0434 protein NGO0244 gi|81707231|sp|Q7DDM0|Y674_NEIMB RecName: Full=UPF0434 protein NMB0674 gi|148841374|sp|A1IQS5|Y874_NEIMA RecName: Full=UPF0434 protein NMA0874 gi|226706050|sp|B4RJR8|Y378_NEIG2 RecName: Full=UPF0434 protein NGK_0378 gi|7225901|gb|AAF41092.1| conserved hypothetical protein [Neisseria meningitidis MC58] gi|59717592|gb|AAW88997.1| conserved hypothetical protein [Neisseria gonorrhoeae FA 1090] gi|121051803|emb|CAM08109.1| hypothetical protein NMA0874 [Neisseria meningitidis Z2491] gi|193933247|gb|ACF29071.1| UPF0434 protein [Neisseria gonorrhoeae NCCP11945] gi|226512189|gb|EEH61534.1| conserved hypothetical protein [Neisseria gonorrhoeae 1291] gi|254671901|emb|CBA04192.1| conserved hypothetical protein [Neisseria meningitidis alpha275] gi|255050403|gb|EET45867.1| tetraacyldisaccharide 4'-kinase [Neisseria sicca ATCC 29256] gi|261392953|emb|CAX50538.1| conserved hypothetical protein [Neisseria meningitidis 8013] gi|268547681|gb|EEZ43099.1| conserved hypothetical protein [Neisseria gonorrhoeae 35/02] gi|268550074|gb|EEZ45093.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19] gi|268582537|gb|EEZ47213.1| conserved hypothetical protein [Neisseria gonorrhoeae MS11] gi|268584892|gb|EEZ49568.1| conserved hypothetical protein [Neisseria gonorrhoeae PID18] gi|268587199|gb|EEZ51875.1| tetraacyldisaccharide 4'-kinase [Neisseria gonorrhoeae PID1] gi|268621831|gb|EEZ54231.1| tetraacyldisaccharide 4'-kinase [Neisseria gonorrhoeae PID332] gi|268624060|gb|EEZ56460.1| tetraacyldisaccharide 4'-kinase [Neisseria gonorrhoeae SK-92-679] gi|268626300|gb|EEZ58700.1| tetraacyldisaccharide 4'-kinase [Neisseria gonorrhoeae SK-93-1035] gi|269145783|gb|EEZ72201.1| tetraacyldisaccharide 4'-kinase [Neisseria cinerea ATCC 14685] gi|288566118|gb|EFC87678.1| tetraacyldisaccharide 4'-kinase [Neisseria mucosa ATCC 25996] gi|291011322|gb|EFE03318.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2] gi|291307190|gb|EFE48433.1| hypothetical protein NEIELOOT_02790 [Neisseria elongata subsp. glycolytica ATCC 29315] gi|291610177|gb|EFF39299.1| hypothetical protein NGNG_01596 [Neisseria gonorrhoeae F62] gi|296838240|gb|EFH22178.1| tetraacyldisaccharide 4'-kinase [Neisseria polysaccharea ATCC 43768] gi|309378934|emb|CBX22387.1| unnamed protein product [Neisseria lactamica Y92-1009] gi|316983642|gb|EFV62623.1| trm112p-like family protein [Neisseria meningitidis H44/76] gi|317163716|gb|ADV07257.1| hypothetical protein NGTW08_0284 [Neisseria gonorrhoeae TCDC-NG08107] gi|319410046|emb|CBY90380.1| conserved hypothetical protein [Neisseria meningitidis WUE 2594] gi|325131873|gb|EGC54573.1| hypothetical protein NMBM6190_1400 [Neisseria meningitidis M6190] gi|325137923|gb|EGC60498.1| hypothetical protein NMBES14902_1550 [Neisseria meningitidis ES14902] gi|325139877|gb|EGC62408.1| hypothetical protein NMBCU385_1459 [Neisseria meningitidis CU385] gi|325141953|gb|EGC64393.1| hypothetical protein NMB9615945_1482 [Neisseria meningitidis 961-5945] gi|325197894|gb|ADY93350.1| conserved hypothetical protein [Neisseria meningitidis G2136] gi|325200640|gb|ADY96095.1| conserved hypothetical protein [Neisseria meningitidis H44/76] Length = 60 Score = 93.0 bits (231), Expect = 1e-17, Method: Composition-based stats. Identities = 26/56 (46%), Positives = 40/56 (71%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 ++ + L+ILVCP+TKG L + EL S++A LAYPI+ G+P ML +EAR + ++ Sbjct: 1 MEKKFLDILVCPVTKGRLEYHQDKQELWSRQAKLAYPIKDGIPYMLENEARALSEE 56 >gi|113970755|ref|YP_734548.1| hypothetical protein Shewmr4_2420 [Shewanella sp. MR-4] gi|114047982|ref|YP_738532.1| hypothetical protein Shewmr7_2490 [Shewanella sp. MR-7] gi|117921023|ref|YP_870215.1| hypothetical protein Shewana3_2582 [Shewanella sp. ANA-3] gi|122943731|sp|Q0HHH6|Y2420_SHESM RecName: Full=UPF0434 protein Shewmr4_2420 gi|123131271|sp|Q0HTT0|Y2490_SHESR RecName: Full=UPF0434 protein Shewmr7_2490 gi|148841357|sp|A0KYE0|Y2582_SHESA RecName: Full=UPF0434 protein Shewana3_2582 gi|113885439|gb|ABI39491.1| protein of unknown function DUF343 [Shewanella sp. MR-4] gi|113889424|gb|ABI43475.1| protein of unknown function DUF343 [Shewanella sp. MR-7] gi|117613355|gb|ABK48809.1| protein of unknown function DUF343 [Shewanella sp. ANA-3] Length = 59 Score = 93.0 bits (231), Expect = 1e-17, Method: Composition-based stats. Identities = 20/57 (35%), Positives = 33/57 (57%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 D +LL+I+ CP+ KG L +L+ K LAYPI G+P++L + A +++ Sbjct: 1 MAFDKKLLDIVACPVCKGKLEYDKTTQQLICKADKLAYPITDGIPVLLENRAVPLNE 57 >gi|254430006|ref|ZP_05043713.1| conserved hypothetical protein [Alcanivorax sp. DG881] gi|196196175|gb|EDX91134.1| conserved hypothetical protein [Alcanivorax sp. DG881] Length = 62 Score = 93.0 bits (231), Expect = 1e-17, Method: Composition-based stats. Identities = 27/57 (47%), Positives = 38/57 (66%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 IDP LL+ILVCP++K L + EL K + LAYP+R G+P+ML +AR + D+ Sbjct: 1 MIDPNLLDILVCPVSKAPLIYDEKSAELKCKASGLAYPVRDGIPVMLEEQARTMGDE 57 >gi|118595153|ref|ZP_01552500.1| hypothetical protein MB2181_05755 [Methylophilales bacterium HTCC2181] gi|118440931|gb|EAV47558.1| hypothetical protein MB2181_05755 [Methylophilales bacterium HTCC2181] Length = 57 Score = 93.0 bits (231), Expect = 1e-17, Method: Composition-based stats. Identities = 31/56 (55%), Positives = 38/56 (67%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LL ILVCP+TKG L E EL+S A LAYPI+ G+PI+L SEAR V Sbjct: 1 MDTKLLSILVCPVTKGPLEFDKENNELVSNSAKLAYPIKDGIPILLESEARVVSLD 56 >gi|222150127|ref|YP_002551084.1| hypothetical protein Avi_4243 [Agrobacterium vitis S4] gi|254803888|sp|B9JUE9|Y4243_AGRVS RecName: Full=UPF0434 protein Avi_4243 gi|221737109|gb|ACM38072.1| conserved hypothetical protein [Agrobacterium vitis S4] Length = 62 Score = 93.0 bits (231), Expect = 1e-17, Method: Composition-based stats. Identities = 38/62 (61%), Positives = 50/62 (80%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 M + + +DP++LE+LVCPLT G LTL E EL+S+KA LAYPIR G+PIMLVSEAR++ Sbjct: 1 MDQRMNGVDPKMLELLVCPLTNGRLTLNRENNELVSEKARLAYPIRDGIPIMLVSEARKI 60 Query: 61 DD 62 +D Sbjct: 61 ED 62 >gi|300716088|ref|YP_003740891.1| inner membrane protein YcaR [Erwinia billingiae Eb661] gi|299061924|emb|CAX59040.1| Putative inner membrane protein YcaR [Erwinia billingiae Eb661] Length = 60 Score = 93.0 bits (231), Expect = 1e-17, Method: Composition-based stats. Identities = 24/56 (42%), Positives = 37/56 (66%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ G L I + EL+ K LAYP+R G+P++L +EAR + + Sbjct: 1 MDHRLLEIVACPVCHGKLYYIKDQQELICKPDGLAYPVRDGIPVLLETEARSLTME 56 >gi|299133169|ref|ZP_07026364.1| protein of unknown function DUF343 [Afipia sp. 1NLS2] gi|298593306|gb|EFI53506.1| protein of unknown function DUF343 [Afipia sp. 1NLS2] Length = 67 Score = 93.0 bits (231), Expect = 1e-17, Method: Composition-based stats. Identities = 32/55 (58%), Positives = 41/55 (74%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 +D +LLEILVCP+TKG L + EL+S+ A LAYPIR G+PIML EAR++D Sbjct: 13 PVDSKLLEILVCPVTKGVLEYDAVKQELISRGAKLAYPIRDGIPIMLPEEARKID 67 >gi|256822591|ref|YP_003146554.1| hypothetical protein Kkor_1373 [Kangiella koreensis DSM 16069] gi|256796130|gb|ACV26786.1| protein of unknown function DUF343 [Kangiella koreensis DSM 16069] Length = 61 Score = 92.6 bits (230), Expect = 1e-17, Method: Composition-based stats. Identities = 24/56 (42%), Positives = 37/56 (66%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 ++ +LL++LVCP+ KG+L + EL+ + LAYPIR +P+ML EAR V + Sbjct: 1 MNHKLLDVLVCPVCKGDLVYKKDNNELICRFDKLAYPIRDDIPVMLEEEARTVSSE 56 >gi|261856313|ref|YP_003263596.1| hypothetical protein Hneap_1726 [Halothiobacillus neapolitanus c2] gi|261836782|gb|ACX96549.1| protein of unknown function DUF343 [Halothiobacillus neapolitanus c2] Length = 72 Score = 92.6 bits (230), Expect = 1e-17, Method: Composition-based stats. Identities = 30/56 (53%), Positives = 41/56 (73%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEILVCP+TKG L + EL+S A LAYPIR +PIML ++AR ++D+ Sbjct: 1 MDKRLLEILVCPVTKGPLIYQQDSNELISLSARLAYPIRDDIPIMLETDARPLEDE 56 >gi|307826202|ref|ZP_07656412.1| protein of unknown function DUF343 [Methylobacter tundripaludum SV96] gi|307732736|gb|EFO03603.1| protein of unknown function DUF343 [Methylobacter tundripaludum SV96] Length = 64 Score = 92.6 bits (230), Expect = 2e-17, Method: Composition-based stats. Identities = 24/57 (42%), Positives = 33/57 (57%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 ID +LL+IL CPL K L EL+ K +A+PIR +P+ML EAR++ Sbjct: 1 MIDKKLLDILACPLCKSPLIYDKSKQELICKADRIAFPIRDDIPVMLEDEARELTSD 57 >gi|261344284|ref|ZP_05971928.1| tetraacyldisaccharide 4'-kinase [Providencia rustigianii DSM 4541] gi|282567887|gb|EFB73422.1| tetraacyldisaccharide 4'-kinase [Providencia rustigianii DSM 4541] Length = 59 Score = 92.6 bits (230), Expect = 2e-17, Method: Composition-based stats. Identities = 27/58 (46%), Positives = 39/58 (67%), Gaps = 1/58 (1%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD-DQG 64 +D +LLEI+ CP G L+ E EL+ K LAYPIR G+P++L +EAR++ D+G Sbjct: 1 MDHRLLEIVACPACHGKLSYNKENLELICKFDHLAYPIRDGIPVLLENEARKIALDEG 58 >gi|310814828|ref|YP_003962792.1| hypothetical protein EIO_0317 [Ketogulonicigenium vulgare Y25] gi|308753563|gb|ADO41492.1| conserved domain protein [Ketogulonicigenium vulgare Y25] Length = 62 Score = 92.6 bits (230), Expect = 2e-17, Method: Composition-based stats. Identities = 30/54 (55%), Positives = 40/54 (74%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 DP++LE LVCP T+ LT E EL+S+ A LA+PIR G+P+MLV EAR++D Sbjct: 9 FDPRMLEALVCPQTQTTLTYDRERGELISRAAGLAFPIRDGIPVMLVDEARKLD 62 >gi|322832240|ref|YP_004212267.1| hypothetical protein Rahaq_1518 [Rahnella sp. Y9602] gi|321167441|gb|ADW73140.1| protein of unknown function DUF343 [Rahnella sp. Y9602] Length = 60 Score = 92.6 bits (230), Expect = 2e-17, Method: Composition-based stats. Identities = 25/56 (44%), Positives = 36/56 (64%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ G L E EL+ K SLAYP+R G+P++L +EAR + Sbjct: 1 MDHRLLEIVACPVCNGKLYFNKESQELVCKADSLAYPVREGIPVLLENEARPLSVD 56 >gi|84515142|ref|ZP_01002505.1| hypothetical protein SKA53_12998 [Loktanella vestfoldensis SKA53] gi|84511301|gb|EAQ07755.1| hypothetical protein SKA53_12998 [Loktanella vestfoldensis SKA53] Length = 59 Score = 92.6 bits (230), Expect = 2e-17, Method: Composition-based stats. Identities = 31/54 (57%), Positives = 41/54 (75%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 DP++LE LVCP+T L +E EL+S+ A LA+PIR+G+P+MLV EARQVD Sbjct: 6 FDPKMLEALVCPITHATLRYDAERQELVSENAHLAFPIRNGIPVMLVDEARQVD 59 >gi|157835281|pdb|2JR6|A Chain A, Solution Structure Of Upf0434 Protein Nma0874. Northeast Structural Genomics Target Mr32 Length = 68 Score = 92.6 bits (230), Expect = 2e-17, Method: Composition-based stats. Identities = 26/56 (46%), Positives = 40/56 (71%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 ++ + L+ILVCP+TKG L + EL S++A LAYPI+ G+P ML +EAR + ++ Sbjct: 1 MEKKFLDILVCPVTKGRLEYHQDKQELWSRQAKLAYPIKDGIPYMLENEARPLSEE 56 >gi|237800335|ref|ZP_04588796.1| tetraacyldisaccharide 4'-kinase [Pseudomonas syringae pv. oryzae str. 1_6] gi|331023192|gb|EGI03249.1| tetraacyldisaccharide 4'-kinase [Pseudomonas syringae pv. oryzae str. 1_6] Length = 61 Score = 92.6 bits (230), Expect = 2e-17, Method: Composition-based stats. Identities = 30/56 (53%), Positives = 41/56 (73%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LL+IL CP+ KG L L ++ TEL+SK A LAYP+R G+P+ML SEAR + Sbjct: 1 MDTKLLDILACPICKGPLKLSADKTELISKGAGLAYPVRDGIPVMLESEARTLTVD 56 >gi|148558023|ref|YP_001257819.1| hypothetical protein BOV_A0835 [Brucella ovis ATCC 25840] gi|166988572|sp|A5VVG4|Y3035_BRUO2 RecName: Full=UPF0434 protein BOV_A0835 gi|148369308|gb|ABQ62180.1| conserved hypothetical protein [Brucella ovis ATCC 25840] Length = 64 Score = 92.6 bits (230), Expect = 2e-17, Method: Composition-based stats. Identities = 35/56 (62%), Positives = 45/56 (80%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 NID +LLE+LVCPLTKG L +E +EL+S+KA LAYP+R G+PIML SEAR + + Sbjct: 9 NIDVRLLELLVCPLTKGPLEYDAERSELVSRKARLAYPVRGGIPIMLPSEARSLTE 64 >gi|153873211|ref|ZP_02001868.1| Protein of unknown function DUF343 [Beggiatoa sp. PS] gi|152070320|gb|EDN68129.1| Protein of unknown function DUF343 [Beggiatoa sp. PS] Length = 62 Score = 92.6 bits (230), Expect = 2e-17, Method: Composition-based stats. Identities = 27/56 (48%), Positives = 38/56 (67%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 ++ +LL+ILVCP+TKG L + E L K + LAYPIR G+P+ML EAR + + Sbjct: 1 MNEKLLDILVCPVTKGPLIYDKDNEEFLCKSSRLAYPIREGIPVMLPDEARHLTLE 56 >gi|72162908|ref|YP_290565.1| hypothetical protein Tfu_2509 [Thermobifida fusca YX] gi|71916640|gb|AAZ56542.1| conserved hypothetical protein [Thermobifida fusca YX] Length = 58 Score = 92.2 bits (229), Expect = 2e-17, Method: Composition-based stats. Identities = 29/54 (53%), Positives = 39/54 (72%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 ID LLEILVCP +K L L E EL+ ++ LAYPIR G+P++LV EAR+++ Sbjct: 5 IDEWLLEILVCPQSKAPLRLDEEAGELVCDESGLAYPIRDGIPVLLVDEARKIE 58 >gi|16124363|ref|NP_418927.1| hypothetical protein CC_0108 [Caulobacter crescentus CB15] gi|221233046|ref|YP_002515482.1| hypothetical protein CCNA_00107 [Caulobacter crescentus NA1000] gi|81536312|sp|Q9ABW2|Y108_CAUCR RecName: Full=UPF0434 protein CC_0108 gi|254799923|sp|B8GXJ8|Y107_CAUCN RecName: Full=UPF0434 protein CCNA_00107 gi|13421213|gb|AAK22095.1| conserved hypothetical protein [Caulobacter crescentus CB15] gi|220962218|gb|ACL93574.1| conserved cytosolic protein [Caulobacter crescentus NA1000] Length = 65 Score = 92.2 bits (229), Expect = 2e-17, Method: Composition-based stats. Identities = 31/60 (51%), Positives = 43/60 (71%) Query: 2 RETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 + ++DP+LLE+LVCP+T+G L EL+S+ A LAYPIR GVPIML EAR+++ Sbjct: 5 SAPLIDVDPRLLEVLVCPVTRGPLEYDRAKGELISRAAKLAYPIRDGVPIMLPEEARELE 64 >gi|298368892|ref|ZP_06980210.1| tetraacyldisaccharide 4'-kinase (Lipid A 4'-kinase) [Neisseria sp. oral taxon 014 str. F0314] gi|298282895|gb|EFI24382.1| tetraacyldisaccharide 4'-kinase (Lipid A 4'-kinase) [Neisseria sp. oral taxon 014 str. F0314] Length = 66 Score = 92.2 bits (229), Expect = 2e-17, Method: Composition-based stats. Identities = 27/63 (42%), Positives = 42/63 (66%), Gaps = 1/63 (1%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 M+ ++ + L+ILVCP+TKG L + EL S++A LAYPI+ G+P ML +EAR + Sbjct: 1 MKRKK-PMEKKFLDILVCPVTKGRLEYHQDKQELWSRQAKLAYPIKDGIPYMLENEARAL 59 Query: 61 DDQ 63 ++ Sbjct: 60 SEE 62 >gi|261253308|ref|ZP_05945881.1| hypothetical protein VIA_003333 [Vibrio orientalis CIP 102891] gi|260936699|gb|EEX92688.1| hypothetical protein VIA_003333 [Vibrio orientalis CIP 102891] Length = 59 Score = 92.2 bits (229), Expect = 2e-17, Method: Composition-based stats. Identities = 27/58 (46%), Positives = 40/58 (68%), Gaps = 1/58 (1%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD-DQG 64 +D +LLEI+ CP+ KG LT + EL+ K LAYPI+ G+P++L EAR++ D+G Sbjct: 1 MDHRLLEIVACPVCKGKLTFDKDKQELVCKFDRLAYPIKEGIPVLLEPEARKISMDEG 58 >gi|120599344|ref|YP_963918.1| hypothetical protein Sputw3181_2540 [Shewanella sp. W3-18-1] gi|146292659|ref|YP_001183083.1| hypothetical protein Sputcn32_1559 [Shewanella putrefaciens CN-32] gi|148841353|sp|A1RL19|Y2540_SHESW RecName: Full=UPF0434 protein Sputw3181_2540 gi|166979785|sp|A4Y5Q1|Y1559_SHEPC RecName: Full=UPF0434 protein Sputcn32_1559 gi|120559437|gb|ABM25364.1| protein of unknown function DUF343 [Shewanella sp. W3-18-1] gi|145564349|gb|ABP75284.1| protein of unknown function DUF343 [Shewanella putrefaciens CN-32] Length = 59 Score = 92.2 bits (229), Expect = 2e-17, Method: Composition-based stats. Identities = 20/57 (35%), Positives = 32/57 (56%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 D +LL+I+ CP+ KG L +L+ K LAYPI G+P++L + A + + Sbjct: 1 MAFDKKLLDIVACPVCKGKLEYDKTAQQLICKADKLAYPITEGIPVLLENRATPITE 57 >gi|269102443|ref|ZP_06155140.1| protein ycaR [Photobacterium damselae subsp. damselae CIP 102761] gi|268162341|gb|EEZ40837.1| protein ycaR [Photobacterium damselae subsp. damselae CIP 102761] Length = 59 Score = 92.2 bits (229), Expect = 2e-17, Method: Composition-based stats. Identities = 23/56 (41%), Positives = 34/56 (60%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ G L + EL+ K LAYPI G+P++L EAR + + Sbjct: 1 MDHRLLEIVACPVCNGKLNYDKDKNELVCKFDRLAYPISDGIPVLLEPEARTLSPE 56 >gi|148841346|sp|Q0VMP7|Y2103_ALCBS RecName: Full=UPF0434 protein ABO_2103 Length = 62 Score = 92.2 bits (229), Expect = 2e-17, Method: Composition-based stats. Identities = 26/57 (45%), Positives = 38/57 (66%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +DP LL+ILVCP++K L + EL K + LAYP+R G+P+ML +AR + D+ Sbjct: 1 MLDPNLLDILVCPVSKAPLIYDEKTAELKCKASGLAYPVRDGIPVMLEEQARAMSDE 57 >gi|163851676|ref|YP_001639719.1| hypothetical protein Mext_2253 [Methylobacterium extorquens PA1] gi|218530482|ref|YP_002421298.1| hypothetical protein Mchl_2528 [Methylobacterium chloromethanicum CM4] gi|240138843|ref|YP_002963318.1| hypothetical protein MexAM1_META1p2249 [Methylobacterium extorquens AM1] gi|254561445|ref|YP_003068540.1| hypothetical protein METDI3031 [Methylobacterium extorquens DM4] gi|163663281|gb|ABY30648.1| protein of unknown function DUF343 [Methylobacterium extorquens PA1] gi|218522785|gb|ACK83370.1| protein of unknown function DUF343 [Methylobacterium chloromethanicum CM4] gi|240008815|gb|ACS40041.1| conserved hypothetical protein [Methylobacterium extorquens AM1] gi|254268723|emb|CAX24684.1| conserved hypothetical protein [Methylobacterium extorquens DM4] Length = 68 Score = 92.2 bits (229), Expect = 2e-17, Method: Composition-based stats. Identities = 31/55 (56%), Positives = 40/55 (72%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 +DP+LLE+LVCPLTK L + EL+S+ A LAYPIR G+PIML EAR + + Sbjct: 14 VDPRLLELLVCPLTKEPLEYDAAREELISRSAKLAYPIRDGIPIMLPEEARSLTE 68 >gi|271500778|ref|YP_003333803.1| hypothetical protein Dd586_2247 [Dickeya dadantii Ech586] gi|270344333|gb|ACZ77098.1| protein of unknown function DUF343 [Dickeya dadantii Ech586] Length = 60 Score = 92.2 bits (229), Expect = 2e-17, Method: Composition-based stats. Identities = 24/56 (42%), Positives = 35/56 (62%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ G L E EL+ K LAYP+R G+P++L +EAR + Sbjct: 1 MDHRLLEIVACPVCNGRLVFDKEKQELICKVDGLAYPVRDGIPVLLENEARSLAPD 56 >gi|300690597|ref|YP_003751592.1| hypothetical protein RPSI07_0933 [Ralstonia solanacearum PSI07] gi|299077657|emb|CBJ50293.1| conserved protein of unknown function, UPF0434 [Ralstonia solanacearum PSI07] Length = 62 Score = 92.2 bits (229), Expect = 2e-17, Method: Composition-based stats. Identities = 30/52 (57%), Positives = 35/52 (67%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 +D +LLEILVCPL KG L EL+ LAYPIR G+P+MLV EARQ Sbjct: 1 MDNRLLEILVCPLCKGTLQHDRANNELICHVDKLAYPIRDGIPVMLVDEARQ 52 >gi|127512569|ref|YP_001093766.1| hypothetical protein Shew_1640 [Shewanella loihica PV-4] gi|148841335|sp|A3QDF9|Y1640_SHELP RecName: Full=UPF0434 protein Shew_1640 gi|126637864|gb|ABO23507.1| protein of unknown function DUF343 [Shewanella loihica PV-4] Length = 59 Score = 92.2 bits (229), Expect = 2e-17, Method: Composition-based stats. Identities = 20/58 (34%), Positives = 33/58 (56%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 D +LLEI+ CP+ KG L +L+ K LAY I G+P++L ++A +++ Sbjct: 1 MAFDKKLLEIVACPVCKGKLEYDKANQQLICKADRLAYAINEGIPVLLENKATPWNEE 58 >gi|259908914|ref|YP_002649270.1| Putative inner membrane protein YcaR [Erwinia pyrifoliae Ep1/96] gi|224964536|emb|CAX56046.1| Putative inner membrane protein YcaR [Erwinia pyrifoliae Ep1/96] gi|283478909|emb|CAY74825.1| Hypothetical protein EPYR_02445 [Erwinia pyrifoliae DSM 12163] gi|310767185|gb|ADP12135.1| Putative inner membrane protein YcaR [Erwinia sp. Ejp617] Length = 60 Score = 92.2 bits (229), Expect = 2e-17, Method: Composition-based stats. Identities = 24/56 (42%), Positives = 35/56 (62%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ G L E EL+ K LAYP+R G+P++L EAR + + Sbjct: 1 MDHRLLEIVACPVCHGKLDYNKEQQELVCKPDGLAYPVRDGIPVLLEVEARALTLE 56 >gi|254283839|ref|ZP_04958807.1| conserved hypothetical protein [gamma proteobacterium NOR51-B] gi|219680042|gb|EED36391.1| conserved hypothetical protein [gamma proteobacterium NOR51-B] Length = 61 Score = 92.2 bits (229), Expect = 2e-17, Method: Composition-based stats. Identities = 27/57 (47%), Positives = 36/57 (63%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEILVCP++K L E EL+ + + LAYPIR +P ML SEAR + Sbjct: 1 MLDRKLLEILVCPVSKAPLEYDEEKQELICRASGLAYPIRDDIPAMLESEARLLTAD 57 >gi|149914509|ref|ZP_01903039.1| hypothetical protein RAZWK3B_12989 [Roseobacter sp. AzwK-3b] gi|149811302|gb|EDM71137.1| hypothetical protein RAZWK3B_12989 [Roseobacter sp. AzwK-3b] Length = 64 Score = 92.2 bits (229), Expect = 2e-17, Method: Composition-based stats. Identities = 25/55 (45%), Positives = 39/55 (70%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 D ++L+ L+CP T+ L+ ++ EL+S A LAYPIR+G+P+MLV EAR + + Sbjct: 10 FDRRMLDALICPQTQATLSYDADRQELVSTAAGLAYPIRNGIPVMLVDEARALQE 64 >gi|237653872|ref|YP_002890186.1| hypothetical protein Tmz1t_3214 [Thauera sp. MZ1T] gi|237625119|gb|ACR01809.1| protein of unknown function DUF343 [Thauera sp. MZ1T] Length = 63 Score = 92.2 bits (229), Expect = 2e-17, Method: Composition-based stats. Identities = 29/56 (51%), Positives = 38/56 (67%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEILVCPL KG L + + EL+ K LAYPIR G+P+ML EAR + + Sbjct: 1 MDARLLEILVCPLCKGPLDYLKDKQELVCKADRLAYPIRDGIPVMLDEEARAMSAE 56 >gi|326795258|ref|YP_004313078.1| hypothetical protein Marme_1994 [Marinomonas mediterranea MMB-1] gi|326546022|gb|ADZ91242.1| UPF0434 protein ycaR [Marinomonas mediterranea MMB-1] Length = 64 Score = 92.2 bits (229), Expect = 2e-17, Method: Composition-based stats. Identities = 29/56 (51%), Positives = 43/56 (76%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 ++ LL+ILVCP+TK L+L +EGTEL+SK +AYPIR G+P++L +EAR + + Sbjct: 1 MNKALLDILVCPVTKAPLSLNAEGTELISKVGGMAYPIRDGIPVLLETEARTLTND 56 >gi|13473733|ref|NP_105301.1| hypothetical protein msl4429 [Mesorhizobium loti MAFF303099] gi|81778925|sp|Q98E33|Y4429_RHILO RecName: Full=UPF0434 protein msl4429 gi|14024484|dbj|BAB51087.1| msl4429 [Mesorhizobium loti MAFF303099] Length = 81 Score = 91.8 bits (228), Expect = 3e-17, Method: Composition-based stats. Identities = 32/57 (56%), Positives = 42/57 (73%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 ++DP+LLE+L CPLTKG L E EL+S+ A LAYP+R G+PIML SEAR + + Sbjct: 12 DVDPKLLELLACPLTKGPLAWDPERGELISRVAKLAYPVRDGIPIMLPSEARTLSAE 68 >gi|75674274|ref|YP_316695.1| hypothetical protein Nwi_0075 [Nitrobacter winogradskyi Nb-255] gi|123614375|sp|Q3SWJ8|Y075_NITWN RecName: Full=UPF0434 protein Nwi_0075 gi|74419144|gb|ABA03343.1| Protein of unknown function DUF343 [Nitrobacter winogradskyi Nb-255] Length = 66 Score = 91.8 bits (228), Expect = 3e-17, Method: Composition-based stats. Identities = 33/53 (62%), Positives = 41/53 (77%) Query: 9 DPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 DP+LLEILVCP+TKG L L EL+S+ A LAYPIR G+PIML EAR+++ Sbjct: 14 DPKLLEILVCPVTKGPLELDGARRELISRSAKLAYPIRDGIPIMLPEEARKIE 66 >gi|254476247|ref|ZP_05089633.1| conserved hypothetical protein [Ruegeria sp. R11] gi|214030490|gb|EEB71325.1| conserved hypothetical protein [Ruegeria sp. R11] Length = 69 Score = 91.8 bits (228), Expect = 3e-17, Method: Composition-based stats. Identities = 27/55 (49%), Positives = 40/55 (72%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 D ++LE LVCP T+ L ++ EL+S+ A+LA+PIR+G+P+MLV EAR +D Sbjct: 15 AFDRRMLEALVCPRTQTTLEYDADSQELISRAANLAFPIRNGIPVMLVDEARVLD 69 >gi|134095663|ref|YP_001100738.1| hypothetical protein HEAR2489 [Herminiimonas arsenicoxydans] gi|166987489|sp|A4G7Y0|Y2489_HERAR RecName: Full=UPF0434 protein HEAR2489 gi|133739566|emb|CAL62617.1| Conserved hypothetical protein [Herminiimonas arsenicoxydans] Length = 59 Score = 91.8 bits (228), Expect = 3e-17, Method: Composition-based stats. Identities = 27/53 (50%), Positives = 35/53 (66%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 +D +LL+ILVCPL KG L + EL+ K LAYPIR G+PIM +AR + Sbjct: 1 MDTRLLDILVCPLCKGPLEHDKKKQELICKVDKLAYPIRDGIPIMWADQARDL 53 >gi|300113150|ref|YP_003759725.1| hypothetical protein Nwat_0439 [Nitrosococcus watsonii C-113] gi|299539087|gb|ADJ27404.1| protein of unknown function DUF343 [Nitrosococcus watsonii C-113] Length = 59 Score = 91.8 bits (228), Expect = 3e-17, Method: Composition-based stats. Identities = 26/56 (46%), Positives = 36/56 (64%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEIL CP+ K +L EL+ K LAYPIR +P+ML +ARQ+D + Sbjct: 1 MDKKLLEILACPVCKSSLIYKKADQELICKACRLAYPIRDDIPVMLEEQARQLDSK 56 >gi|89052915|ref|YP_508366.1| hypothetical protein Jann_0424 [Jannaschia sp. CCS1] gi|122499655|sp|Q28VC1|Y424_JANSC RecName: Full=UPF0434 protein Jann_0424 gi|88862464|gb|ABD53341.1| protein of unknown function DUF343 [Jannaschia sp. CCS1] Length = 66 Score = 91.8 bits (228), Expect = 3e-17, Method: Composition-based stats. Identities = 31/55 (56%), Positives = 41/55 (74%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 ID ++LE LVCP+T+ L+ +E EL+SK A LAYPIR G+PIML EAR++D Sbjct: 12 PIDRRMLEALVCPMTQAPLSYDAEKQELISKAAHLAYPIRGGIPIMLEEEARKLD 66 >gi|57238865|ref|YP_180001.1| hypothetical protein Erum1340 [Ehrlichia ruminantium str. Welgevonden] gi|58578794|ref|YP_197006.1| hypothetical protein ERWE_CDS_01300 [Ehrlichia ruminantium str. Welgevonden] gi|58616853|ref|YP_196052.1| hypothetical protein ERGA_CDS_01260 [Ehrlichia ruminantium str. Gardel] gi|75356584|sp|Q5FFA6|Y126_EHRRG RecName: Full=UPF0434 protein ERGA_CDS_01260 gi|81353054|sp|Q5HC42|Y130_EHRRW RecName: Full=UPF0434 protein Erum1340/ERWE_CDS_01300 gi|57160944|emb|CAH57850.1| conserved hypothetical protein [Ehrlichia ruminantium str. Welgevonden] gi|58416465|emb|CAI27578.1| Conserved hypothetical protein; Similar to E coli protein ycaR [Ehrlichia ruminantium str. Gardel] gi|58417420|emb|CAI26624.1| Conserved hypothetical protein. Similar to E coli protein ycaR [Ehrlichia ruminantium str. Welgevonden] Length = 55 Score = 91.8 bits (228), Expect = 3e-17, Method: Composition-based stats. Identities = 33/55 (60%), Positives = 43/55 (78%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 ID +LLEILVCPLTK L + EL+S+KA LA+PIR+G+PIMLV EAR+++ Sbjct: 1 MIDKKLLEILVCPLTKEKLEYNKDTNELISQKAKLAFPIRNGIPIMLVDEARKLE 55 >gi|157961596|ref|YP_001501630.1| hypothetical protein Spea_1772 [Shewanella pealeana ATCC 700345] gi|189039009|sp|A8H3F8|Y1772_SHEPA RecName: Full=UPF0434 protein Spea_1772 gi|157846596|gb|ABV87095.1| protein of unknown function DUF343 [Shewanella pealeana ATCC 700345] Length = 57 Score = 91.8 bits (228), Expect = 3e-17, Method: Composition-based stats. Identities = 22/57 (38%), Positives = 34/57 (59%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 D +LLEI+ CP+ KG L E +L+ K LAYPI G+P++L ++A + + Sbjct: 1 MAFDKKLLEIVACPVCKGKLEFNKEAQQLICKADKLAYPINDGIPVLLENKAEPLAE 57 >gi|260768905|ref|ZP_05877839.1| hypothetical protein VFA_001962 [Vibrio furnissii CIP 102972] gi|260616935|gb|EEX42120.1| hypothetical protein VFA_001962 [Vibrio furnissii CIP 102972] gi|315180601|gb|ADT87515.1| hypothetical protein vfu_A02386 [Vibrio furnissii NCTC 11218] Length = 59 Score = 91.8 bits (228), Expect = 3e-17, Method: Composition-based stats. Identities = 27/58 (46%), Positives = 40/58 (68%), Gaps = 1/58 (1%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD-DQG 64 +D +LLEI+ CP+ KG LT + EL+ K LAYPI+ G+P++L +EAR + D+G Sbjct: 1 MDHRLLEIVACPVCKGKLTYDKDHQELICKLDRLAYPIKEGIPVLLENEARTMSMDEG 58 >gi|126173916|ref|YP_001050065.1| hypothetical protein Sbal_1685 [Shewanella baltica OS155] gi|160874824|ref|YP_001554140.1| hypothetical protein Sbal195_1707 [Shewanella baltica OS195] gi|217973834|ref|YP_002358585.1| hypothetical protein Sbal223_2672 [Shewanella baltica OS223] gi|304409788|ref|ZP_07391408.1| protein of unknown function DUF343 [Shewanella baltica OS183] gi|307304145|ref|ZP_07583898.1| protein of unknown function DUF343 [Shewanella baltica BA175] gi|166980191|sp|A3D383|Y1685_SHEB5 RecName: Full=UPF0434 protein Sbal_1685 gi|189038993|sp|A9KXE1|Y1707_SHEB9 RecName: Full=UPF0434 protein Sbal195_1707 gi|254801439|sp|B8EF44|Y2672_SHEB2 RecName: Full=UPF0434 protein Sbal223_2672 gi|125997121|gb|ABN61196.1| protein of unknown function DUF343 [Shewanella baltica OS155] gi|160860346|gb|ABX48880.1| protein of unknown function DUF343 [Shewanella baltica OS195] gi|217498969|gb|ACK47162.1| protein of unknown function DUF343 [Shewanella baltica OS223] gi|304352306|gb|EFM16704.1| protein of unknown function DUF343 [Shewanella baltica OS183] gi|306913043|gb|EFN43466.1| protein of unknown function DUF343 [Shewanella baltica BA175] gi|315267063|gb|ADT93916.1| protein of unknown function DUF343 [Shewanella baltica OS678] Length = 59 Score = 91.8 bits (228), Expect = 3e-17, Method: Composition-based stats. Identities = 20/57 (35%), Positives = 32/57 (56%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 D +LL+I+ CP+ KG L +L+ K LAYPI G+P++L + A + + Sbjct: 1 MAFDKKLLDIVACPVCKGKLEYDKTTQQLICKADKLAYPITEGIPVLLENRAVPLTE 57 >gi|329298222|ref|ZP_08255558.1| hypothetical protein Pstas_20184 [Plautia stali symbiont] Length = 60 Score = 91.5 bits (227), Expect = 3e-17, Method: Composition-based stats. Identities = 23/56 (41%), Positives = 35/56 (62%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ G L E EL+ K LA+P+R G+P++L EAR + + Sbjct: 1 MDHRLLEIVACPVCNGKLYYNKEQQELICKPDGLAFPVRDGIPVLLEVEARTLSVE 56 >gi|110834964|ref|YP_693823.1| hypothetical protein ABO_2103 [Alcanivorax borkumensis SK2] gi|110648075|emb|CAL17551.1| conserved hypothetical protein [Alcanivorax borkumensis SK2] Length = 64 Score = 91.5 bits (227), Expect = 3e-17, Method: Composition-based stats. Identities = 26/57 (45%), Positives = 38/57 (66%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +DP LL+ILVCP++K L + EL K + LAYP+R G+P+ML +AR + D+ Sbjct: 3 MLDPNLLDILVCPVSKAPLIYDEKTAELKCKASGLAYPVRDGIPVMLEEQARAMSDE 59 >gi|188581462|ref|YP_001924907.1| hypothetical protein Mpop_2210 [Methylobacterium populi BJ001] gi|179344960|gb|ACB80372.1| protein of unknown function DUF343 [Methylobacterium populi BJ001] Length = 68 Score = 91.5 bits (227), Expect = 3e-17, Method: Composition-based stats. Identities = 32/55 (58%), Positives = 40/55 (72%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 +DP+LLE+LVCPLTK L S EL+S+ A LAYPIR G+PIML EAR + + Sbjct: 14 VDPRLLELLVCPLTKEPLEYDSAREELISRSAKLAYPIRDGIPIMLPEEARSLTE 68 >gi|161869612|ref|YP_001598779.1| hypothetical protein NMCC_0628 [Neisseria meningitidis 053442] gi|189040569|sp|A9M2V6|Y628_NEIM0 RecName: Full=UPF0434 protein NMCC_0628 gi|161595165|gb|ABX72825.1| conserved hypothetical protein [Neisseria meningitidis 053442] Length = 60 Score = 91.5 bits (227), Expect = 3e-17, Method: Composition-based stats. Identities = 26/56 (46%), Positives = 40/56 (71%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 ++ + L+ILVCP+TKG L + EL S++A LAYPI+ G+P ML +EAR + ++ Sbjct: 1 MEKKFLDILVCPVTKGRLEYHQDKQELWSRQAKLAYPIKDGIPYMLENEARALGEE 56 >gi|121634470|ref|YP_974715.1| hypothetical protein NMC0623 [Neisseria meningitidis FAM18] gi|254804553|ref|YP_003082774.1| hypothetical protein NMO_0560 [Neisseria meningitidis alpha14] gi|304388076|ref|ZP_07370205.1| tetraacyldisaccharide 4'-kinase [Neisseria meningitidis ATCC 13091] gi|148841369|sp|A1KST5|Y623_NEIMF RecName: Full=UPF0434 protein NMC0623 gi|120866176|emb|CAM09916.1| hypothetical protein NMC0623 [Neisseria meningitidis FAM18] gi|254668095|emb|CBA04623.1| conserved hypothetical protein [Neisseria meningitidis alpha14] gi|304337933|gb|EFM04073.1| tetraacyldisaccharide 4'-kinase [Neisseria meningitidis ATCC 13091] gi|325127818|gb|EGC50726.1| hypothetical protein NMXN1568_1467 [Neisseria meningitidis N1568] gi|325143938|gb|EGC66248.1| hypothetical protein NMBM01240013_1546 [Neisseria meningitidis M01-240013] gi|325203761|gb|ADY99214.1| conserved hypothetical protein [Neisseria meningitidis M01-240355] gi|325206481|gb|ADZ01934.1| conserved hypothetical protein [Neisseria meningitidis M04-240196] gi|325207720|gb|ADZ03172.1| conserved hypothetical protein [Neisseria meningitidis NZ-05/33] Length = 60 Score = 91.5 bits (227), Expect = 3e-17, Method: Composition-based stats. Identities = 26/56 (46%), Positives = 40/56 (71%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 ++ + L+ILVCP+TKG L + EL S++A LAYPI+ G+P ML +EAR + ++ Sbjct: 1 MEKKFLDILVCPVTKGRLEYHQDKQELWSRQAKLAYPIKDGIPYMLENEARPLGEE 56 >gi|254419552|ref|ZP_05033276.1| conserved hypothetical protein [Brevundimonas sp. BAL3] gi|196185729|gb|EDX80705.1| conserved hypothetical protein [Brevundimonas sp. BAL3] Length = 64 Score = 91.5 bits (227), Expect = 3e-17, Method: Composition-based stats. Identities = 34/55 (61%), Positives = 43/55 (78%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 ++DP+LLE+LVCP+T+G LT + EL+S A LAYPIR GVPIML EARQ+D Sbjct: 10 SVDPRLLEVLVCPVTRGKLTYDRDAGELISVGAKLAYPIREGVPIMLAEEARQLD 64 >gi|17988748|ref|NP_541381.1| cytosolic protein [Brucella melitensis bv. 1 str. 16M] gi|23500618|ref|NP_700058.1| hypothetical protein BRA0891 [Brucella suis 1330] gi|62317280|ref|YP_223133.1| hypothetical protein BruAb2_0341 [Brucella abortus bv. 1 str. 9-941] gi|83269261|ref|YP_418552.1| hypothetical protein BAB2_0345 [Brucella melitensis biovar Abortus 2308] gi|161620944|ref|YP_001594830.1| hypothetical protein BCAN_B0909 [Brucella canis ATCC 23365] gi|163845009|ref|YP_001622664.1| hypothetical protein BSUIS_B0883 [Brucella suis ATCC 23445] gi|189022540|ref|YP_001932281.1| Protein of unknown function DUF343 [Brucella abortus S19] gi|225629350|ref|ZP_03787383.1| protein of unknown function DUF343 [Brucella ceti str. Cudo] gi|225686653|ref|YP_002734625.1| hypothetical protein BMEA_B0871 [Brucella melitensis ATCC 23457] gi|237816840|ref|ZP_04595832.1| Trm112p-like protein [Brucella abortus str. 2308 A] gi|254690788|ref|ZP_05154042.1| hypothetical protein Babob68_11646 [Brucella abortus bv. 6 str. 870] gi|254695907|ref|ZP_05157735.1| hypothetical protein Babob3T_15032 [Brucella abortus bv. 3 str. Tulya] gi|254698566|ref|ZP_05160394.1| hypothetical protein Babob28_12922 [Brucella abortus bv. 2 str. 86/8/59] gi|254700094|ref|ZP_05161922.1| hypothetical protein Bsuib55_04429 [Brucella suis bv. 5 str. 513] gi|254703214|ref|ZP_05165042.1| hypothetical protein Bsuib36_04644 [Brucella suis bv. 3 str. 686] gi|254705641|ref|ZP_05167469.1| hypothetical protein BpinM_01166 [Brucella pinnipedialis M163/99/10] gi|254710871|ref|ZP_05172682.1| hypothetical protein BpinB_11541 [Brucella pinnipedialis B2/94] gi|254712655|ref|ZP_05174466.1| hypothetical protein BcetM6_04629 [Brucella ceti M644/93/1] gi|254715726|ref|ZP_05177537.1| hypothetical protein BcetM_04644 [Brucella ceti M13/05/1] gi|254720242|ref|ZP_05182053.1| hypothetical protein Bru83_12058 [Brucella sp. 83/13] gi|254732013|ref|ZP_05190591.1| hypothetical protein Babob42_12722 [Brucella abortus bv. 4 str. 292] gi|256029254|ref|ZP_05442868.1| hypothetical protein BpinM2_01100 [Brucella pinnipedialis M292/94/1] gi|256043759|ref|ZP_05446681.1| hypothetical protein Bmelb1R_04659 [Brucella melitensis bv. 1 str. Rev.1] gi|256058940|ref|ZP_05449154.1| hypothetical protein Bneo5_01096 [Brucella neotomae 5K33] gi|256111196|ref|ZP_05452232.1| hypothetical protein Bmelb3E_01161 [Brucella melitensis bv. 3 str. Ether] gi|256157449|ref|ZP_05455367.1| hypothetical protein BcetM4_01136 [Brucella ceti M490/95/1] gi|256253573|ref|ZP_05459109.1| hypothetical protein BcetB_04604 [Brucella ceti B1/94] gi|256255971|ref|ZP_05461507.1| hypothetical protein Babob9C_01096 [Brucella abortus bv. 9 str. C68] gi|256262215|ref|ZP_05464747.1| conserved hypothetical protein [Brucella melitensis bv. 2 str. 63/9] gi|260167654|ref|ZP_05754465.1| hypothetical protein BruF5_04569 [Brucella sp. F5/99] gi|260544519|ref|ZP_05820340.1| conserved hypothetical protein [Brucella abortus NCTC 8038] gi|260564945|ref|ZP_05835430.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M] gi|260567854|ref|ZP_05838323.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40] gi|260756360|ref|ZP_05868708.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870] gi|260759788|ref|ZP_05872136.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292] gi|260763028|ref|ZP_05875360.1| conserved hypothetical protein [Brucella abortus bv. 2 str. 86/8/59] gi|260882185|ref|ZP_05893799.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68] gi|261216334|ref|ZP_05930615.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya] gi|261217482|ref|ZP_05931763.1| conserved hypothetical protein [Brucella ceti M13/05/1] gi|261220707|ref|ZP_05934988.1| conserved hypothetical protein [Brucella ceti B1/94] gi|261313054|ref|ZP_05952251.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10] gi|261318447|ref|ZP_05957644.1| conserved hypothetical protein [Brucella pinnipedialis B2/94] gi|261320356|ref|ZP_05959553.1| hypothetical protein BAIG_00930 [Brucella ceti M644/93/1] gi|261322881|ref|ZP_05962078.1| conserved hypothetical protein [Brucella neotomae 5K33] gi|261750584|ref|ZP_05994293.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513] gi|261753842|ref|ZP_05997551.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686] gi|261757085|ref|ZP_06000794.1| conserved hypothetical protein [Brucella sp. F5/99] gi|265985255|ref|ZP_06097990.1| conserved hypothetical protein [Brucella sp. 83/13] gi|265986246|ref|ZP_06098803.1| hypothetical protein BALG_02057 [Brucella pinnipedialis M292/94/1] gi|265990185|ref|ZP_06102742.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. Rev.1] gi|265992708|ref|ZP_06105265.1| conserved hypothetical protein [Brucella melitensis bv. 3 str. Ether] gi|265995942|ref|ZP_06108499.1| hypothetical protein BAPG_01735 [Brucella ceti M490/95/1] gi|294853841|ref|ZP_06794513.1| hypothetical protein BAZG_02822 [Brucella sp. NVSL 07-0026] gi|297249329|ref|ZP_06933030.1| hypothetical protein BAYG_02076 [Brucella abortus bv. 5 str. B3196] gi|306838616|ref|ZP_07471452.1| cytosolic protein [Brucella sp. NF 2653] gi|306841547|ref|ZP_07474245.1| cytosolic protein [Brucella sp. BO2] gi|306846103|ref|ZP_07478665.1| cytosolic protein [Brucella sp. BO1] gi|75495767|sp|Q579B2|Y2641_BRUAB RecName: Full=UPF0434 protein BruAb2_0341 gi|81751083|sp|Q8FVF2|Y3891_BRUSU RecName: Full=UPF0434 protein BRA0891 gi|81850620|sp|Q8YCX5|Y3403_BRUME RecName: Full=UPF0434 protein BMEII0403 gi|123546071|sp|Q2YL59|Y2845_BRUA2 RecName: Full=UPF0434 protein BAB2_0345 gi|189040136|sp|A9WVQ6|Y3383_BRUSI RecName: Full=UPF0434 protein BSUIS_B0883 gi|189040140|sp|A9MCH2|Y3409_BRUC2 RecName: Full=UPF0434 protein BCAN_B0909 gi|226703768|sp|B2SAE8|Y3260_BRUA1 RecName: Full=UPF0434 protein BAbS19_II03260 gi|254801625|sp|C0RM38|Y3171_BRUMB RecName: Full=UPF0434 protein BMEA_B0871 gi|17984562|gb|AAL53645.1| conserved cytosolic protein [Brucella melitensis bv. 1 str. 16M] gi|23464259|gb|AAN34063.1| conserved hypothetical protein [Brucella suis 1330] gi|62197473|gb|AAX75772.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941] gi|82939535|emb|CAJ12511.1| Protein of unknown function DUF343 [Brucella melitensis biovar Abortus 2308] gi|161337755|gb|ABX64059.1| protein of unknown function DUF343 [Brucella canis ATCC 23365] gi|163675732|gb|ABY39842.1| Hypothetical protein, conserved [Brucella suis ATCC 23445] gi|189021114|gb|ACD73835.1| Protein of unknown function DUF343 [Brucella abortus S19] gi|225615846|gb|EEH12895.1| protein of unknown function DUF343 [Brucella ceti str. Cudo] gi|225642758|gb|ACO02671.1| protein of unknown function DUF343 [Brucella melitensis ATCC 23457] gi|237787653|gb|EEP61869.1| Trm112p-like protein [Brucella abortus str. 2308 A] gi|260097790|gb|EEW81664.1| conserved hypothetical protein [Brucella abortus NCTC 8038] gi|260152588|gb|EEW87681.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M] gi|260154519|gb|EEW89600.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40] gi|260670106|gb|EEX57046.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292] gi|260673449|gb|EEX60270.1| conserved hypothetical protein [Brucella abortus bv. 2 str. 86/8/59] gi|260676468|gb|EEX63289.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870] gi|260871713|gb|EEX78782.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68] gi|260917941|gb|EEX84802.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya] gi|260919291|gb|EEX85944.1| conserved hypothetical protein [Brucella ceti B1/94] gi|260922571|gb|EEX89139.1| conserved hypothetical protein [Brucella ceti M13/05/1] gi|261293046|gb|EEX96542.1| hypothetical protein BAIG_00930 [Brucella ceti M644/93/1] gi|261297670|gb|EEY01167.1| conserved hypothetical protein [Brucella pinnipedialis B2/94] gi|261298861|gb|EEY02358.1| conserved hypothetical protein [Brucella neotomae 5K33] gi|261302080|gb|EEY05577.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10] gi|261737069|gb|EEY25065.1| conserved hypothetical protein [Brucella sp. F5/99] gi|261740337|gb|EEY28263.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513] gi|261743595|gb|EEY31521.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686] gi|262550239|gb|EEZ06400.1| hypothetical protein BAPG_01735 [Brucella ceti M490/95/1] gi|262763578|gb|EEZ09610.1| conserved hypothetical protein [Brucella melitensis bv. 3 str. Ether] gi|263000854|gb|EEZ13544.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. Rev.1] gi|263091911|gb|EEZ16233.1| conserved hypothetical protein [Brucella melitensis bv. 2 str. 63/9] gi|264658443|gb|EEZ28704.1| hypothetical protein BALG_02057 [Brucella pinnipedialis M292/94/1] gi|264663847|gb|EEZ34108.1| conserved hypothetical protein [Brucella sp. 83/13] gi|294819496|gb|EFG36496.1| hypothetical protein BAZG_02822 [Brucella sp. NVSL 07-0026] gi|297173198|gb|EFH32562.1| hypothetical protein BAYG_02076 [Brucella abortus bv. 5 str. B3196] gi|306273354|gb|EFM55215.1| cytosolic protein [Brucella sp. BO1] gi|306288384|gb|EFM59743.1| cytosolic protein [Brucella sp. BO2] gi|306406259|gb|EFM62502.1| cytosolic protein [Brucella sp. NF 2653] gi|326411042|gb|ADZ68106.1| cytosolic protein [Brucella melitensis M28] gi|326554333|gb|ADZ88972.1| cytosolic protein [Brucella melitensis M5-90] Length = 64 Score = 91.5 bits (227), Expect = 3e-17, Method: Composition-based stats. Identities = 35/56 (62%), Positives = 45/56 (80%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 NID +LLE+LVCPLTKG L +E +EL+S+KA LAYP+R G+PIML SEAR + + Sbjct: 9 NIDVRLLELLVCPLTKGPLEYDAERSELVSRKARLAYPVRGGIPIMLPSEARSLTE 64 >gi|300722541|ref|YP_003711831.1| protein ycaR [Xenorhabdus nematophila ATCC 19061] gi|297629048|emb|CBJ89633.1| Protein ycaR [Xenorhabdus nematophila ATCC 19061] Length = 59 Score = 91.5 bits (227), Expect = 4e-17, Method: Composition-based stats. Identities = 23/56 (41%), Positives = 37/56 (66%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ G L+ E EL+ K LA+P+R G+P++L +EAR + + Sbjct: 1 MDHRLLEIIACPVCHGKLSYDKENFELICKLDRLAFPVRDGIPVLLENEARALPTE 56 >gi|237749560|ref|ZP_04580040.1| conserved hypothetical protein [Oxalobacter formigenes OXCC13] gi|229380922|gb|EEO31013.1| conserved hypothetical protein [Oxalobacter formigenes OXCC13] Length = 60 Score = 91.5 bits (227), Expect = 4e-17, Method: Composition-based stats. Identities = 26/55 (47%), Positives = 36/55 (65%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 ++ LLEILVCPL KG L E EL+ + LAYP+R G+PIM +AR +++ Sbjct: 1 MNADLLEILVCPLCKGKLQYDREKQELICRGDRLAYPVRDGIPIMWEDQARVLEE 55 >gi|238792391|ref|ZP_04636025.1| hypothetical protein yinte0001_13190 [Yersinia intermedia ATCC 29909] gi|238728317|gb|EEQ19837.1| hypothetical protein yinte0001_13190 [Yersinia intermedia ATCC 29909] Length = 60 Score = 91.5 bits (227), Expect = 4e-17, Method: Composition-based stats. Identities = 24/54 (44%), Positives = 36/54 (66%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 +D +LLEI+ CP+ G L E EL+ K +LAYP+R G+P++L +EAR + Sbjct: 1 MDHRLLEIVACPVCNGKLYFNKENLELVCKADNLAYPVRDGIPVLLENEARPLS 54 >gi|187929877|ref|YP_001900364.1| hypothetical protein Rpic_2808 [Ralstonia pickettii 12J] gi|241663986|ref|YP_002982346.1| hypothetical protein Rpic12D_2402 [Ralstonia pickettii 12D] gi|309781422|ref|ZP_07676158.1| tetraacyldisaccharide 4'-kinase (Lipid A 4'-kinase) [Ralstonia sp. 5_7_47FAA] gi|226701521|sp|B2UB83|Y2808_RALPJ RecName: Full=UPF0434 protein Rpic_2808 gi|187726767|gb|ACD27932.1| protein of unknown function DUF343 [Ralstonia pickettii 12J] gi|240866013|gb|ACS63674.1| protein of unknown function DUF343 [Ralstonia pickettii 12D] gi|308919835|gb|EFP65496.1| tetraacyldisaccharide 4'-kinase (Lipid A 4'-kinase) [Ralstonia sp. 5_7_47FAA] Length = 62 Score = 91.5 bits (227), Expect = 4e-17, Method: Composition-based stats. Identities = 29/52 (55%), Positives = 34/52 (65%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 +D +LLEILVCPL KG L EL+ LAYPIR G+P+ML EARQ Sbjct: 1 MDNRLLEILVCPLCKGTLQHDRANNELICHVDKLAYPIRDGIPVMLADEARQ 52 >gi|319425963|gb|ADV54037.1| protein of unknown function DUF343 [Shewanella putrefaciens 200] Length = 59 Score = 91.5 bits (227), Expect = 4e-17, Method: Composition-based stats. Identities = 20/57 (35%), Positives = 32/57 (56%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 D +LL+I+ CP+ KG L +L+ K LAYPI G+P++L + A + + Sbjct: 1 MAFDKKLLDIVACPVCKGKLEYDKTAQQLICKADKLAYPITEGIPVLLENRAIPITE 57 >gi|251789907|ref|YP_003004628.1| hypothetical protein Dd1591_2307 [Dickeya zeae Ech1591] gi|247538528|gb|ACT07149.1| protein of unknown function DUF343 [Dickeya zeae Ech1591] Length = 60 Score = 91.5 bits (227), Expect = 4e-17, Method: Composition-based stats. Identities = 24/56 (42%), Positives = 34/56 (60%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ G L E EL+ K LAYP+R G+P++L EAR + Sbjct: 1 MDHRLLEIVACPVCNGRLIFDKEKQELICKVDGLAYPVRDGIPVLLEHEARTLAPD 56 >gi|163734302|ref|ZP_02141742.1| hypothetical protein RLO149_08659 [Roseobacter litoralis Och 149] gi|161392310|gb|EDQ16639.1| hypothetical protein RLO149_08659 [Roseobacter litoralis Och 149] Length = 61 Score = 91.5 bits (227), Expect = 4e-17, Method: Composition-based stats. Identities = 29/61 (47%), Positives = 40/61 (65%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 M ET D ++LE L+CP + L E EL+S+ A+LAYPIR+G+P+ML EAR + Sbjct: 1 MSETEVVFDRRMLEALICPRSHATLKYDQERQELISEAANLAYPIRNGIPVMLTDEARVL 60 Query: 61 D 61 D Sbjct: 61 D 61 >gi|256015653|ref|YP_003105662.1| hypothetical protein BMI_II885 [Brucella microti CCM 4915] gi|255998313|gb|ACU50000.1| hypothetical protein BMI_II885 [Brucella microti CCM 4915] Length = 64 Score = 91.5 bits (227), Expect = 4e-17, Method: Composition-based stats. Identities = 35/56 (62%), Positives = 45/56 (80%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 NID +LLE+LVCPLTKG L +E +EL+S+KA LAYP+R G+PIML SEAR + + Sbjct: 9 NIDVRLLELLVCPLTKGPLEYNAERSELVSRKARLAYPVRGGIPIMLPSEARSLTE 64 >gi|148982461|ref|ZP_01816766.1| hypothetical protein VSWAT3_04301 [Vibrionales bacterium SWAT-3] gi|145960467|gb|EDK25843.1| hypothetical protein VSWAT3_04301 [Vibrionales bacterium SWAT-3] Length = 59 Score = 91.5 bits (227), Expect = 4e-17, Method: Composition-based stats. Identities = 27/58 (46%), Positives = 39/58 (67%), Gaps = 1/58 (1%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD-DQG 64 +D +LLEI+ CP+ KG LT + EL+ K LAYPI+ G+P++L EAR + D+G Sbjct: 1 MDHRLLEIVACPVCKGKLTFDKDKQELVCKIDRLAYPIKEGIPVLLEPEARTLSMDEG 58 >gi|156934593|ref|YP_001438509.1| hypothetical protein ESA_02427 [Cronobacter sakazakii ATCC BAA-894] gi|166987474|sp|A7MET6|Y2427_ENTS8 RecName: Full=UPF0434 protein ESA_02427 gi|156532847|gb|ABU77673.1| hypothetical protein ESA_02427 [Cronobacter sakazakii ATCC BAA-894] Length = 60 Score = 91.1 bits (226), Expect = 4e-17, Method: Composition-based stats. Identities = 23/56 (41%), Positives = 36/56 (64%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ G L E EL+ K LA+P+R G+P++L +EAR + + Sbjct: 1 MDHRLLEIIACPVCNGKLYFNQEKQELICKADRLAFPLRDGIPVLLENEARALTAE 56 >gi|84394637|ref|ZP_00993331.1| hypothetical protein V12B01_00622 [Vibrio splendidus 12B01] gi|86146935|ref|ZP_01065253.1| hypothetical protein MED222_19574 [Vibrio sp. MED222] gi|218710040|ref|YP_002417661.1| hypothetical protein VS_2060 [Vibrio splendidus LGP32] gi|254801534|sp|B7VH36|Y2060_VIBSL RecName: Full=UPF0434 protein VS_2060 gi|84374740|gb|EAP91693.1| hypothetical protein V12B01_00622 [Vibrio splendidus 12B01] gi|85835185|gb|EAQ53325.1| hypothetical protein MED222_19574 [Vibrio sp. MED222] gi|218323059|emb|CAV19236.1| conserved hypothetical protein [Vibrio splendidus LGP32] Length = 59 Score = 91.1 bits (226), Expect = 4e-17, Method: Composition-based stats. Identities = 28/58 (48%), Positives = 39/58 (67%), Gaps = 1/58 (1%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD-DQG 64 +D +LLEI+ CP+ KG LT + EL+ K LAYPI+ G+P++L EAR V D+G Sbjct: 1 MDHRLLEIVACPVCKGKLTFDKDKQELVCKIDRLAYPIKEGIPVLLEPEARTVSMDEG 58 >gi|161503886|ref|YP_001570998.1| hypothetical protein SARI_01975 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980] gi|168237090|ref|ZP_02662148.1| tetraacyldisaccharide 4'-kinase (Lipid A 4'-kinase) [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] gi|194733945|ref|YP_002114039.1| hypothetical protein SeSA_A1101 [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] gi|189041092|sp|A9MHW6|YCAR_SALAR RecName: Full=UPF0434 protein ycaR gi|226710595|sp|B4TRU9|YCAR_SALSV RecName: Full=UPF0434 protein ycaR gi|160865233|gb|ABX21856.1| hypothetical protein SARI_01975 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] gi|194709447|gb|ACF88668.1| tetraacyldisaccharide 4'-kinase [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] gi|197289816|gb|EDY29177.1| tetraacyldisaccharide 4'-kinase (Lipid A 4'-kinase) [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] Length = 60 Score = 91.1 bits (226), Expect = 4e-17, Method: Composition-based stats. Identities = 23/56 (41%), Positives = 36/56 (64%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ G L E EL+ K +LA+P+R G+P++L +EAR + Sbjct: 1 MDHRLLEIIACPVCNGKLWYNQEKQELICKLDNLAFPLRDGIPVLLENEARSLTSD 56 >gi|114706375|ref|ZP_01439277.1| hypothetical protein FP2506_01285 [Fulvimarina pelagi HTCC2506] gi|114538236|gb|EAU41358.1| hypothetical protein FP2506_01285 [Fulvimarina pelagi HTCC2506] Length = 64 Score = 91.1 bits (226), Expect = 4e-17, Method: Composition-based stats. Identities = 35/54 (64%), Positives = 42/54 (77%) Query: 9 DPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 DP+LLE+LVCPLTK L E EL+S KA LAYPIR G+PIML SEAR+++D Sbjct: 11 DPKLLELLVCPLTKATLRYDREAQELISVKAKLAYPIRDGIPIMLPSEARELED 64 >gi|322616417|gb|EFY13326.1| hypothetical protein SEEM315_12448 [Salmonella enterica subsp. enterica serovar Montevideo str. 315996572] gi|322619667|gb|EFY16542.1| hypothetical protein SEEM971_17442 [Salmonella enterica subsp. enterica serovar Montevideo str. 495297-1] gi|322622637|gb|EFY19482.1| hypothetical protein SEEM973_13515 [Salmonella enterica subsp. enterica serovar Montevideo str. 495297-3] gi|322629786|gb|EFY26561.1| hypothetical protein SEEM974_05216 [Salmonella enterica subsp. enterica serovar Montevideo str. 495297-4] gi|322632492|gb|EFY29238.1| hypothetical protein SEEM201_14815 [Salmonella enterica subsp. enterica serovar Montevideo str. 515920-1] gi|322637013|gb|EFY33716.1| hypothetical protein SEEM202_02120 [Salmonella enterica subsp. enterica serovar Montevideo str. 515920-2] gi|322641447|gb|EFY38085.1| hypothetical protein SEEM954_01463 [Salmonella enterica subsp. enterica serovar Montevideo str. 531954] gi|322646087|gb|EFY42603.1| hypothetical protein SEEM054_01070 [Salmonella enterica subsp. enterica serovar Montevideo str. NC_MB110209-0054] gi|322649611|gb|EFY46042.1| hypothetical protein SEEM675_15984 [Salmonella enterica subsp. enterica serovar Montevideo str. OH_2009072675] gi|322654087|gb|EFY50410.1| hypothetical protein SEEM965_12767 [Salmonella enterica subsp. enterica serovar Montevideo str. CASC_09SCPH15965] gi|322658619|gb|EFY54881.1| hypothetical protein SEEM19N_16632 [Salmonella enterica subsp. enterica serovar Montevideo str. 19N] gi|322663476|gb|EFY59678.1| hypothetical protein SEEM801_11922 [Salmonella enterica subsp. enterica serovar Montevideo str. 81038-01] gi|322670212|gb|EFY66352.1| hypothetical protein SEEM507_18699 [Salmonella enterica subsp. enterica serovar Montevideo str. MD_MDA09249507] gi|322671448|gb|EFY67570.1| hypothetical protein SEEM877_09708 [Salmonella enterica subsp. enterica serovar Montevideo str. 414877] gi|322676804|gb|EFY72871.1| hypothetical protein SEEM867_07856 [Salmonella enterica subsp. enterica serovar Montevideo str. 366867] gi|322682729|gb|EFY78748.1| hypothetical protein SEEM180_06907 [Salmonella enterica subsp. enterica serovar Montevideo str. 413180] gi|322686408|gb|EFY82390.1| hypothetical protein SEEM600_05885 [Salmonella enterica subsp. enterica serovar Montevideo str. 446600] gi|323195931|gb|EFZ81098.1| hypothetical protein SEEM581_13171 [Salmonella enterica subsp. enterica serovar Montevideo str. 609458-1] gi|323199781|gb|EFZ84870.1| hypothetical protein SEEM501_09323 [Salmonella enterica subsp. enterica serovar Montevideo str. 556150-1] gi|323202774|gb|EFZ87810.1| hypothetical protein SEEM460_08259 [Salmonella enterica subsp. enterica serovar Montevideo str. 609460] gi|323209045|gb|EFZ93982.1| hypothetical protein SEEM020_20025 [Salmonella enterica subsp. enterica serovar Montevideo str. 507440-20] gi|323211521|gb|EFZ96360.1| hypothetical protein SEEM6152_19313 [Salmonella enterica subsp. enterica serovar Montevideo str. 556152] gi|323217994|gb|EGA02709.1| hypothetical protein SEEM0077_06164 [Salmonella enterica subsp. enterica serovar Montevideo str. MB101509-0077] gi|323222906|gb|EGA07256.1| hypothetical protein SEEM0047_13280 [Salmonella enterica subsp. enterica serovar Montevideo str. MB102109-0047] gi|323226600|gb|EGA10805.1| hypothetical protein SEEM0055_10140 [Salmonella enterica subsp. enterica serovar Montevideo str. MB110209-0055] gi|323229796|gb|EGA13919.1| hypothetical protein SEEM0052_13197 [Salmonella enterica subsp. enterica serovar Montevideo str. MB111609-0052] gi|323233021|gb|EGA17117.1| hypothetical protein SEEM3312_03149 [Salmonella enterica subsp. enterica serovar Montevideo str. 2009083312] gi|323240756|gb|EGA24798.1| hypothetical protein SEEM5258_12759 [Salmonella enterica subsp. enterica serovar Montevideo str. 2009085258] gi|323243072|gb|EGA27093.1| hypothetical protein SEEM1156_20609 [Salmonella enterica subsp. enterica serovar Montevideo str. 315731156] gi|323249765|gb|EGA33667.1| hypothetical protein SEEM9199_12222 [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2009159199] gi|323252762|gb|EGA36600.1| hypothetical protein SEEM8282_16793 [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008282] gi|323257195|gb|EGA40896.1| hypothetical protein SEEM8283_02194 [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008283] gi|323259999|gb|EGA43627.1| hypothetical protein SEEM8284_18108 [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008284] gi|323268000|gb|EGA51479.1| hypothetical protein SEEM8285_13211 [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008285] gi|323269848|gb|EGA53297.1| hypothetical protein SEEM8287_20634 [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008287] Length = 60 Score = 91.1 bits (226), Expect = 4e-17, Method: Composition-based stats. Identities = 23/56 (41%), Positives = 36/56 (64%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ G L E EL+ K +LA+P+R G+P++L +EAR + Sbjct: 1 MDHRLLEIIACPVCNGKLWYNQEQQELICKLDNLAFPLRDGIPVLLENEARSLTSD 56 >gi|118592116|ref|ZP_01549510.1| hypothetical protein SIAM614_25607 [Stappia aggregata IAM 12614] gi|118435412|gb|EAV42059.1| hypothetical protein SIAM614_25607 [Stappia aggregata IAM 12614] Length = 63 Score = 91.1 bits (226), Expect = 5e-17, Method: Composition-based stats. Identities = 30/56 (53%), Positives = 43/56 (76%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 +D +LLE+LVCP+TK L ++ EL+S+ A LAYPIR+G+PIML EAR+++D Sbjct: 8 PVDRKLLELLVCPVTKTTLEYDADARELISRTAKLAYPIRNGIPIMLPDEARKLED 63 >gi|188534264|ref|YP_001908061.1| Putative inner membrane protein YcaR [Erwinia tasmaniensis Et1/99] gi|226701184|sp|B2VC72|Y2137_ERWT9 RecName: Full=UPF0434 protein ETA_21370 gi|188029306|emb|CAO97183.1| Putative inner membrane protein YcaR [Erwinia tasmaniensis Et1/99] Length = 60 Score = 91.1 bits (226), Expect = 5e-17, Method: Composition-based stats. Identities = 23/56 (41%), Positives = 35/56 (62%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ G L E EL+ K LAYP++ G+P++L EAR + + Sbjct: 1 MDHRLLEIVACPVCHGKLYYNKEQQELICKPDGLAYPVQDGIPVLLEVEARALTLE 56 >gi|295687559|ref|YP_003591252.1| hypothetical protein Cseg_0107 [Caulobacter segnis ATCC 21756] gi|295429462|gb|ADG08634.1| protein of unknown function DUF343 [Caulobacter segnis ATCC 21756] Length = 65 Score = 91.1 bits (226), Expect = 5e-17, Method: Composition-based stats. Identities = 30/55 (54%), Positives = 41/55 (74%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 ++DP+LLE+LVCP+T+ L EL+S+ A LAYPIR GVPIML EAR+++ Sbjct: 10 DVDPRLLEVLVCPVTRAPLEYDRAAGELISRSAKLAYPIRDGVPIMLPEEARELE 64 >gi|77166135|ref|YP_344660.1| hypothetical protein Noc_2677 [Nitrosococcus oceani ATCC 19707] gi|254435542|ref|ZP_05049049.1| conserved hypothetical protein [Nitrosococcus oceani AFC27] gi|123593464|sp|Q3J7R6|Y2677_NITOC RecName: Full=UPF0434 protein Noc_2677 gi|76884449|gb|ABA59130.1| Protein of unknown function DUF343 [Nitrosococcus oceani ATCC 19707] gi|207088653|gb|EDZ65925.1| conserved hypothetical protein [Nitrosococcus oceani AFC27] Length = 59 Score = 91.1 bits (226), Expect = 5e-17, Method: Composition-based stats. Identities = 26/56 (46%), Positives = 35/56 (62%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEIL CP+ K +L EL+ K LAYPIR +P+ML +ARQ D + Sbjct: 1 MDKKLLEILACPVCKSSLIYKKADQELICKACRLAYPIRDDIPVMLEEQARQFDPE 56 >gi|146306646|ref|YP_001187111.1| hypothetical protein Pmen_1615 [Pseudomonas mendocina ymp] gi|166979813|sp|A4XSR3|Y1615_PSEMY RecName: Full=UPF0434 protein Pmen_1615 gi|145574847|gb|ABP84379.1| protein of unknown function DUF343 [Pseudomonas mendocina ymp] Length = 61 Score = 91.1 bits (226), Expect = 5e-17, Method: Composition-based stats. Identities = 30/56 (53%), Positives = 40/56 (71%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LL+IL CP+ KG L L + TEL+SK A +AYPIR G+P+ML SEAR + Sbjct: 1 MDLKLLDILACPICKGPLQLSEDKTELISKGAGVAYPIRDGIPVMLESEARTLTTD 56 >gi|17547250|ref|NP_520652.1| hypothetical protein RSc2531 [Ralstonia solanacearum GMI1000] gi|83749965|ref|ZP_00946918.1| conserved cytosolic protein [Ralstonia solanacearum UW551] gi|207721744|ref|YP_002252183.1| protein of unknown function duf343 [Ralstonia solanacearum MolK2] gi|207742507|ref|YP_002258899.1| protein of unknown function duf343 [Ralstonia solanacearum IPO1609] gi|300703202|ref|YP_003744804.1| hypothetical protein RCFBP_10864 [Ralstonia solanacearum CFBP2957] gi|81503622|sp|Q8XWE3|Y2531_RALSO RecName: Full=UPF0434 protein RSc2531 gi|17429552|emb|CAD16238.1| hypothetical protein of unknown function duf343 [Ralstonia solanacearum GMI1000] gi|83723368|gb|EAP70593.1| conserved cytosolic protein [Ralstonia solanacearum UW551] gi|206586908|emb|CAQ17493.1| protein of unknown function duf343 [Ralstonia solanacearum MolK2] gi|206593898|emb|CAQ60825.1| protein of unknown function duf343 [Ralstonia solanacearum IPO1609] gi|299065870|emb|CBJ37049.1| conserved protein of unknown function, UPF0434 [Ralstonia solanacearum CMR15] gi|299070865|emb|CBJ42167.1| conserved protein of unknown function, UPF0434 [Ralstonia solanacearum CFBP2957] Length = 62 Score = 91.1 bits (226), Expect = 5e-17, Method: Composition-based stats. Identities = 29/52 (55%), Positives = 34/52 (65%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 +D +LLEILVCPL KG L EL+ LAYPIR G+P+ML EARQ Sbjct: 1 MDNRLLEILVCPLCKGTLQHDRAHNELICHVDKLAYPIRDGIPVMLADEARQ 52 >gi|212709798|ref|ZP_03317926.1| hypothetical protein PROVALCAL_00846 [Providencia alcalifaciens DSM 30120] gi|212687609|gb|EEB47137.1| hypothetical protein PROVALCAL_00846 [Providencia alcalifaciens DSM 30120] Length = 59 Score = 91.1 bits (226), Expect = 5e-17, Method: Composition-based stats. Identities = 26/58 (44%), Positives = 39/58 (67%), Gaps = 1/58 (1%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD-DQG 64 +D +LLEI+ CP G L+ E EL+ K LA+P+R G+P++L +EAR+V D+G Sbjct: 1 MDHRLLEIVACPSCHGKLSYNKENLELICKFDHLAFPVRDGIPVLLENEARKVALDEG 58 >gi|24374335|ref|NP_718378.1| hypothetical protein SO_2800 [Shewanella oneidensis MR-1] gi|81460983|sp|Q8EDF2|Y2800_SHEON RecName: Full=UPF0434 protein SO_2800 gi|24348887|gb|AAN55822.1|AE015719_4 conserved hypothetical protein [Shewanella oneidensis MR-1] Length = 59 Score = 91.1 bits (226), Expect = 5e-17, Method: Composition-based stats. Identities = 20/57 (35%), Positives = 32/57 (56%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 D +LL+I+ CP+ KG L +L+ K LAYPI G+P++L + A + + Sbjct: 1 MAFDKKLLDIVACPVCKGKLEYDKVAQQLICKADKLAYPITDGIPVLLENRALPLTE 57 >gi|163868820|ref|YP_001610046.1| hypothetical protein Btr_1765 [Bartonella tribocorum CIP 105476] gi|161018493|emb|CAK02051.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476] Length = 68 Score = 91.1 bits (226), Expect = 5e-17, Method: Composition-based stats. Identities = 33/60 (55%), Positives = 42/60 (70%) Query: 4 TIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 DP++LE+LVCP+TKG L+ + EL+S KA LAYPIR GVPIML SEAR + + Sbjct: 2 KKMTTDPKMLELLVCPMTKGTLSFNRKTQELISLKAKLAYPIRDGVPIMLASEARPLQND 61 >gi|114765832|ref|ZP_01444925.1| hypothetical protein 1100011001323_R2601_11049 [Pelagibaca bermudensis HTCC2601] gi|114541831|gb|EAU44868.1| hypothetical protein R2601_11049 [Roseovarius sp. HTCC2601] Length = 65 Score = 91.1 bits (226), Expect = 5e-17, Method: Composition-based stats. Identities = 31/56 (55%), Positives = 39/56 (69%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 D ++LE LVCP T+ L E EL+SK A LAYPIR G+P+MLV EAR++DD Sbjct: 10 AFDRRMLEALVCPATQHRLDYDLERQELISKAAGLAYPIRDGIPVMLVDEARRIDD 65 >gi|89092888|ref|ZP_01165840.1| hypothetical protein MED92_10519 [Oceanospirillum sp. MED92] gi|89082913|gb|EAR62133.1| hypothetical protein MED92_10519 [Oceanospirillum sp. MED92] Length = 61 Score = 91.1 bits (226), Expect = 5e-17, Method: Composition-based stats. Identities = 27/56 (48%), Positives = 39/56 (69%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LL+ILVCP+TK L E EL +K + LAYPIR +P++L SEAR++ + Sbjct: 1 MDKKLLDILVCPVTKTPLEFNEETNELFAKASGLAYPIRDDIPVLLESEARELTLE 56 >gi|240851022|ref|YP_002972422.1| hypothetical protein Bgr_15680 [Bartonella grahamii as4aup] gi|240268145|gb|ACS51733.1| hypothetical protein Bgr_15680 [Bartonella grahamii as4aup] Length = 65 Score = 91.1 bits (226), Expect = 5e-17, Method: Composition-based stats. Identities = 31/58 (53%), Positives = 41/58 (70%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 DP++LE+LVCP+T+ L+ + EL+S KA LAYPIR GVPIML SEAR + + Sbjct: 1 MTTDPKMLELLVCPITRSTLSYNRKTQELISLKAKLAYPIRDGVPIMLASEARPLQND 58 >gi|330502583|ref|YP_004379452.1| hypothetical protein MDS_1669 [Pseudomonas mendocina NK-01] gi|328916869|gb|AEB57700.1| hypothetical protein MDS_1669 [Pseudomonas mendocina NK-01] Length = 61 Score = 91.1 bits (226), Expect = 5e-17, Method: Composition-based stats. Identities = 30/56 (53%), Positives = 41/56 (73%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LL+IL CP+ KG L L + TEL+SK A +AYPIR G+P+ML SEAR ++ Sbjct: 1 MDLKLLDILACPICKGPLQLSEDKTELISKGAGVAYPIRDGIPVMLESEARTLNTD 56 >gi|238753511|ref|ZP_04614874.1| hypothetical protein yruck0001_20410 [Yersinia ruckeri ATCC 29473] gi|238708464|gb|EEQ00819.1| hypothetical protein yruck0001_20410 [Yersinia ruckeri ATCC 29473] Length = 60 Score = 91.1 bits (226), Expect = 5e-17, Method: Composition-based stats. Identities = 24/56 (42%), Positives = 36/56 (64%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ G L E EL+ K +LAYP+R G+P++L +EAR + Sbjct: 1 MDHRLLEIVACPVCNGKLYFNKENLELVCKADNLAYPVRDGIPVLLENEARALSVD 56 >gi|119774476|ref|YP_927216.1| hypothetical protein Sama_1339 [Shewanella amazonensis SB2B] gi|148841320|sp|A1S590|Y1339_SHEAM RecName: Full=UPF0434 protein Sama_1339 gi|119766976|gb|ABL99546.1| conserved hypothetical protein [Shewanella amazonensis SB2B] Length = 61 Score = 91.1 bits (226), Expect = 5e-17, Method: Composition-based stats. Identities = 22/58 (37%), Positives = 32/58 (55%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 D +LLEI+ CP+ KG L +L+ K LAYPI G+P++L + A +Q Sbjct: 1 MAFDKKLLEIVACPVCKGKLEYDKAAEQLICKFDRLAYPITEGIPVLLENRATPWQEQ 58 >gi|296445768|ref|ZP_06887721.1| protein of unknown function DUF343 [Methylosinus trichosporium OB3b] gi|296256748|gb|EFH03822.1| protein of unknown function DUF343 [Methylosinus trichosporium OB3b] Length = 76 Score = 91.1 bits (226), Expect = 5e-17, Method: Composition-based stats. Identities = 33/54 (61%), Positives = 41/54 (75%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 +DP+LLEILVCPLTK L + EL+S+ A LAYPIR G+PIML EAR++D Sbjct: 23 VDPRLLEILVCPLTKSTLEYDAARQELISRPARLAYPIRDGIPIMLPEEARRID 76 >gi|270261200|ref|ZP_06189473.1| protein YcaR [Serratia odorifera 4Rx13] gi|270044684|gb|EFA17775.1| protein YcaR [Serratia odorifera 4Rx13] Length = 60 Score = 91.1 bits (226), Expect = 5e-17, Method: Composition-based stats. Identities = 24/56 (42%), Positives = 35/56 (62%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ G L E EL+ K LAYP+R G+P++L +EAR + Sbjct: 1 MDHRLLEIVACPVCNGKLYFNKENQELVCKVDGLAYPLRDGIPVLLENEARSLSLD 56 >gi|59713609|ref|YP_206384.1| cytosolic protein [Vibrio fischeri ES114] gi|197337359|ref|YP_002158024.1| tetraacyldisaccharide 4'-kinase (Lipid A 4'-kinase) [Vibrio fischeri MJ11] gi|75352899|sp|Q5E0F0|Y3426_VIBF1 RecName: Full=UPF0434 protein VF_A0426 gi|226703771|sp|B5ETK6|Y3275_VIBFM RecName: Full=UPF0434 protein VFMJ11_A0475 gi|59481857|gb|AAW87496.1| conserved cytosolic protein [Vibrio fischeri ES114] gi|197314611|gb|ACH64060.1| tetraacyldisaccharide 4'-kinase (Lipid A 4'-kinase) [Vibrio fischeri MJ11] Length = 65 Score = 91.1 bits (226), Expect = 5e-17, Method: Composition-based stats. Identities = 25/56 (44%), Positives = 37/56 (66%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ KG L + EL+ K LAYPI+ G+P+ML EAR++ + Sbjct: 1 MDYRLLEIVACPVCKGKLNYDKDKQELICKIDRLAYPIKDGIPVMLEPEARRMTME 56 >gi|239833598|ref|ZP_04681926.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301] gi|239821661|gb|EEQ93230.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301] Length = 64 Score = 91.1 bits (226), Expect = 5e-17, Method: Composition-based stats. Identities = 34/56 (60%), Positives = 43/56 (76%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 NID +LLE+LVCP+TKG L +E EL+S KA LAYP+R G+PIML SEAR + + Sbjct: 9 NIDVRLLELLVCPITKGALEYDAEHGELISHKAKLAYPVRGGIPIMLPSEARSLTE 64 >gi|218548433|ref|YP_002382224.1| hypothetical protein EFER_1061 [Escherichia fergusonii ATCC 35469] gi|226710587|sp|B7LN79|YCAR_ESCF3 RecName: Full=UPF0434 protein ycaR gi|218355974|emb|CAQ88590.1| conserved hypothetical protein [Escherichia fergusonii ATCC 35469] gi|324113752|gb|EGC07727.1| Trm112p protein [Escherichia fergusonii B253] Length = 60 Score = 91.1 bits (226), Expect = 5e-17, Method: Composition-based stats. Identities = 23/56 (41%), Positives = 36/56 (64%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ G L E EL+ K LA+P+R G+P++L +EAR + + Sbjct: 1 MDHRLLEIIACPVCNGKLWYNQEKQELICKLDKLAFPLRDGIPVLLETEARVLTSE 56 >gi|304397077|ref|ZP_07378956.1| protein of unknown function DUF343 [Pantoea sp. aB] gi|308186263|ref|YP_003930394.1| Tetraacyldisaccharide 4'-kinase [Pantoea vagans C9-1] gi|304355226|gb|EFM19594.1| protein of unknown function DUF343 [Pantoea sp. aB] gi|308056773|gb|ADO08945.1| Tetraacyldisaccharide 4'-kinase [Pantoea vagans C9-1] Length = 60 Score = 90.7 bits (225), Expect = 5e-17, Method: Composition-based stats. Identities = 22/56 (39%), Positives = 36/56 (64%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ G L + EL+ K LA+P+R G+P++L +EAR + + Sbjct: 1 MDHRLLEIVACPVCNGKLYFNNAQQELICKPDGLAFPVRDGIPVLLETEARTLSVE 56 >gi|204930025|ref|ZP_03221046.1| tetraacyldisaccharide 4'-kinase [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] gi|204321019|gb|EDZ06220.1| tetraacyldisaccharide 4'-kinase [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] Length = 60 Score = 90.7 bits (225), Expect = 6e-17, Method: Composition-based stats. Identities = 23/56 (41%), Positives = 36/56 (64%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ G L E EL+ K +LA+P+R G+P++L +EAR + Sbjct: 1 MDHRLLEIIACPVCNGKLWYNQEKQELICKLDNLAFPLRDGIPVLLENEARALTSD 56 >gi|16759856|ref|NP_455473.1| hypothetical protein STY0989 [Salmonella enterica subsp. enterica serovar Typhi str. CT18] gi|16764347|ref|NP_459962.1| hypothetical protein STM0987 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2] gi|29142371|ref|NP_805713.1| hypothetical protein t1947 [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] gi|56413964|ref|YP_151039.1| hypothetical protein SPA1811 [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] gi|161614775|ref|YP_001588740.1| hypothetical protein SPAB_02527 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] gi|167553014|ref|ZP_02346764.1| tetraacyldisaccharide 4'-kinase [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] gi|167994936|ref|ZP_02576026.1| tetraacyldisaccharide 4'-kinase [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] gi|168233406|ref|ZP_02658464.1| tetraacyldisaccharide 4'-kinase [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] gi|168243754|ref|ZP_02668686.1| tetraacyldisaccharide 4'-kinase [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] gi|168263519|ref|ZP_02685492.1| tetraacyldisaccharide 4'-kinase [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] gi|168466581|ref|ZP_02700443.1| tetraacyldisaccharide 4'-kinase [Salmonella enterica subsp. enterica serovar Newport str. SL317] gi|168822083|ref|ZP_02834083.1| tetraacyldisaccharide 4'-kinase [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] gi|194442769|ref|YP_002040185.1| hypothetical protein SNSL254_A1020 [Salmonella enterica subsp. enterica serovar Newport str. SL254] gi|194451130|ref|YP_002044979.1| hypothetical protein SeHA_C1085 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] gi|194470708|ref|ZP_03076692.1| tetraacyldisaccharide 4'-kinase [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] gi|197249748|ref|YP_002145905.1| hypothetical protein SeAg_B0993 [Salmonella enterica subsp. enterica serovar Agona str. SL483] gi|197262620|ref|ZP_03162694.1| tetraacyldisaccharide 4'-kinase [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] gi|197362887|ref|YP_002142524.1| hypothetical protein SSPA1684 [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601] gi|198244229|ref|YP_002214911.1| hypothetical protein SeD_A1052 [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] gi|200390486|ref|ZP_03217097.1| tetraacyldisaccharide 4'-kinase [Salmonella enterica subsp. enterica serovar Virchow str. SL491] gi|205352194|ref|YP_002225995.1| hypothetical protein SG0929 [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91] gi|207856378|ref|YP_002243029.1| hypothetical protein SEN0891 [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109] gi|213025060|ref|ZP_03339507.1| hypothetical protein Salmonelentericaenterica_22393 [Salmonella enterica subsp. enterica serovar Typhi str. 404ty] gi|213162061|ref|ZP_03347771.1| hypothetical protein Salmoneentericaenterica_19522 [Salmonella enterica subsp. enterica serovar Typhi str. E00-7866] gi|213416603|ref|ZP_03349747.1| hypothetical protein Salmonentericaenterica_00923 [Salmonella enterica subsp. enterica serovar Typhi str. E01-6750] gi|213424602|ref|ZP_03357385.1| hypothetical protein SentesTyphi_02326 [Salmonella enterica subsp. enterica serovar Typhi str. E02-1180] gi|213579945|ref|ZP_03361771.1| hypothetical protein SentesTyph_01538 [Salmonella enterica subsp. enterica serovar Typhi str. E98-0664] gi|213612922|ref|ZP_03370748.1| hypothetical protein SentesTyp_10659 [Salmonella enterica subsp. enterica serovar Typhi str. E98-2068] gi|213650535|ref|ZP_03380588.1| hypothetical protein SentesTy_26838 [Salmonella enterica subsp. enterica serovar Typhi str. J185] gi|224582797|ref|YP_002636595.1| hypothetical protein SPC_0988 [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594] gi|238913240|ref|ZP_04657077.1| hypothetical protein SentesTe_19244 [Salmonella enterica subsp. enterica serovar Tennessee str. CDC07-0191] gi|289810827|ref|ZP_06541456.1| hypothetical protein Salmonellaentericaenterica_43357 [Salmonella enterica subsp. enterica serovar Typhi str. AG3] gi|289825851|ref|ZP_06545019.1| hypothetical protein Salmonellentericaenterica_10635 [Salmonella enterica subsp. enterica serovar Typhi str. E98-3139] gi|81360283|sp|Q5PGF4|YCAR_SALPA RecName: Full=UPF0434 protein ycaR gi|81416401|sp|Q7CQT7|YCAR_SALTY RecName: Full=UPF0434 protein ycaR gi|81499257|sp|Q8XEM5|YCAR_SALTI RecName: Full=UPF0434 protein ycaR gi|148841377|sp|Q57R11|YCAR_SALCH RecName: Full=UPF0434 protein ycaR gi|189041093|sp|A9N7U5|YCAR_SALPB RecName: Full=UPF0434 protein ycaR gi|226710588|sp|B5F170|YCAR_SALA4 RecName: Full=UPF0434 protein ycaR gi|226710589|sp|B5FQ60|YCAR_SALDC RecName: Full=UPF0434 protein ycaR gi|226710590|sp|B5QZC1|YCAR_SALEP RecName: Full=UPF0434 protein ycaR gi|226710591|sp|B5R8K4|YCAR_SALG2 RecName: Full=UPF0434 protein ycaR gi|226710592|sp|B4TDQ4|YCAR_SALHS RecName: Full=UPF0434 protein ycaR gi|226710593|sp|B4T151|YCAR_SALNS RecName: Full=UPF0434 protein ycaR gi|226710594|sp|B5BBP1|YCAR_SALPK RecName: Full=UPF0434 protein ycaR gi|254814009|sp|C0PXV4|YCAR_SALPC RecName: Full=UPF0434 protein ycaR gi|25513318|pir||AI0614 conserved hypothetical protein STY0989 [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) gi|16419499|gb|AAL19921.1| putative inner membrane protein [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2] gi|16502149|emb|CAD05387.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Typhi] gi|29138001|gb|AAO69562.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] gi|56128221|gb|AAV77727.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] gi|161364139|gb|ABX67907.1| hypothetical protein SPAB_02527 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] gi|194401432|gb|ACF61654.1| tetraacyldisaccharide 4'-kinase [Salmonella enterica subsp. enterica serovar Newport str. SL254] gi|194409434|gb|ACF69653.1| tetraacyldisaccharide 4'-kinase [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] gi|194457072|gb|EDX45911.1| tetraacyldisaccharide 4'-kinase [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] gi|195630969|gb|EDX49555.1| tetraacyldisaccharide 4'-kinase [Salmonella enterica subsp. enterica serovar Newport str. SL317] gi|197094364|emb|CAR59876.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601] gi|197213451|gb|ACH50848.1| tetraacyldisaccharide 4'-kinase [Salmonella enterica subsp. enterica serovar Agona str. SL483] gi|197240875|gb|EDY23495.1| tetraacyldisaccharide 4'-kinase [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] gi|197938745|gb|ACH76078.1| tetraacyldisaccharide 4'-kinase [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] gi|199602931|gb|EDZ01477.1| tetraacyldisaccharide 4'-kinase [Salmonella enterica subsp. enterica serovar Virchow str. SL491] gi|205271975|emb|CAR36819.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91] gi|205322461|gb|EDZ10300.1| tetraacyldisaccharide 4'-kinase [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] gi|205327285|gb|EDZ14049.1| tetraacyldisaccharide 4'-kinase [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] gi|205332456|gb|EDZ19220.1| tetraacyldisaccharide 4'-kinase [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] gi|205337162|gb|EDZ23926.1| tetraacyldisaccharide 4'-kinase [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] gi|205341522|gb|EDZ28286.1| tetraacyldisaccharide 4'-kinase [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] gi|205347844|gb|EDZ34475.1| tetraacyldisaccharide 4'-kinase [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] gi|206708181|emb|CAR32474.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109] gi|224467324|gb|ACN45154.1| hypothetical protein SPC_0988 [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594] gi|261246203|emb|CBG24007.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Typhimurium str. D23580] gi|267992725|gb|ACY87610.1| hypothetical protein STM14_1116 [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S] gi|301157530|emb|CBW17020.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344] gi|312911973|dbj|BAJ35947.1| hypothetical protein STMDT12_C10040 [Salmonella enterica subsp. enterica serovar Typhimurium str. T000240] gi|320085229|emb|CBY95014.1| Tetraacyldisaccharide 4'-kinase Lipid A 4'-kinase [Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1] gi|321223310|gb|EFX48379.1| UPF0434 protein YcaR [Salmonella enterica subsp. enterica serovar Typhimurium str. TN061786] gi|323129252|gb|ADX16682.1| UPF0434 protein ycaR [Salmonella enterica subsp. enterica serovar Typhimurium str. 4/74] gi|326622664|gb|EGE29009.1| UPF0434 protein ycaR [Salmonella enterica subsp. enterica serovar Dublin str. 3246] gi|326627238|gb|EGE33581.1| hypothetical protein SG9_0950 [Salmonella enterica subsp. enterica serovar Gallinarum str. 9] gi|332987878|gb|AEF06861.1| hypothetical protein STMUK_0953 [Salmonella enterica subsp. enterica serovar Typhimurium str. UK-1] Length = 60 Score = 90.7 bits (225), Expect = 6e-17, Method: Composition-based stats. Identities = 23/56 (41%), Positives = 36/56 (64%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ G L E EL+ K +LA+P+R G+P++L +EAR + Sbjct: 1 MDHRLLEIIACPVCNGKLWYNQEQQELICKLDNLAFPLRDGIPVLLENEARALTSD 56 >gi|123441860|ref|YP_001005843.1| hypothetical protein YE1549 [Yersinia enterocolitica subsp. enterocolitica 8081] gi|238757627|ref|ZP_04618811.1| hypothetical protein yaldo0001_19480 [Yersinia aldovae ATCC 35236] gi|238784537|ref|ZP_04628545.1| hypothetical protein yberc0001_26140 [Yersinia bercovieri ATCC 43970] gi|238789309|ref|ZP_04633096.1| hypothetical protein yfred0001_41180 [Yersinia frederiksenii ATCC 33641] gi|148841329|sp|A1JMK8|Y1549_YERE8 RecName: Full=UPF0434 protein YE1549 gi|122088821|emb|CAL11627.1| conserved hypothetical protein [Yersinia enterocolitica subsp. enterocolitica 8081] gi|238704132|gb|EEP96665.1| hypothetical protein yaldo0001_19480 [Yersinia aldovae ATCC 35236] gi|238714600|gb|EEQ06604.1| hypothetical protein yberc0001_26140 [Yersinia bercovieri ATCC 43970] gi|238722641|gb|EEQ14294.1| hypothetical protein yfred0001_41180 [Yersinia frederiksenii ATCC 33641] Length = 60 Score = 90.7 bits (225), Expect = 6e-17, Method: Composition-based stats. Identities = 24/56 (42%), Positives = 36/56 (64%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ G L E EL+ K +LAYP+R G+P++L +EAR + Sbjct: 1 MDHRLLEIVACPVCNGKLYFNKENLELVCKADNLAYPVRDGIPVLLENEARPLSID 56 >gi|226192872|ref|ZP_03788485.1| conserved hypothetical protein [Burkholderia pseudomallei Pakistan 9] gi|225935122|gb|EEH31096.1| conserved hypothetical protein [Burkholderia pseudomallei Pakistan 9] Length = 390 Score = 90.7 bits (225), Expect = 6e-17, Method: Composition-based stats. Identities = 22/43 (51%), Positives = 27/43 (62%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVP 50 +D +LLEILVCP+ KG L EL+ LAYPIR G+P Sbjct: 1 MDARLLEILVCPICKGPLHYDRGAQELVCHADKLAYPIRDGIP 43 >gi|291616913|ref|YP_003519655.1| YcaR [Pantoea ananatis LMG 20103] gi|291151943|gb|ADD76527.1| YcaR [Pantoea ananatis LMG 20103] gi|327393340|dbj|BAK10762.1| uncharacterized conserved protein YcaR [Pantoea ananatis AJ13355] Length = 60 Score = 90.7 bits (225), Expect = 6e-17, Method: Composition-based stats. Identities = 23/56 (41%), Positives = 38/56 (67%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ G L +E EL+ K +LA+P+R G+P++L +EAR + + Sbjct: 1 MDHRLLEIVACPVCNGKLYYNNEQQELICKPDALAFPVRDGIPVLLENEARTLSVE 56 >gi|312113422|ref|YP_004011018.1| hypothetical protein Rvan_0642 [Rhodomicrobium vannielii ATCC 17100] gi|311218551|gb|ADP69919.1| protein of unknown function DUF343 [Rhodomicrobium vannielii ATCC 17100] Length = 63 Score = 90.7 bits (225), Expect = 6e-17, Method: Composition-based stats. Identities = 29/53 (54%), Positives = 38/53 (71%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 +DP LLEILVCP+TK L EL+S+ A LAYP+R G+P+ML EAR++ Sbjct: 9 LDPVLLEILVCPITKTPLVYDRTAGELVSQAAGLAYPVRKGIPVMLPEEARKL 61 >gi|163739844|ref|ZP_02147251.1| hypothetical protein RGBS107_05334 [Phaeobacter gallaeciensis BS107] gi|161386878|gb|EDQ11240.1| hypothetical protein RGBS107_05334 [Phaeobacter gallaeciensis BS107] Length = 68 Score = 90.7 bits (225), Expect = 6e-17, Method: Composition-based stats. Identities = 25/55 (45%), Positives = 38/55 (69%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 + D ++LE LVCP T+ L + EL+S+ +LA+PIR+G+P+ML EAR +D Sbjct: 14 SFDRRMLEALVCPRTQTVLEYDASAQELISRAGNLAFPIRNGIPVMLEDEARVLD 68 >gi|254447984|ref|ZP_05061448.1| tetraacyldisaccharide-1-P 4-kinase [gamma proteobacterium HTCC5015] gi|198262410|gb|EDY86691.1| tetraacyldisaccharide-1-P 4-kinase [gamma proteobacterium HTCC5015] Length = 58 Score = 90.7 bits (225), Expect = 7e-17, Method: Composition-based stats. Identities = 25/55 (45%), Positives = 35/55 (63%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 ++ L+I+VCP T L EL+S+KA LAYPIR G+P+ML EAR++ Sbjct: 1 MNKDYLDIVVCPKTGEKLVYDETHQELISEKAGLAYPIRDGIPVMLEEEARELSS 55 >gi|192359895|ref|YP_001980617.1| Tetraacyldisaccharide-1-P 4-kinase [Cellvibrio japonicus Ueda107] gi|190686060|gb|ACE83738.1| Tetraacyldisaccharide-1-P 4-kinase [Cellvibrio japonicus Ueda107] Length = 59 Score = 90.7 bits (225), Expect = 7e-17, Method: Composition-based stats. Identities = 27/57 (47%), Positives = 38/57 (66%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 + P+LL ILVCP++K L E EL+ K + LAYPIR G+P+ML EAR++ + Sbjct: 1 MLSPKLLAILVCPVSKAPLDYRPEQQELVCKTSGLAYPIRDGIPVMLEYEARRLAPE 57 >gi|152996175|ref|YP_001341010.1| hypothetical protein Mmwyl1_2153 [Marinomonas sp. MWYL1] gi|189039510|sp|A6VX96|Y2153_MARMS RecName: Full=UPF0434 protein Mmwyl1_2153 gi|150837099|gb|ABR71075.1| protein of unknown function DUF343 [Marinomonas sp. MWYL1] Length = 65 Score = 90.7 bits (225), Expect = 7e-17, Method: Composition-based stats. Identities = 28/56 (50%), Positives = 42/56 (75%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 ++ LL+ILVCP+TK +LTL +GTEL+SK +AYP+R G+P++L +EAR + Sbjct: 1 MNKTLLDILVCPVTKASLTLSKDGTELISKVGGMAYPVRDGIPVLLETEARTLTAD 56 >gi|292487835|ref|YP_003530710.1| hypothetical protein EAMY_1352 [Erwinia amylovora CFBP1430] gi|292899062|ref|YP_003538431.1| hypothetical protein EAM_1345 [Erwinia amylovora ATCC 49946] gi|291198910|emb|CBJ46020.1| conserved hypothetical protein [Erwinia amylovora ATCC 49946] gi|291553257|emb|CBA20302.1| Hypothetical protein EAMY_1352 [Erwinia amylovora CFBP1430] gi|312171956|emb|CBX80213.1| Hypothetical protein EAIL5_1393 [Erwinia amylovora ATCC BAA-2158] Length = 60 Score = 90.7 bits (225), Expect = 7e-17, Method: Composition-based stats. Identities = 23/56 (41%), Positives = 34/56 (60%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ G L E EL+ K LA+P+R G+P++L EAR + Sbjct: 1 MDYRLLEIVACPVCHGKLYYNKEQQELVCKPDGLAFPVRDGIPVLLEVEARALTLD 56 >gi|146282974|ref|YP_001173127.1| hypothetical protein PST_2635 [Pseudomonas stutzeri A1501] gi|166988486|sp|A4VMT4|Y2635_PSEU5 RecName: Full=UPF0434 protein PST_2635 gi|145571179|gb|ABP80285.1| conserved hypothetical protein [Pseudomonas stutzeri A1501] gi|327481325|gb|AEA84635.1| conserved hypothetical protein [Pseudomonas stutzeri DSM 4166] Length = 61 Score = 90.7 bits (225), Expect = 7e-17, Method: Composition-based stats. Identities = 28/56 (50%), Positives = 39/56 (69%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LL+IL CPL KG L L + +EL+ K LA+P+R G+P+ML SEAR +D Sbjct: 1 MDTKLLDILACPLCKGPLKLAEDKSELICKADGLAFPVRDGIPVMLESEARTLDVD 56 >gi|71278892|ref|YP_268853.1| hypothetical protein CPS_2127 [Colwellia psychrerythraea 34H] gi|123632731|sp|Q483B4|Y2127_COLP3 RecName: Full=UPF0434 protein CPS_2127 gi|71144632|gb|AAZ25105.1| conserved hypothetical protein [Colwellia psychrerythraea 34H] Length = 65 Score = 90.7 bits (225), Expect = 7e-17, Method: Composition-based stats. Identities = 21/56 (37%), Positives = 32/56 (57%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 D +L+EIL CP+ KG L EL+ LAY I +P++L +EAR+++ Sbjct: 1 MAFDTKLMEILACPVCKGKLDYDKAAQELICHFDRLAYSIEKDIPVLLENEAREIN 56 >gi|329119985|ref|ZP_08248657.1| tetraacyldisaccharide 4'-kinase [Neisseria bacilliformis ATCC BAA-1200] gi|327463898|gb|EGF10212.1| tetraacyldisaccharide 4'-kinase [Neisseria bacilliformis ATCC BAA-1200] Length = 60 Score = 90.7 bits (225), Expect = 7e-17, Method: Composition-based stats. Identities = 25/56 (44%), Positives = 39/56 (69%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 ++ + +ILVCP+TKG L + EL S++A LAYPI+ G+P ML +EAR + ++ Sbjct: 1 MEQKYFDILVCPVTKGRLEYRRDKQELWSRQAKLAYPIKDGIPHMLENEARALSEE 56 >gi|50121479|ref|YP_050646.1| hypothetical protein ECA2555 [Pectobacterium atrosepticum SCRI1043] gi|81644832|sp|Q6D439|Y2555_ERWCT RecName: Full=UPF0434 protein ECA2555 gi|49612005|emb|CAG75454.1| conserved hypothetical protein [Pectobacterium atrosepticum SCRI1043] Length = 60 Score = 90.7 bits (225), Expect = 7e-17, Method: Composition-based stats. Identities = 24/56 (42%), Positives = 36/56 (64%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ G L E EL+ K LAYP+R G+P++L +EAR++ Sbjct: 1 MDHRLLEIVACPVCNGRLYFNKEKLELICKADGLAYPVRDGIPVLLENEARKLGAD 56 >gi|145588471|ref|YP_001155068.1| hypothetical protein Pnuc_0283 [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1] gi|145046877|gb|ABP33504.1| protein of unknown function DUF343 [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1] Length = 60 Score = 90.7 bits (225), Expect = 7e-17, Method: Composition-based stats. Identities = 30/57 (52%), Positives = 37/57 (64%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LL+ILVCPL K L L +E EL+ K LAYPIR VP+MLV EAR + Sbjct: 1 MMDKRLLDILVCPLCKSQLHLDTEKHELICKADRLAYPIRDDVPVMLVDEARSLSAD 57 >gi|163802110|ref|ZP_02196006.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Vibrio sp. AND4] gi|262394756|ref|YP_003286610.1| protein ycaR [Vibrio sp. Ex25] gi|159174251|gb|EDP59059.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Vibrio sp. AND4] gi|262338350|gb|ACY52145.1| protein ycaR [Vibrio sp. Ex25] Length = 59 Score = 90.3 bits (224), Expect = 7e-17, Method: Composition-based stats. Identities = 28/58 (48%), Positives = 39/58 (67%), Gaps = 1/58 (1%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD-DQG 64 +D +LLEI+ CP+ KG LT E EL+ K LAYPI+ G+P++L EAR + D+G Sbjct: 1 MDHRLLEIVACPVCKGKLTYDKENQELICKLDRLAYPIKEGIPVLLEPEARTMSMDEG 58 >gi|91225261|ref|ZP_01260429.1| hypothetical protein V12G01_20878 [Vibrio alginolyticus 12G01] gi|153837355|ref|ZP_01990022.1| conserved domain protein [Vibrio parahaemolyticus AQ3810] gi|156973827|ref|YP_001444734.1| hypothetical protein VIBHAR_01537 [Vibrio harveyi ATCC BAA-1116] gi|260363815|ref|ZP_05776570.1| tetraacyldisaccharide 4'-kinase [Vibrio parahaemolyticus K5030] gi|260876925|ref|ZP_05889280.1| tetraacyldisaccharide 4'-kinase [Vibrio parahaemolyticus AN-5034] gi|260897933|ref|ZP_05906429.1| tetraacyldisaccharide 4'-kinase (Lipid A 4'-kinase) [Vibrio parahaemolyticus Peru-466] gi|260903468|ref|ZP_05911863.1| tetraacyldisaccharide 4'-kinase [Vibrio parahaemolyticus AQ4037] gi|166979770|sp|A7MV11|Y1537_VIBHB RecName: Full=UPF0434 protein VIBHAR_01537 gi|91189900|gb|EAS76172.1| hypothetical protein V12G01_20878 [Vibrio alginolyticus 12G01] gi|149749386|gb|EDM60159.1| conserved domain protein [Vibrio parahaemolyticus AQ3810] gi|156525421|gb|ABU70507.1| hypothetical protein VIBHAR_01537 [Vibrio harveyi ATCC BAA-1116] gi|308085483|gb|EFO35178.1| tetraacyldisaccharide 4'-kinase (Lipid A 4'-kinase) [Vibrio parahaemolyticus Peru-466] gi|308093766|gb|EFO43461.1| tetraacyldisaccharide 4'-kinase [Vibrio parahaemolyticus AN-5034] gi|308110336|gb|EFO47876.1| tetraacyldisaccharide 4'-kinase [Vibrio parahaemolyticus AQ4037] gi|308113864|gb|EFO51404.1| tetraacyldisaccharide 4'-kinase [Vibrio parahaemolyticus K5030] gi|328473264|gb|EGF44112.1| hypothetical protein VP10329_21340 [Vibrio parahaemolyticus 10329] Length = 59 Score = 90.3 bits (224), Expect = 7e-17, Method: Composition-based stats. Identities = 27/58 (46%), Positives = 39/58 (67%), Gaps = 1/58 (1%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD-DQG 64 +D +LLEI+ CP+ KG LT + EL+ K LAYPI+ G+P++L EAR + D+G Sbjct: 1 MDHRLLEIVACPVCKGKLTYDKDNQELICKLDRLAYPIKEGIPVLLEPEARTMSMDEG 58 >gi|149910078|ref|ZP_01898725.1| hypothetical protein PE36_12967 [Moritella sp. PE36] gi|149806803|gb|EDM66765.1| hypothetical protein PE36_12967 [Moritella sp. PE36] Length = 62 Score = 90.3 bits (224), Expect = 7e-17, Method: Composition-based stats. Identities = 22/58 (37%), Positives = 33/58 (56%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D LLEI+ CP+ KG L EL+ LAYPI G+P+++ +ARQ+ + Sbjct: 1 MTLDHNLLEIIACPVCKGKLHFDKSNNELICNADRLAYPITEGIPVLIQVKARQLTSE 58 >gi|329891197|ref|ZP_08269540.1| trm112p-like family protein [Brevundimonas diminuta ATCC 11568] gi|328846498|gb|EGF96062.1| trm112p-like family protein [Brevundimonas diminuta ATCC 11568] Length = 64 Score = 90.3 bits (224), Expect = 8e-17, Method: Composition-based stats. Identities = 32/55 (58%), Positives = 42/55 (76%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 ++DP+LLE+LVCP+T+G LT E EL+S A LA+PIR GVPIML +AR +D Sbjct: 10 SVDPRLLEVLVCPVTRGRLTYDRERNELVSAGAKLAFPIRDGVPIMLAEDARPLD 64 >gi|312883541|ref|ZP_07743266.1| hypothetical protein VIBC2010_12019 [Vibrio caribbenthicus ATCC BAA-2122] gi|309368764|gb|EFP96291.1| hypothetical protein VIBC2010_12019 [Vibrio caribbenthicus ATCC BAA-2122] Length = 59 Score = 90.3 bits (224), Expect = 8e-17, Method: Composition-based stats. Identities = 25/56 (44%), Positives = 39/56 (69%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ KG LT + EL+ K L+YPI+ G+P++L SEAR++ + Sbjct: 1 MDHRLLEIVACPICKGKLTFDKDKQELICKFDRLSYPIKQGIPVLLESEARRISLE 56 >gi|294141521|ref|YP_003557499.1| hypothetical protein SVI_2750 [Shewanella violacea DSS12] gi|293327990|dbj|BAJ02721.1| conserved hypothetical protein [Shewanella violacea DSS12] Length = 59 Score = 90.3 bits (224), Expect = 8e-17, Method: Composition-based stats. Identities = 22/58 (37%), Positives = 32/58 (55%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 D +LLEI+ CP+ KG L +L+ K LAY I G+P++L ++A DQ Sbjct: 1 MAFDKKLLEIVACPVCKGKLDYDKTKQQLICKADRLAYAINDGIPVLLENKAEPWQDQ 58 >gi|197103487|ref|YP_002128864.1| tetraacyldisaccharide-1-P 4-kinase [Phenylobacterium zucineum HLK1] gi|196476907|gb|ACG76435.1| tetraacyldisaccharide-1-P 4-kinase [Phenylobacterium zucineum HLK1] Length = 68 Score = 90.3 bits (224), Expect = 8e-17, Method: Composition-based stats. Identities = 34/56 (60%), Positives = 43/56 (76%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 ++DP+LLEILVCPLT+G L E EL+S+ A LAYPIR GVPIML EAR++ + Sbjct: 11 DVDPRLLEILVCPLTRGPLEYDREKAELVSRSARLAYPIRDGVPIMLPEEARELGE 66 >gi|77462029|ref|YP_351533.1| hypothetical protein RSP_1491 [Rhodobacter sphaeroides 2.4.1] gi|221640982|ref|YP_002527244.1| hypothetical protein RSKD131_2883 [Rhodobacter sphaeroides KD131] gi|332559957|ref|ZP_08414279.1| hypothetical protein RSWS8N_12880 [Rhodobacter sphaeroides WS8N] gi|123593129|sp|Q3J6F2|Y064_RHOS4 RecName: Full=UPF0434 protein RHOS4_00640 gi|254801575|sp|B9KRC9|Y2883_RHOSK RecName: Full=UPF0434 protein RSKD131_2883 gi|77386447|gb|ABA77632.1| conserved hypothetical protein [Rhodobacter sphaeroides 2.4.1] gi|221161763|gb|ACM02743.1| Hypothetical Protein RSKD131_2883 [Rhodobacter sphaeroides KD131] gi|332277669|gb|EGJ22984.1| hypothetical protein RSWS8N_12880 [Rhodobacter sphaeroides WS8N] Length = 59 Score = 90.3 bits (224), Expect = 8e-17, Method: Composition-based stats. Identities = 29/53 (54%), Positives = 41/53 (77%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 D ++LE LVCP+T+ L ++ EL+SK+A LA+PIR G+PIMLVSEAR++ Sbjct: 7 FDRRMLEALVCPVTQAGLAYDADRQELISKQARLAFPIRDGIPIMLVSEAREL 59 >gi|153835237|ref|ZP_01987904.1| conserved domain protein [Vibrio harveyi HY01] gi|148868275|gb|EDL67409.1| conserved domain protein [Vibrio harveyi HY01] Length = 59 Score = 90.3 bits (224), Expect = 8e-17, Method: Composition-based stats. Identities = 25/56 (44%), Positives = 37/56 (66%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ KG LT + EL+ K LAYPI+ G+P++L EAR + + Sbjct: 1 MDHRLLEIVACPVCKGKLTYDKDNQELICKLDRLAYPIKEGIPVLLEPEARTMSME 56 >gi|88657988|ref|YP_507018.1| hypothetical protein ECH_0194 [Ehrlichia chaffeensis str. Arkansas] gi|88599445|gb|ABD44914.1| conserved hypothetical protein [Ehrlichia chaffeensis str. Arkansas] Length = 59 Score = 90.3 bits (224), Expect = 9e-17, Method: Composition-based stats. Identities = 30/56 (53%), Positives = 42/56 (75%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 D ++LEILVCPLTK L + EL+S+KA LA+PIR G+PIML+ EAR++++ Sbjct: 4 MFDHRILEILVCPLTKDKLQYNKDTNELISEKAKLAFPIRDGIPIMLIDEARKLEE 59 >gi|71908820|ref|YP_286407.1| hypothetical protein Daro_3207 [Dechloromonas aromatica RCB] gi|123626719|sp|Q47B44|Y3207_DECAR RecName: Full=UPF0434 protein Daro_3207 gi|71848441|gb|AAZ47937.1| Protein of unknown function DUF343 [Dechloromonas aromatica RCB] Length = 58 Score = 90.3 bits (224), Expect = 9e-17, Method: Composition-based stats. Identities = 29/57 (50%), Positives = 37/57 (64%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQG 64 +D +LL+ILVCP+ KGNL EL+ K LA+PIR +PIML EARQ+ G Sbjct: 1 MDARLLDILVCPICKGNLEHRKAEKELVCKPCKLAFPIRDDIPIMLEDEARQLTADG 57 >gi|53805018|ref|YP_113149.1| hypothetical protein MCA0634 [Methylococcus capsulatus str. Bath] gi|81682754|sp|Q60B48|Y634_METCA RecName: Full=UPF0434 protein MCA0634 gi|53758779|gb|AAU93070.1| conserved hypothetical protein [Methylococcus capsulatus str. Bath] Length = 70 Score = 90.3 bits (224), Expect = 9e-17, Method: Composition-based stats. Identities = 28/56 (50%), Positives = 38/56 (67%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEILVCP+ KG L + E EL+ LAYPIR +P+ML SEAR++ + Sbjct: 1 MDKRLLEILVCPVCKGGLIYLREQQELVCLADKLAYPIRDDIPVMLDSEARRLSLE 56 >gi|163744107|ref|ZP_02151472.1| hypothetical protein RG210_07909 [Phaeobacter gallaeciensis 2.10] gi|161382605|gb|EDQ07009.1| hypothetical protein RG210_07909 [Phaeobacter gallaeciensis 2.10] Length = 68 Score = 90.3 bits (224), Expect = 9e-17, Method: Composition-based stats. Identities = 25/55 (45%), Positives = 38/55 (69%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 + D ++LE LVCP T+ L + EL+S+ +LA+PIR+G+P+ML EAR +D Sbjct: 14 SFDRRMLEALVCPRTQTVLEYDASAQELISRAGNLAFPIRNGIPVMLEDEARVLD 68 >gi|307130839|ref|YP_003882855.1| hypothetical protein Dda3937_03203 [Dickeya dadantii 3937] gi|306528368|gb|ADM98298.1| conserved protein [Dickeya dadantii 3937] Length = 60 Score = 89.9 bits (223), Expect = 1e-16, Method: Composition-based stats. Identities = 24/56 (42%), Positives = 35/56 (62%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ G L E EL+ K LAYP+R G+P++L +EAR + Sbjct: 1 MDHRLLEIVACPVCNGRLIFDKEKQELICKIEGLAYPVRDGIPVLLENEARTLAPD 56 >gi|167624426|ref|YP_001674720.1| hypothetical protein Shal_2504 [Shewanella halifaxensis HAW-EB4] gi|189039703|sp|B0TK42|Y2504_SHEHH RecName: Full=UPF0434 protein Shal_2504 gi|167354448|gb|ABZ77061.1| protein of unknown function DUF343 [Shewanella halifaxensis HAW-EB4] Length = 57 Score = 89.9 bits (223), Expect = 1e-16, Method: Composition-based stats. Identities = 21/55 (38%), Positives = 32/55 (58%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 D +LLEI+ CP+ KG L E +L+ K L YPI G+P++L ++A + Sbjct: 1 MAFDKKLLEIVACPVCKGKLEYNKEAQQLICKADRLVYPINDGIPVLLENKAEPL 55 >gi|170726174|ref|YP_001760200.1| hypothetical protein Swoo_1821 [Shewanella woodyi ATCC 51908] gi|226696086|sp|B1KNM8|Y1821_SHEWM RecName: Full=UPF0434 protein Swoo_1821 gi|169811521|gb|ACA86105.1| protein of unknown function DUF343 [Shewanella woodyi ATCC 51908] Length = 58 Score = 89.9 bits (223), Expect = 1e-16, Method: Composition-based stats. Identities = 21/57 (36%), Positives = 34/57 (59%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 + D +LLEI+ CP+ KG L +L+ K LAYPI G+P++L ++A ++ Sbjct: 1 MSFDKKLLEIVACPVCKGKLDYDKAKQQLICKLDRLAYPINDGIPVLLENKAESWEE 57 >gi|319780654|ref|YP_004140130.1| hypothetical protein Mesci_0915 [Mesorhizobium ciceri biovar biserrulae WSM1271] gi|317166542|gb|ADV10080.1| protein of unknown function DUF343 [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 79 Score = 89.9 bits (223), Expect = 1e-16, Method: Composition-based stats. Identities = 31/56 (55%), Positives = 41/56 (73%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +DP+LLE+L CPLTKG L E EL+S+ A +AYP+R G+PIML SEAR + + Sbjct: 10 VDPKLLELLACPLTKGPLAWDPERGELISRVAKIAYPVRDGIPIMLPSEARTLSVE 65 >gi|226943595|ref|YP_002798668.1| hypothetical protein Avin_14770 [Azotobacter vinelandii DJ] gi|259646404|sp|C1DR20|Y1477_AZOVD RecName: Full=UPF0434 protein Avin_14770 gi|226718522|gb|ACO77693.1| conserved hypothetical protein [Azotobacter vinelandii DJ] Length = 61 Score = 89.9 bits (223), Expect = 1e-16, Method: Composition-based stats. Identities = 27/56 (48%), Positives = 41/56 (73%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +DP+LL+IL CP+ KG L L + +EL+ K +LA+P+R G+P+ML SEAR ++ Sbjct: 1 MDPKLLDILACPICKGPLKLTDDKSELICKADALAFPVRDGIPVMLESEARTLNVD 56 >gi|260597315|ref|YP_003209886.1| hypothetical protein CTU_15230 [Cronobacter turicensis z3032] gi|260216492|emb|CBA29655.1| UPF0434 protein ESA_02427 [Cronobacter turicensis z3032] Length = 60 Score = 89.9 bits (223), Expect = 1e-16, Method: Composition-based stats. Identities = 23/56 (41%), Positives = 36/56 (64%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ G L E EL+ K LA+P+R G+P++L +EAR + + Sbjct: 1 MDHRLLEIIACPVCNGKLYFNQEKQELICKADRLAFPLRDGIPVLLETEARSLAAE 56 >gi|307544572|ref|YP_003897051.1| hypothetical protein HELO_1982 [Halomonas elongata DSM 2581] gi|307216596|emb|CBV41866.1| K09791 hypothetical protein [Halomonas elongata DSM 2581] Length = 69 Score = 89.9 bits (223), Expect = 1e-16, Method: Composition-based stats. Identities = 29/56 (51%), Positives = 37/56 (66%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LL +LVCPL KG L E ELL + LAYP+R G+P+ML EARQ+D Sbjct: 1 MDKELLAMLVCPLCKGKLKYDREADELLCRYDGLAYPVRDGIPVMLPDEARQMDVD 56 >gi|159042589|ref|YP_001531383.1| hypothetical protein Dshi_0033 [Dinoroseobacter shibae DFL 12] gi|157910349|gb|ABV91782.1| protein of unknown function DUF343 [Dinoroseobacter shibae DFL 12] Length = 63 Score = 89.9 bits (223), Expect = 1e-16, Method: Composition-based stats. Identities = 27/54 (50%), Positives = 40/54 (74%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 D +LE LVCP+T+ LT +E EL+S+ A LA+PIR+G+P+M+ EAR++D Sbjct: 10 FDRHMLESLVCPVTRAPLTYDAEAQELISRAAHLAFPIRNGIPVMIEDEARKLD 63 >gi|68171430|ref|ZP_00544820.1| Protein of unknown function DUF343 [Ehrlichia chaffeensis str. Sapulpa] gi|148841342|sp|Q2GHR5|Y194_EHRCR RecName: Full=UPF0434 protein ECH_0194 gi|67999150|gb|EAM85810.1| Protein of unknown function DUF343 [Ehrlichia chaffeensis str. Sapulpa] Length = 56 Score = 89.9 bits (223), Expect = 1e-16, Method: Composition-based stats. Identities = 30/56 (53%), Positives = 42/56 (75%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 D ++LEILVCPLTK L + EL+S+KA LA+PIR G+PIML+ EAR++++ Sbjct: 1 MFDHRILEILVCPLTKDKLQYNKDTNELISEKAKLAFPIRDGIPIMLIDEARKLEE 56 >gi|261401074|ref|ZP_05987199.1| tetraacyldisaccharide 4'-kinase [Neisseria lactamica ATCC 23970] gi|269208965|gb|EEZ75420.1| tetraacyldisaccharide 4'-kinase [Neisseria lactamica ATCC 23970] Length = 60 Score = 89.9 bits (223), Expect = 1e-16, Method: Composition-based stats. Identities = 25/56 (44%), Positives = 39/56 (69%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 ++ + L+ILVCP+TKG L + EL S++A LAYPI+ G+P ML +E R + ++ Sbjct: 1 MEKKFLDILVCPVTKGRLEYHQDKQELWSRQAKLAYPIKDGIPYMLENEVRALSEE 56 >gi|153000197|ref|YP_001365878.1| hypothetical protein Shew185_1670 [Shewanella baltica OS185] gi|166980183|sp|A6WLX6|Y1670_SHEB8 RecName: Full=UPF0434 protein Shew185_1670 gi|151364815|gb|ABS07815.1| protein of unknown function DUF343 [Shewanella baltica OS185] Length = 59 Score = 89.5 bits (222), Expect = 1e-16, Method: Composition-based stats. Identities = 20/57 (35%), Positives = 32/57 (56%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 D +LL+I+ CP+ KG L +L+ K LAYPI G+P++L + A + + Sbjct: 1 MAFDKKLLDIVACPVCKGKLEYDKMTQQLICKADKLAYPITEGIPVLLENRAVPLTE 57 >gi|157369961|ref|YP_001477950.1| hypothetical protein Spro_1718 [Serratia proteamaculans 568] gi|166980203|sp|A8GCI2|Y1718_SERP5 RecName: Full=UPF0434 protein Spro_1718 gi|157321725|gb|ABV40822.1| protein of unknown function DUF343 [Serratia proteamaculans 568] Length = 60 Score = 89.5 bits (222), Expect = 1e-16, Method: Composition-based stats. Identities = 24/56 (42%), Positives = 35/56 (62%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ G L E EL+ K LAYP+R G+P++L +EAR + Sbjct: 1 MDHRLLEIVACPVCTGKLYFNKENQELVCKVDGLAYPLRDGIPVLLENEARALSLD 56 >gi|260772494|ref|ZP_05881410.1| hypothetical protein VIB_000942 [Vibrio metschnikovii CIP 69.14] gi|260611633|gb|EEX36836.1| hypothetical protein VIB_000942 [Vibrio metschnikovii CIP 69.14] Length = 59 Score = 89.5 bits (222), Expect = 1e-16, Method: Composition-based stats. Identities = 27/58 (46%), Positives = 38/58 (65%), Gaps = 1/58 (1%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD-DQG 64 +D +LLEI+ CP+ KG LT EL+ K LAYPI+ G+P++L EAR + D+G Sbjct: 1 MDHRLLEIVACPVCKGKLTYDKSNQELICKLDRLAYPIKEGIPVLLEPEARSMTMDEG 58 >gi|126738699|ref|ZP_01754404.1| hypothetical protein RSK20926_09542 [Roseobacter sp. SK209-2-6] gi|126720498|gb|EBA17204.1| hypothetical protein RSK20926_09542 [Roseobacter sp. SK209-2-6] Length = 62 Score = 89.5 bits (222), Expect = 1e-16, Method: Composition-based stats. Identities = 29/62 (46%), Positives = 41/62 (66%), Gaps = 1/62 (1%) Query: 1 MRETIFN-IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 M E D ++LE L+CP T+ L + EL+SK A+LA+PIR+G+P+MLV EAR Sbjct: 1 MSEAKQAQFDRRMLETLICPQTQTVLEYDAASQELISKAANLAFPIRNGIPVMLVDEART 60 Query: 60 VD 61 +D Sbjct: 61 LD 62 >gi|110677456|ref|YP_680463.1| hypothetical protein RD1_0037 [Roseobacter denitrificans OCh 114] gi|122973166|sp|Q16E16|Y037_ROSDO RecName: Full=UPF0434 protein RD1_0037 gi|109453572|gb|ABG29777.1| conserved hypothetical protein [Roseobacter denitrificans OCh 114] Length = 61 Score = 89.5 bits (222), Expect = 1e-16, Method: Composition-based stats. Identities = 29/61 (47%), Positives = 41/61 (67%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 M ET D ++LE L+CP + L E EL+S+ A+LAYPIR+G+P+ML+ EAR + Sbjct: 1 MSETEVVFDRRMLEALICPRSHETLKYDQERQELISETANLAYPIRNGIPVMLIDEARVL 60 Query: 61 D 61 D Sbjct: 61 D 61 >gi|51595764|ref|YP_069955.1| hypothetical protein YPTB1424 [Yersinia pseudotuberculosis IP 32953] gi|108806690|ref|YP_650606.1| hypothetical protein YPA_0693 [Yersinia pestis Antiqua] gi|108812739|ref|YP_648506.1| hypothetical protein YPN_2578 [Yersinia pestis Nepal516] gi|145599568|ref|YP_001163644.1| hypothetical protein YPDSF_2296 [Yersinia pestis Pestoides F] gi|149366656|ref|ZP_01888690.1| hypothetical protein YPE_1891 [Yersinia pestis CA88-4125] gi|153947309|ref|YP_001401537.1| hypothetical protein YpsIP31758_2572 [Yersinia pseudotuberculosis IP 31758] gi|162419452|ref|YP_001606437.1| hypothetical protein YpAngola_A1964 [Yersinia pestis Angola] gi|165924373|ref|ZP_02220205.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis str. F1991016] gi|165939003|ref|ZP_02227556.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis str. IP275] gi|166009948|ref|ZP_02230846.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str. E1979001] gi|166211323|ref|ZP_02237358.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str. B42003004] gi|167399856|ref|ZP_02305374.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str. UG05-0454] gi|167419860|ref|ZP_02311613.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis str. MG05-1020] gi|167423970|ref|ZP_02315723.1| conserved hypothetical protein [Yersinia pestis biovar Mediaevalis str. K1973002] gi|170024886|ref|YP_001721391.1| hypothetical protein YPK_2661 [Yersinia pseudotuberculosis YPIII] gi|186894843|ref|YP_001871955.1| hypothetical protein YPTS_1526 [Yersinia pseudotuberculosis PB1/+] gi|218928547|ref|YP_002346422.1| hypothetical protein YPO1399 [Yersinia pestis CO92] gi|229841370|ref|ZP_04461529.1| conserved protein [Yersinia pestis biovar Orientalis str. PEXU2] gi|229843475|ref|ZP_04463621.1| conserved protein [Yersinia pestis biovar Orientalis str. India 195] gi|229895848|ref|ZP_04511018.1| conserved protein [Yersinia pestis Pestoides A] gi|229903146|ref|ZP_04518259.1| conserved protein [Yersinia pestis Nepal516] gi|270486940|ref|ZP_06204014.1| hypothetical protein YPD27_0412 [Yersinia pestis KIM D27] gi|81639893|sp|Q66CH9|Y1424_YERPS RecName: Full=UPF0434 protein YPTB1424 gi|122383652|sp|Q1CA61|Y693_YERPA RecName: Full=UPF0434 protein YPA_0693 gi|122384464|sp|Q1CGH4|Y2578_YERPN RecName: Full=UPF0434 protein YPN_2578 gi|148841321|sp|Q74VT6|Y1399_YERPE RecName: Full=UPF0434 protein YPO1399/y2773.1/YP_1194 gi|166987431|sp|A4TN09|Y2296_YERPP RecName: Full=UPF0434 protein YPDSF_2296 gi|166987517|sp|A7FJV9|Y2572_YERP3 RecName: Full=UPF0434 protein YpsIP31758_2572 gi|226701099|sp|A9R7J2|Y1964_YERPG RecName: Full=UPF0434 protein YpAngola_A1964 gi|226701481|sp|B1JQT7|Y2661_YERPY RecName: Full=UPF0434 protein YPK_2661 gi|226734679|sp|B2KA33|Y1526_YERPB RecName: Full=UPF0434 protein YPTS_1526 gi|51589046|emb|CAH20664.1| conserved hypothetical protein [Yersinia pseudotuberculosis IP 32953] gi|108776387|gb|ABG18906.1| hypothetical protein YPN_2578 [Yersinia pestis Nepal516] gi|108778603|gb|ABG12661.1| hypothetical protein YPA_0693 [Yersinia pestis Antiqua] gi|115347158|emb|CAL20051.1| conserved hypothetical protein [Yersinia pestis CO92] gi|145211264|gb|ABP40671.1| hypothetical protein YPDSF_2296 [Yersinia pestis Pestoides F] gi|149291030|gb|EDM41105.1| hypothetical protein YPE_1891 [Yersinia pestis CA88-4125] gi|152958804|gb|ABS46265.1| conserved hypothetical protein [Yersinia pseudotuberculosis IP 31758] gi|162352267|gb|ABX86215.1| conserved hypothetical protein [Yersinia pestis Angola] gi|165913150|gb|EDR31774.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis str. IP275] gi|165923433|gb|EDR40565.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis str. F1991016] gi|165991344|gb|EDR43645.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str. E1979001] gi|166207094|gb|EDR51574.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str. B42003004] gi|166962601|gb|EDR58622.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis str. MG05-1020] gi|167050564|gb|EDR61972.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str. UG05-0454] gi|167056819|gb|EDR66582.1| conserved hypothetical protein [Yersinia pestis biovar Mediaevalis str. K1973002] gi|169751420|gb|ACA68938.1| protein of unknown function DUF343 [Yersinia pseudotuberculosis YPIII] gi|186697869|gb|ACC88498.1| protein of unknown function DUF343 [Yersinia pseudotuberculosis PB1/+] gi|229678916|gb|EEO75019.1| conserved protein [Yersinia pestis Nepal516] gi|229689822|gb|EEO81883.1| conserved protein [Yersinia pestis biovar Orientalis str. India 195] gi|229697736|gb|EEO87783.1| conserved protein [Yersinia pestis biovar Orientalis str. PEXU2] gi|229700771|gb|EEO88800.1| conserved protein [Yersinia pestis Pestoides A] gi|270335444|gb|EFA46221.1| hypothetical protein YPD27_0412 [Yersinia pestis KIM D27] gi|320015740|gb|ADV99311.1| conserved protein [Yersinia pestis biovar Medievalis str. Harbin 35] Length = 60 Score = 89.5 bits (222), Expect = 1e-16, Method: Composition-based stats. Identities = 24/56 (42%), Positives = 36/56 (64%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ G L E EL+ K +LAYP+R G+P++L +EAR + Sbjct: 1 MDHRLLEIVACPVCNGKLYFNKENLELVCKVDNLAYPVRDGIPVLLENEARPLSID 56 >gi|293396762|ref|ZP_06641038.1| tetraacyldisaccharide 4'-kinase [Serratia odorifera DSM 4582] gi|291421026|gb|EFE94279.1| tetraacyldisaccharide 4'-kinase [Serratia odorifera DSM 4582] Length = 85 Score = 89.5 bits (222), Expect = 1e-16, Method: Composition-based stats. Identities = 24/54 (44%), Positives = 36/54 (66%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 ++D +LLEI+ CP+ G L E EL+ K LAYP+R G+P++L +EAR + Sbjct: 25 SMDHRLLEIVACPVCNGKLYFNKENQELVCKLDGLAYPLRDGIPVLLENEARTL 78 >gi|281178048|dbj|BAI54378.1| conserved hypothetical protein [Escherichia coli SE15] Length = 60 Score = 89.5 bits (222), Expect = 1e-16, Method: Composition-based stats. Identities = 25/58 (43%), Positives = 39/58 (67%), Gaps = 1/58 (1%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD-DQG 64 +D +LLEI+ CP+ G L E EL+ K +LA+P+R G+P++L +EAR + D+G Sbjct: 1 MDHRLLEIIACPVCNGKLWYNQEKQELICKLDNLAFPLRDGIPVLLETEARVLTADEG 58 >gi|126730402|ref|ZP_01746213.1| hypothetical protein SSE37_11619 [Sagittula stellata E-37] gi|126709135|gb|EBA08190.1| hypothetical protein SSE37_11619 [Sagittula stellata E-37] Length = 61 Score = 89.5 bits (222), Expect = 1e-16, Method: Composition-based stats. Identities = 29/61 (47%), Positives = 45/61 (73%), Gaps = 1/61 (1%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 M E + + D ++LE LVCP+++ L+ ++ EL+S+ A LAYPIR G+P+MLV EAR++ Sbjct: 1 MAEAV-SFDRRMLEALVCPVSQSVLSYDADRQELVSEPAGLAYPIRDGIPVMLVDEARRL 59 Query: 61 D 61 D Sbjct: 60 D 60 >gi|283784743|ref|YP_003364608.1| hypothetical protein ROD_09851 [Citrobacter rodentium ICC168] gi|282948197|emb|CBG87764.1| conserved hypothetical protein [Citrobacter rodentium ICC168] Length = 60 Score = 89.5 bits (222), Expect = 1e-16, Method: Composition-based stats. Identities = 23/56 (41%), Positives = 36/56 (64%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ G L E EL+ K +LA+P+R G+P++L +EAR + Sbjct: 1 MDHRLLEIIACPVCNGKLWYNQEKQELICKPDNLAFPLRDGIPVLLETEARVLTAD 56 >gi|163757417|ref|ZP_02164506.1| hypothetical protein HPDFL43_18442 [Hoeflea phototrophica DFL-43] gi|162284919|gb|EDQ35201.1| hypothetical protein HPDFL43_18442 [Hoeflea phototrophica DFL-43] Length = 57 Score = 89.5 bits (222), Expect = 1e-16, Method: Composition-based stats. Identities = 34/56 (60%), Positives = 45/56 (80%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D ++LE+LVCPLT G L SE EL+S++A LAYP+R G+PIMLVSEARQ+ D+ Sbjct: 1 MDVKMLELLVCPLTYGPLKYDSEQNELISERARLAYPVRDGIPIMLVSEARQLPDE 56 >gi|332283944|ref|YP_004415855.1| hypothetical protein PT7_0691 [Pusillimonas sp. T7-7] gi|330427897|gb|AEC19231.1| hypothetical protein PT7_0691 [Pusillimonas sp. T7-7] Length = 68 Score = 89.5 bits (222), Expect = 1e-16, Method: Composition-based stats. Identities = 26/53 (49%), Positives = 36/53 (67%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 ++ +LLEIL CPL KG L E EL+ + LA+PIR G+P+ML +EAR + Sbjct: 1 MESRLLEILACPLCKGPLRHDREQQELVCQADKLAFPIRDGIPVMLEAEARDL 53 >gi|124267672|ref|YP_001021676.1| hypothetical protein Mpe_A2486 [Methylibium petroleiphilum PM1] gi|148841351|sp|A2SIQ2|Y2486_METPP RecName: Full=UPF0434 protein Mpe_A2486 gi|124260447|gb|ABM95441.1| conserved hypothetical protein [Methylibium petroleiphilum PM1] Length = 65 Score = 89.5 bits (222), Expect = 1e-16, Method: Composition-based stats. Identities = 26/55 (47%), Positives = 37/55 (67%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 +D +L+++LVCP+ KG LT EL LA+PIR G+P+ML SEAR +D+ Sbjct: 1 MDTRLMDLLVCPICKGPLTHDHSSHELHCAADRLAFPIRDGIPVMLESEARALDE 55 >gi|157146394|ref|YP_001453713.1| hypothetical protein CKO_02153 [Citrobacter koseri ATCC BAA-895] gi|166987600|sp|A8AIG4|Y2153_CITK8 RecName: Full=UPF0434 protein CKO_02153 gi|157083599|gb|ABV13277.1| hypothetical protein CKO_02153 [Citrobacter koseri ATCC BAA-895] Length = 60 Score = 89.5 bits (222), Expect = 1e-16, Method: Composition-based stats. Identities = 23/56 (41%), Positives = 36/56 (64%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ G L E EL+ K +LA+P+R G+P++L +EAR + Sbjct: 1 MDHRLLEIIACPVCNGKLWYNQEKQELICKLDNLAFPLRDGIPVLLETEARSITAD 56 >gi|238920338|ref|YP_002933853.1| hypothetical protein NT01EI_2448 [Edwardsiella ictaluri 93-146] gi|259646850|sp|C5BAD8|Y2448_EDWI9 RecName: Full=UPF0434 protein NT01EI_2448 gi|238869907|gb|ACR69618.1| conserved hypothetical protein [Edwardsiella ictaluri 93-146] Length = 58 Score = 89.5 bits (222), Expect = 2e-16, Method: Composition-based stats. Identities = 25/56 (44%), Positives = 37/56 (66%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ G L+ E EL+ K LA+P+R G+P+ML SEAR + + Sbjct: 1 MDHRLLEIIACPVCNGKLSFNQEHQELVCKIDRLAFPLRDGIPVMLESEARPLPQE 56 >gi|15641878|ref|NP_231510.1| hypothetical protein VC1876 [Vibrio cholerae O1 biovar El Tor str. N16961] gi|121587287|ref|ZP_01677059.1| conserved hypothetical protein [Vibrio cholerae 2740-80] gi|121727137|ref|ZP_01680311.1| conserved hypothetical protein [Vibrio cholerae V52] gi|147673931|ref|YP_001217410.1| hypothetical protein VC0395_A1467 [Vibrio cholerae O395] gi|153213075|ref|ZP_01948613.1| conserved hypothetical protein [Vibrio cholerae 1587] gi|153818857|ref|ZP_01971524.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457] gi|153823087|ref|ZP_01975754.1| conserved hypothetical protein [Vibrio cholerae B33] gi|153830801|ref|ZP_01983468.1| conserved hypothetical protein [Vibrio cholerae 623-39] gi|227082006|ref|YP_002810557.1| hypothetical protein VCM66_1800 [Vibrio cholerae M66-2] gi|229508027|ref|ZP_04397532.1| hypothetical protein VCF_003261 [Vibrio cholerae BX 330286] gi|229511734|ref|ZP_04401213.1| hypothetical protein VCE_003143 [Vibrio cholerae B33] gi|229515256|ref|ZP_04404716.1| hypothetical protein VCB_002913 [Vibrio cholerae TMA 21] gi|229518872|ref|ZP_04408315.1| hypothetical protein VCC_002899 [Vibrio cholerae RC9] gi|229520336|ref|ZP_04409762.1| hypothetical protein VIF_000858 [Vibrio cholerae TM 11079-80] gi|229523895|ref|ZP_04413300.1| hypothetical protein VCA_001474 [Vibrio cholerae bv. albensis VL426] gi|229529101|ref|ZP_04418491.1| hypothetical protein VCG_002194 [Vibrio cholerae 12129(1)] gi|229607574|ref|YP_002878222.1| hypothetical protein VCD_002486 [Vibrio cholerae MJ-1236] gi|254286767|ref|ZP_04961721.1| conserved hypothetical protein [Vibrio cholerae AM-19226] gi|254848963|ref|ZP_05238313.1| tetraacyldisaccharide 4'-kinase [Vibrio cholerae MO10] gi|255745364|ref|ZP_05419313.1| hypothetical protein VCH_001712 [Vibrio cholera CIRS 101] gi|262153533|ref|ZP_06028662.1| hypothetical protein VIG_000737 [Vibrio cholerae INDRE 91/1] gi|262167433|ref|ZP_06035140.1| hypothetical protein VIJ_000597 [Vibrio cholerae RC27] gi|262191316|ref|ZP_06049509.1| hypothetical protein VIH_001686 [Vibrio cholerae CT 5369-93] gi|262404224|ref|ZP_06080779.1| hypothetical protein VOA_002214 [Vibrio sp. RC586] gi|298498084|ref|ZP_07007891.1| conserved hypothetical protein [Vibrio cholerae MAK 757] gi|81544726|sp|Q9KQX1|Y1876_VIBCH RecName: Full=UPF0434 protein VC_1876 gi|172047654|sp|A5F727|Y2667_VIBC3 RecName: Full=UPF0434 protein VC0395_A1467/VC395_1991 gi|254800635|sp|C3LNI0|Y1800_VIBCM RecName: Full=UPF0434 protein VCM66_1800 gi|9656407|gb|AAF95024.1| conserved hypothetical protein [Vibrio cholerae O1 biovar El Tor str. N16961] gi|121548447|gb|EAX58505.1| conserved hypothetical protein [Vibrio cholerae 2740-80] gi|121630515|gb|EAX62907.1| conserved hypothetical protein [Vibrio cholerae V52] gi|124116122|gb|EAY34942.1| conserved hypothetical protein [Vibrio cholerae 1587] gi|126510585|gb|EAZ73179.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457] gi|126519378|gb|EAZ76601.1| conserved hypothetical protein [Vibrio cholerae B33] gi|146315814|gb|ABQ20353.1| conserved hypothetical protein [Vibrio cholerae O395] gi|148873708|gb|EDL71843.1| conserved hypothetical protein [Vibrio cholerae 623-39] gi|150423194|gb|EDN15141.1| conserved hypothetical protein [Vibrio cholerae AM-19226] gi|227009894|gb|ACP06106.1| conserved hypothetical protein [Vibrio cholerae M66-2] gi|227013774|gb|ACP09984.1| conserved hypothetical protein [Vibrio cholerae O395] gi|229332875|gb|EEN98361.1| hypothetical protein VCG_002194 [Vibrio cholerae 12129(1)] gi|229337476|gb|EEO02493.1| hypothetical protein VCA_001474 [Vibrio cholerae bv. albensis VL426] gi|229342702|gb|EEO07694.1| hypothetical protein VIF_000858 [Vibrio cholerae TM 11079-80] gi|229343561|gb|EEO08536.1| hypothetical protein VCC_002899 [Vibrio cholerae RC9] gi|229347961|gb|EEO12920.1| hypothetical protein VCB_002913 [Vibrio cholerae TMA 21] gi|229351699|gb|EEO16640.1| hypothetical protein VCE_003143 [Vibrio cholerae B33] gi|229355532|gb|EEO20453.1| hypothetical protein VCF_003261 [Vibrio cholerae BX 330286] gi|229370229|gb|ACQ60652.1| hypothetical protein VCD_002486 [Vibrio cholerae MJ-1236] gi|254844668|gb|EET23082.1| tetraacyldisaccharide 4'-kinase [Vibrio cholerae MO10] gi|255737194|gb|EET92590.1| hypothetical protein VCH_001712 [Vibrio cholera CIRS 101] gi|262024130|gb|EEY42824.1| hypothetical protein VIJ_000597 [Vibrio cholerae RC27] gi|262030660|gb|EEY49295.1| hypothetical protein VIG_000737 [Vibrio cholerae INDRE 91/1] gi|262032812|gb|EEY51357.1| hypothetical protein VIH_001686 [Vibrio cholerae CT 5369-93] gi|262349256|gb|EEY98394.1| hypothetical protein VOA_002214 [Vibrio sp. RC586] gi|297542417|gb|EFH78467.1| conserved hypothetical protein [Vibrio cholerae MAK 757] Length = 59 Score = 89.5 bits (222), Expect = 2e-16, Method: Composition-based stats. Identities = 27/58 (46%), Positives = 39/58 (67%), Gaps = 1/58 (1%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD-DQG 64 +D +LLEI+ CP+ KG LT + EL+ K LAYPI+ G+P++L EAR + D+G Sbjct: 1 MDHRLLEIVACPVCKGKLTYDKDRQELICKLDRLAYPIKEGIPVLLEPEARSMSMDEG 58 >gi|227111952|ref|ZP_03825608.1| hypothetical protein PcarbP_03253 [Pectobacterium carotovorum subsp. brasiliensis PBR1692] gi|261821323|ref|YP_003259429.1| hypothetical protein Pecwa_2043 [Pectobacterium wasabiae WPP163] gi|261605336|gb|ACX87822.1| protein of unknown function DUF343 [Pectobacterium wasabiae WPP163] Length = 60 Score = 89.1 bits (221), Expect = 2e-16, Method: Composition-based stats. Identities = 24/56 (42%), Positives = 36/56 (64%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ G L E EL+ K LAYP+R G+P++L +EAR++ Sbjct: 1 MDHRLLEIVACPVCNGRLYFNKEKLELICKVDGLAYPVRDGIPVLLENEARKLGAD 56 >gi|163751461|ref|ZP_02158685.1| hypothetical protein KT99_10458 [Shewanella benthica KT99] gi|161328675|gb|EDP99824.1| hypothetical protein KT99_10458 [Shewanella benthica KT99] Length = 59 Score = 89.1 bits (221), Expect = 2e-16, Method: Composition-based stats. Identities = 21/58 (36%), Positives = 32/58 (55%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 D +LLEI+ CP+ KG L +L+ K LAY I G+P++L ++A D+ Sbjct: 1 MAFDRKLLEIVACPICKGKLDYDKAKQQLICKADRLAYAINDGIPVLLENKAEPWQDE 58 >gi|126460919|ref|YP_001042033.1| hypothetical protein Rsph17029_0141 [Rhodobacter sphaeroides ATCC 17029] gi|148841323|sp|A3PFZ5|Y141_RHOS1 RecName: Full=UPF0434 protein Rsph17029_0141 gi|126102583|gb|ABN75261.1| protein of unknown function DUF343 [Rhodobacter sphaeroides ATCC 17029] Length = 59 Score = 89.1 bits (221), Expect = 2e-16, Method: Composition-based stats. Identities = 29/53 (54%), Positives = 41/53 (77%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 D ++LE LVCP+T+ L ++ EL+SK+A LA+PIR G+PIMLVSEAR++ Sbjct: 7 FDRRMLEALVCPVTQAGLAYDADRQELISKQARLAFPIRDGIPIMLVSEAREL 59 >gi|153825195|ref|ZP_01977862.1| conserved hypothetical protein [Vibrio cholerae MZO-2] gi|183179500|ref|ZP_02957711.1| conserved hypothetical protein [Vibrio cholerae MZO-3] gi|149741174|gb|EDM55225.1| conserved hypothetical protein [Vibrio cholerae MZO-2] gi|183012911|gb|EDT88211.1| conserved hypothetical protein [Vibrio cholerae MZO-3] Length = 59 Score = 89.1 bits (221), Expect = 2e-16, Method: Composition-based stats. Identities = 27/58 (46%), Positives = 39/58 (67%), Gaps = 1/58 (1%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD-DQG 64 +D +LLEI+ CP+ KG LT + EL+ K LAYPI+ G+P++L EAR + D+G Sbjct: 1 MDHRLLEIVACPVCKGKLTYDKDRQELICKLDRLAYPIKEGIPVLLEPEARNMSMDEG 58 >gi|15800778|ref|NP_286792.1| hypothetical protein Z1263 [Escherichia coli O157:H7 EDL933] gi|15830254|ref|NP_309027.1| hypothetical protein ECs1000 [Escherichia coli O157:H7 str. Sakai] gi|16128884|ref|NP_415437.1| conserved protein, UPF0434 family [Escherichia coli str. K-12 substr. MG1655] gi|24112325|ref|NP_706835.1| hypothetical protein SF0913 [Shigella flexneri 2a str. 301] gi|26246943|ref|NP_752983.1| hypothetical protein c1058 [Escherichia coli CFT073] gi|30062451|ref|NP_836622.1| hypothetical protein S0977 [Shigella flexneri 2a str. 2457T] gi|74311474|ref|YP_309893.1| hypothetical protein SSON_0919 [Shigella sonnei Ss046] gi|82544656|ref|YP_408603.1| hypothetical protein SBO_2205 [Shigella boydii Sb227] gi|82777560|ref|YP_403909.1| hypothetical protein SDY_2341 [Shigella dysenteriae Sd197] gi|89107767|ref|AP_001547.1| hypothetical protein [Escherichia coli str. K-12 substr. W3110] gi|91210018|ref|YP_540004.1| hypothetical protein UTI89_C0988 [Escherichia coli UTI89] gi|110641114|ref|YP_668844.1| hypothetical protein ECP_0928 [Escherichia coli 536] gi|110804925|ref|YP_688445.1| hypothetical protein SFV_0918 [Shigella flexneri 5 str. 8401] gi|157155881|ref|YP_001462135.1| hypothetical protein EcE24377A_1015 [Escherichia coli E24377A] gi|157160438|ref|YP_001457756.1| hypothetical protein EcHS_A1024 [Escherichia coli HS] gi|168751180|ref|ZP_02776202.1| conserved hypothetical protein [Escherichia coli O157:H7 str. EC4113] gi|168757009|ref|ZP_02782016.1| conserved hypothetical protein [Escherichia coli O157:H7 str. EC4401] gi|168762947|ref|ZP_02787954.1| conserved hypothetical protein [Escherichia coli O157:H7 str. EC4501] gi|168769912|ref|ZP_02794919.1| conserved hypothetical protein [Escherichia coli O157:H7 str. EC4486] gi|168776231|ref|ZP_02801238.1| conserved hypothetical protein [Escherichia coli O157:H7 str. EC4196] gi|168784114|ref|ZP_02809121.1| conserved hypothetical protein [Escherichia coli O157:H7 str. EC4076] gi|168787346|ref|ZP_02812353.1| conserved hypothetical protein [Escherichia coli O157:H7 str. EC869] gi|168801399|ref|ZP_02826406.1| conserved hypothetical protein [Escherichia coli O157:H7 str. EC508] gi|170020681|ref|YP_001725635.1| hypothetical protein EcolC_2679 [Escherichia coli ATCC 8739] gi|170080575|ref|YP_001729895.1| hypothetical protein ECDH10B_0987 [Escherichia coli str. K-12 substr. DH10B] gi|170680062|ref|YP_001744253.1| hypothetical protein EcSMS35_2203 [Escherichia coli SMS-3-5] gi|170769307|ref|ZP_02903760.1| conserved hypothetical protein [Escherichia albertii TW07627] gi|187730498|ref|YP_001880886.1| hypothetical protein SbBS512_E2407 [Shigella boydii CDC 3083-94] gi|188496028|ref|ZP_03003298.1| conserved hypothetical protein [Escherichia coli 53638] gi|191166970|ref|ZP_03028793.1| conserved hypothetical protein [Escherichia coli B7A] gi|191172059|ref|ZP_03033603.1| conserved hypothetical protein [Escherichia coli F11] gi|193064611|ref|ZP_03045690.1| conserved hypothetical protein [Escherichia coli E22] gi|193070755|ref|ZP_03051690.1| conserved hypothetical protein [Escherichia coli E110019] gi|194428358|ref|ZP_03060899.1| conserved hypothetical protein [Escherichia coli B171] gi|194431566|ref|ZP_03063858.1| conserved hypothetical protein [Shigella dysenteriae 1012] gi|194438733|ref|ZP_03070820.1| conserved hypothetical protein [Escherichia coli 101-1] gi|195940074|ref|ZP_03085456.1| hypothetical protein EscherichcoliO157_27395 [Escherichia coli O157:H7 str. EC4024] gi|208809427|ref|ZP_03251764.1| conserved hypothetical protein [Escherichia coli O157:H7 str. EC4206] gi|208815334|ref|ZP_03256513.1| conserved hypothetical protein [Escherichia coli O157:H7 str. EC4045] gi|208822471|ref|ZP_03262790.1| conserved hypothetical protein [Escherichia coli O157:H7 str. EC4042] gi|209399404|ref|YP_002269589.1| hypothetical protein ECH74115_1078 [Escherichia coli O157:H7 str. EC4115] gi|209918167|ref|YP_002292251.1| hypothetical protein ECSE_0976 [Escherichia coli SE11] gi|215486042|ref|YP_002328473.1| hypothetical protein E2348C_0910 [Escherichia coli O127:H6 str. E2348/69] gi|217326203|ref|ZP_03442287.1| conserved hypothetical protein [Escherichia coli O157:H7 str. TW14588] gi|218553504|ref|YP_002386417.1| hypothetical protein ECIAI1_0958 [Escherichia coli IAI1] gi|218557822|ref|YP_002390735.1| hypothetical protein ECS88_0945 [Escherichia coli S88] gi|218694390|ref|YP_002402057.1| hypothetical protein EC55989_0962 [Escherichia coli 55989] gi|218700564|ref|YP_002408193.1| hypothetical protein ECIAI39_2230 [Escherichia coli IAI39] gi|218704344|ref|YP_002411863.1| hypothetical protein ECUMN_1110 [Escherichia coli UMN026] gi|227884118|ref|ZP_04001923.1| protein of hypothetical function DUF343 [Escherichia coli 83972] gi|237707095|ref|ZP_04537576.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Escherichia sp. 3_2_53FAA] gi|238900175|ref|YP_002925971.1| hypothetical protein BWG_0769 [Escherichia coli BW2952] gi|253774054|ref|YP_003036885.1| hypothetical protein ECBD_2678 [Escherichia coli 'BL21-Gold(DE3)pLysS AG'] gi|254161031|ref|YP_003044139.1| hypothetical protein ECB_00921 [Escherichia coli B str. REL606] gi|254792116|ref|YP_003076953.1| hypothetical protein ECSP_1021 [Escherichia coli O157:H7 str. TW14359] gi|256020955|ref|ZP_05434820.1| hypothetical protein ShiD9_18702 [Shigella sp. D9] gi|256023382|ref|ZP_05437247.1| hypothetical protein E4_08409 [Escherichia sp. 4_1_40B] gi|260843166|ref|YP_003220944.1| hypothetical protein ECO103_0961 [Escherichia coli O103:H2 str. 12009] gi|260854208|ref|YP_003228099.1| hypothetical protein ECO26_1043 [Escherichia coli O26:H11 str. 11368] gi|260867089|ref|YP_003233491.1| hypothetical protein ECO111_0985 [Escherichia coli O111:H- str. 11128] gi|261227420|ref|ZP_05941701.1| hypothetical protein EscherichiacoliO157_22911 [Escherichia coli O157:H7 str. FRIK2000] gi|261256157|ref|ZP_05948690.1| hypothetical protein EscherichiacoliO157EcO_10054 [Escherichia coli O157:H7 str. FRIK966] gi|291281918|ref|YP_003498736.1| hypothetical protein G2583_1152 [Escherichia coli O55:H7 str. CB9615] gi|293404222|ref|ZP_06648216.1| tetraacyldisaccharide 4'-kinase [Escherichia coli FVEC1412] gi|293409294|ref|ZP_06652870.1| conserved hypothetical protein [Escherichia coli B354] gi|293414197|ref|ZP_06656846.1| ycaR protein [Escherichia coli B185] gi|293433214|ref|ZP_06661642.1| ycaR protein [Escherichia coli B088] gi|297516349|ref|ZP_06934735.1| hypothetical protein EcolOP_01847 [Escherichia coli OP50] gi|298380002|ref|ZP_06989607.1| hypothetical protein ECFG_02805 [Escherichia coli FVEC1302] gi|300816979|ref|ZP_07097198.1| hypothetical protein HMPREF9345_02034 [Escherichia coli MS 107-1] gi|300823657|ref|ZP_07103784.1| hypothetical protein HMPREF9346_03524 [Escherichia coli MS 119-7] gi|300901653|ref|ZP_07119713.1| like protein [Escherichia coli MS 198-1] gi|300902924|ref|ZP_07120869.1| like protein [Escherichia coli MS 84-1] gi|300921045|ref|ZP_07137432.1| hypothetical protein HMPREF9540_04681 [Escherichia coli MS 115-1] gi|300925405|ref|ZP_07141290.1| like protein [Escherichia coli MS 182-1] gi|300929612|ref|ZP_07145074.1| hypothetical protein HMPREF9550_01927 [Escherichia coli MS 187-1] gi|300937738|ref|ZP_07152539.1| like protein [Escherichia coli MS 21-1] gi|300949720|ref|ZP_07163699.1| like protein [Escherichia coli MS 116-1] gi|300955435|ref|ZP_07167809.1| hypothetical protein HMPREF9547_01320 [Escherichia coli MS 175-1] gi|300978424|ref|ZP_07174272.1| hypothetical protein HMPREF9531_01705 [Escherichia coli MS 45-1] gi|300983097|ref|ZP_07176441.1| like protein [Escherichia coli MS 200-1] gi|301022411|ref|ZP_07186294.1| like protein [Escherichia coli MS 196-1] gi|301023039|ref|ZP_07186848.1| hypothetical protein HMPREF9534_03176 [Escherichia coli MS 69-1] gi|301047822|ref|ZP_07194874.1| like protein [Escherichia coli MS 185-1] gi|301302474|ref|ZP_07208605.1| hypothetical protein HMPREF9347_01051 [Escherichia coli MS 124-1] gi|301326631|ref|ZP_07219961.1| hypothetical protein HMPREF9535_01575 [Escherichia coli MS 78-1] gi|301643437|ref|ZP_07243485.1| hypothetical protein HMPREF9543_00124 [Escherichia coli MS 146-1] gi|306812630|ref|ZP_07446823.1| hypothetical protein ECNC101_11977 [Escherichia coli NC101] gi|307137546|ref|ZP_07496902.1| hypothetical protein EcolH7_05366 [Escherichia coli H736] gi|307311696|ref|ZP_07591336.1| protein of unknown function DUF343 [Escherichia coli W] gi|309787788|ref|ZP_07682398.1| trm112p-like family protein [Shigella dysenteriae 1617] gi|309795098|ref|ZP_07689518.1| like protein [Escherichia coli MS 145-7] gi|312969017|ref|ZP_07783224.1| trm112p-like family protein [Escherichia coli 2362-75] gi|312971045|ref|ZP_07785224.1| trm112p-like family protein [Escherichia coli 1827-70] gi|331641443|ref|ZP_08342578.1| putative inner membrane protein [Escherichia coli H736] gi|331646182|ref|ZP_08347285.1| putative inner membrane protein [Escherichia coli M605] gi|331651937|ref|ZP_08352956.1| putative inner membrane protein [Escherichia coli M718] gi|331662330|ref|ZP_08363253.1| putative inner membrane protein [Escherichia coli TA143] gi|331667294|ref|ZP_08368159.1| putative inner membrane protein [Escherichia coli TA271] gi|331676705|ref|ZP_08377401.1| putative inner membrane protein [Escherichia coli H591] gi|331682424|ref|ZP_08383043.1| putative inner membrane protein [Escherichia coli H299] gi|332282178|ref|ZP_08394591.1| conserved hypothetical protein [Shigella sp. D9] gi|77416802|sp|P0AAZ9|YCAR_ECO57 RecName: Full=UPF0434 protein ycaR gi|77416803|sp|P0AAZ8|YCAR_ECOL6 RecName: Full=UPF0434 protein ycaR gi|77416804|sp|P0AAZ7|YCAR_ECOLI RecName: Full=UPF0434 protein ycaR gi|77416805|sp|P0AB00|YCAR_SHIFL RecName: Full=UPF0434 protein ycaR gi|122424353|sp|Q1RDU1|YCAR_ECOUT RecName: Full=UPF0434 protein ycaR gi|123146380|sp|Q0SWZ8|YCAR_SHIF8 RecName: Full=UPF0434 protein ycaR gi|123344179|sp|Q0TJD6|YCAR_ECOL5 RecName: Full=UPF0434 protein ycaR gi|123559223|sp|Q31YT3|YCAR_SHIBS RecName: Full=UPF0434 protein ycaR gi|123562146|sp|Q32E37|YCAR_SHIDS RecName: Full=UPF0434 protein ycaR gi|123617586|sp|Q3Z3K4|YCAR_SHISS RecName: Full=UPF0434 protein ycaR gi|166919080|sp|A7ZK06|YCAR_ECO24 RecName: Full=UPF0434 protein ycaR gi|166919081|sp|A7ZYL9|YCAR_ECOHS RecName: Full=UPF0434 protein ycaR gi|189041091|sp|B1IW14|YCAR_ECOLC RecName: Full=UPF0434 protein ycaR gi|226710579|sp|B7MHM6|YCAR_ECO45 RecName: Full=UPF0434 protein ycaR gi|226710580|sp|B5YT51|YCAR_ECO5E RecName: Full=UPF0434 protein ycaR gi|226710581|sp|B7NM57|YCAR_ECO7I RecName: Full=UPF0434 protein ycaR gi|226710582|sp|B7M846|YCAR_ECO8A RecName: Full=UPF0434 protein ycaR gi|226710583|sp|B1X8M1|YCAR_ECODH RecName: Full=UPF0434 protein ycaR gi|226710584|sp|B7NAR6|YCAR_ECOLU RecName: Full=UPF0434 protein ycaR gi|226710585|sp|B6I8Y9|YCAR_ECOSE RecName: Full=UPF0434 protein ycaR gi|226710586|sp|B1LJU6|YCAR_ECOSM RecName: Full=UPF0434 protein ycaR gi|226710596|sp|B2TUG2|YCAR_SHIB3 RecName: Full=UPF0434 protein ycaR gi|254807390|sp|B7UN03|YCAR_ECO27 RecName: Full=UPF0434 protein ycaR gi|254807391|sp|B7LE15|YCAR_ECO55 RecName: Full=UPF0434 protein ycaR gi|259710215|sp|C4ZQ43|YCAR_ECOBW RecName: Full=UPF0434 protein ycaR gi|12514086|gb|AAG55402.1|AE005281_5 orf, hypothetical protein [Escherichia coli O157:H7 str. EDL933] gi|26107343|gb|AAN79526.1|AE016758_130 Protein ycaR [Escherichia coli CFT073] gi|1787146|gb|AAC74003.1| conserved protein, UPF0434 family [Escherichia coli str. K-12 substr. MG1655] gi|4062489|dbj|BAA35663.1| conserved hypothetical protein [Escherichia coli str. K12 substr. W3110] gi|13360459|dbj|BAB34423.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai] gi|24051186|gb|AAN42542.1| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301] gi|30040697|gb|AAP16428.1| hypothetical protein S0977 [Shigella flexneri 2a str. 2457T] gi|73854951|gb|AAZ87658.1| conserved hypothetical protein [Shigella sonnei Ss046] gi|81241708|gb|ABB62418.1| conserved hypothetical protein [Shigella dysenteriae Sd197] gi|81246067|gb|ABB66775.1| conserved hypothetical protein [Shigella boydii Sb227] gi|91071592|gb|ABE06473.1| hypothetical protein UTI89_C0988 [Escherichia coli UTI89] gi|110342706|gb|ABG68943.1| hypothetical protein ECP_0928 [Escherichia coli 536] gi|110614473|gb|ABF03140.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401] gi|157066118|gb|ABV05373.1| conserved hypothetical protein [Escherichia coli HS] gi|157077911|gb|ABV17619.1| conserved hypothetical protein [Escherichia coli E24377A] gi|169755609|gb|ACA78308.1| protein of unknown function DUF343 [Escherichia coli ATCC 8739] gi|169888410|gb|ACB02117.1| conserved protein [Escherichia coli str. K-12 substr. DH10B] gi|170121959|gb|EDS90890.1| conserved hypothetical protein [Escherichia albertii TW07627] gi|170517780|gb|ACB15958.1| conserved hypothetical protein [Escherichia coli SMS-3-5] gi|187427490|gb|ACD06764.1| conserved hypothetical protein [Shigella boydii CDC 3083-94] gi|187768387|gb|EDU32231.1| conserved hypothetical protein [Escherichia coli O157:H7 str. EC4196] gi|188014740|gb|EDU52862.1| conserved hypothetical protein [Escherichia coli O157:H7 str. EC4113] gi|188491227|gb|EDU66330.1| conserved hypothetical protein [Escherichia coli 53638] gi|188998659|gb|EDU67645.1| conserved hypothetical protein [Escherichia coli O157:H7 str. EC4076] gi|189355904|gb|EDU74323.1| conserved hypothetical protein [Escherichia coli O157:H7 str. EC4401] gi|189361121|gb|EDU79540.1| conserved hypothetical protein [Escherichia coli O157:H7 str. EC4486] gi|189366783|gb|EDU85199.1| conserved hypothetical protein [Escherichia coli O157:H7 str. EC4501] gi|189372731|gb|EDU91147.1| conserved hypothetical protein [Escherichia coli O157:H7 str. EC869] gi|189376424|gb|EDU94840.1| conserved hypothetical protein [Escherichia coli O157:H7 str. EC508] gi|190902964|gb|EDV62690.1| conserved hypothetical protein [Escherichia coli B7A] gi|190907586|gb|EDV67181.1| conserved hypothetical protein [Escherichia coli F11] gi|192927668|gb|EDV82283.1| conserved hypothetical protein [Escherichia coli E22] gi|192955948|gb|EDV86416.1| conserved hypothetical protein [Escherichia coli E110019] gi|194413573|gb|EDX29854.1| conserved hypothetical protein [Escherichia coli B171] gi|194420391|gb|EDX36468.1| conserved hypothetical protein [Shigella dysenteriae 1012] gi|194422365|gb|EDX38365.1| conserved hypothetical protein [Escherichia coli 101-1] gi|208729228|gb|EDZ78829.1| conserved hypothetical protein [Escherichia coli O157:H7 str. EC4206] gi|208731982|gb|EDZ80670.1| conserved hypothetical protein [Escherichia coli O157:H7 str. EC4045] gi|208737956|gb|EDZ85639.1| conserved hypothetical protein [Escherichia coli O157:H7 str. EC4042] gi|209160804|gb|ACI38237.1| conserved hypothetical protein [Escherichia coli O157:H7 str. EC4115] gi|209774818|gb|ACI85721.1| hypothetical protein ECs1000 [Escherichia coli] gi|209774820|gb|ACI85722.1| hypothetical protein ECs1000 [Escherichia coli] gi|209774822|gb|ACI85723.1| hypothetical protein ECs1000 [Escherichia coli] gi|209774824|gb|ACI85724.1| hypothetical protein ECs1000 [Escherichia coli] gi|209774826|gb|ACI85725.1| hypothetical protein ECs1000 [Escherichia coli] gi|209911426|dbj|BAG76500.1| conserved hypothetical protein [Escherichia coli SE11] gi|215264114|emb|CAS08458.1| predicted protein [Escherichia coli O127:H6 str. E2348/69] gi|217322424|gb|EEC30848.1| conserved hypothetical protein [Escherichia coli O157:H7 str. TW14588] gi|218351122|emb|CAU96826.1| conserved hypothetical protein [Escherichia coli 55989] gi|218360272|emb|CAQ97822.1| conserved hypothetical protein [Escherichia coli IAI1] gi|218364591|emb|CAR02277.1| conserved hypothetical protein [Escherichia coli S88] gi|218370550|emb|CAR18357.1| conserved hypothetical protein [Escherichia coli IAI39] gi|218431441|emb|CAR12319.1| conserved hypothetical protein [Escherichia coli UMN026] gi|222032648|emb|CAP75387.1| UPF0434 protein ycaR [Escherichia coli LF82] gi|226898305|gb|EEH84564.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Escherichia sp. 3_2_53FAA] gi|227838870|gb|EEJ49336.1| protein of hypothetical function DUF343 [Escherichia coli 83972] gi|238860453|gb|ACR62451.1| conserved protein [Escherichia coli BW2952] gi|242376732|emb|CAQ31445.1| conserved protein [Escherichia coli BL21(DE3)] gi|253325098|gb|ACT29700.1| protein of unknown function DUF343 [Escherichia coli 'BL21-Gold(DE3)pLysS AG'] gi|253972932|gb|ACT38603.1| hypothetical protein ECB_00921 [Escherichia coli B str. REL606] gi|253977146|gb|ACT42816.1| hypothetical protein ECD_00921 [Escherichia coli BL21(DE3)] gi|254591516|gb|ACT70877.1| conserved protein [Escherichia coli O157:H7 str. TW14359] gi|257752857|dbj|BAI24359.1| conserved predicted protein [Escherichia coli O26:H11 str. 11368] gi|257758313|dbj|BAI29810.1| conserved predicted protein [Escherichia coli O103:H2 str. 12009] gi|257763445|dbj|BAI34940.1| conserved predicted protein [Escherichia coli O111:H- str. 11128] gi|260449937|gb|ACX40359.1| protein of unknown function DUF343 [Escherichia coli DH1] gi|281600276|gb|ADA73260.1| protein ycaR [Shigella flexneri 2002017] gi|284920768|emb|CBG33831.1| conserved hypothetical protein [Escherichia coli 042] gi|290761791|gb|ADD55752.1| UPF0434 protein ycaR [Escherichia coli O55:H7 str. CB9615] gi|291324033|gb|EFE63455.1| ycaR protein [Escherichia coli B088] gi|291428808|gb|EFF01833.1| tetraacyldisaccharide 4'-kinase [Escherichia coli FVEC1412] gi|291434255|gb|EFF07228.1| ycaR protein [Escherichia coli B185] gi|291469762|gb|EFF12246.1| conserved hypothetical protein [Escherichia coli B354] gi|294494035|gb|ADE92791.1| conserved hypothetical protein [Escherichia coli IHE3034] gi|298279700|gb|EFI21208.1| hypothetical protein ECFG_02805 [Escherichia coli FVEC1302] gi|299881252|gb|EFI89463.1| like protein [Escherichia coli MS 196-1] gi|300300314|gb|EFJ56699.1| like protein [Escherichia coli MS 185-1] gi|300307001|gb|EFJ61521.1| like protein [Escherichia coli MS 200-1] gi|300317658|gb|EFJ67442.1| hypothetical protein HMPREF9547_01320 [Escherichia coli MS 175-1] gi|300354946|gb|EFJ70816.1| like protein [Escherichia coli MS 198-1] gi|300397245|gb|EFJ80783.1| hypothetical protein HMPREF9534_03176 [Escherichia coli MS 69-1] gi|300405066|gb|EFJ88604.1| like protein [Escherichia coli MS 84-1] gi|300409666|gb|EFJ93204.1| hypothetical protein HMPREF9531_01705 [Escherichia coli MS 45-1] gi|300412036|gb|EFJ95346.1| hypothetical protein HMPREF9540_04681 [Escherichia coli MS 115-1] gi|300418475|gb|EFK01786.1| like protein [Escherichia coli MS 182-1] gi|300450901|gb|EFK14521.1| like protein [Escherichia coli MS 116-1] gi|300457245|gb|EFK20738.1| like protein [Escherichia coli MS 21-1] gi|300462449|gb|EFK25942.1| hypothetical protein HMPREF9550_01927 [Escherichia coli MS 187-1] gi|300523857|gb|EFK44926.1| hypothetical protein HMPREF9346_03524 [Escherichia coli MS 119-7] gi|300530331|gb|EFK51393.1| hypothetical protein HMPREF9345_02034 [Escherichia coli MS 107-1] gi|300842313|gb|EFK70073.1| hypothetical protein HMPREF9347_01051 [Escherichia coli MS 124-1] gi|300846676|gb|EFK74436.1| hypothetical protein HMPREF9535_01575 [Escherichia coli MS 78-1] gi|301078151|gb|EFK92957.1| hypothetical protein HMPREF9543_00124 [Escherichia coli MS 146-1] gi|305853393|gb|EFM53832.1| hypothetical protein ECNC101_11977 [Escherichia coli NC101] gi|306908251|gb|EFN38750.1| protein of unknown function DUF343 [Escherichia coli W] gi|307552756|gb|ADN45531.1| conserved hypothetical protein [Escherichia coli ABU 83972] gi|307627656|gb|ADN71960.1| hypothetical protein UM146_12965 [Escherichia coli UM146] gi|308121402|gb|EFO58664.1| like protein [Escherichia coli MS 145-7] gi|308924187|gb|EFP69684.1| trm112p-like family protein [Shigella dysenteriae 1617] gi|309701193|emb|CBJ00493.1| conserved hypothetical protein [Escherichia coli ETEC H10407] gi|310336806|gb|EFQ01973.1| trm112p-like family protein [Escherichia coli 1827-70] gi|312286419|gb|EFR14332.1| trm112p-like family protein [Escherichia coli 2362-75] gi|312945437|gb|ADR26264.1| hypothetical protein NRG857_04180 [Escherichia coli O83:H1 str. NRG 857C] gi|313650842|gb|EFS15243.1| trm112p-like family protein [Shigella flexneri 2a str. 2457T] gi|315060202|gb|ADT74529.1| conserved hypothetical protein [Escherichia coli W] gi|315135565|dbj|BAJ42724.1| hypothetical protein ECDH1ME8569_0868 [Escherichia coli DH1] gi|315257958|gb|EFU37926.1| conserved hypothetical protein [Escherichia coli MS 85-1] gi|315287556|gb|EFU46962.1| conserved hypothetical protein [Escherichia coli MS 110-3] gi|315291215|gb|EFU50575.1| conserved hypothetical protein [Escherichia coli MS 153-1] gi|315296226|gb|EFU55533.1| conserved hypothetical protein [Escherichia coli MS 16-3] gi|315619111|gb|EFU99691.1| trm112p-like family protein [Escherichia coli 3431] gi|320173258|gb|EFW48467.1| UPF0434 protein YcaR [Shigella dysenteriae CDC 74-1112] gi|320182016|gb|EFW56921.1| UPF0434 protein YcaR [Shigella boydii ATCC 9905] gi|320187453|gb|EFW62143.1| UPF0434 protein YcaR [Shigella flexneri CDC 796-83] gi|320192597|gb|EFW67238.1| UPF0434 protein YcaR [Escherichia coli O157:H7 str. EC1212] gi|320196589|gb|EFW71212.1| UPF0434 protein YcaR [Escherichia coli WV_060327] gi|320202313|gb|EFW76884.1| UPF0434 protein YcaR [Escherichia coli EC4100B] gi|320637785|gb|EFX07577.1| hypothetical protein ECO5101_23310 [Escherichia coli O157:H7 str. G5101] gi|320642910|gb|EFX12111.1| hypothetical protein ECO9389_03061 [Escherichia coli O157:H- str. 493-89] gi|320648367|gb|EFX17022.1| hypothetical protein ECO2687_19171 [Escherichia coli O157:H- str. H 2687] gi|320653683|gb|EFX21757.1| hypothetical protein ECO7815_15498 [Escherichia coli O55:H7 str. 3256-97 TW 07815] gi|320659828|gb|EFX27384.1| hypothetical protein ECO5905_25008 [Escherichia coli O55:H7 str. USDA 5905] gi|320664297|gb|EFX31448.1| hypothetical protein ECOSU61_01663 [Escherichia coli O157:H7 str. LSU-61] gi|323157196|gb|EFZ43319.1| trm112p-like family protein [Escherichia coli EPECa14] gi|323159544|gb|EFZ45524.1| trm112p-like family protein [Escherichia coli E128010] gi|323165388|gb|EFZ51175.1| trm112p-like family protein [Shigella sonnei 53G] gi|323174982|gb|EFZ60597.1| trm112p-like family protein [Escherichia coli LT-68] gi|323175460|gb|EFZ61055.1| trm112p-like family protein [Escherichia coli 1180] gi|323185377|gb|EFZ70741.1| trm112p-like family protein [Escherichia coli 1357] gi|323379238|gb|ADX51506.1| protein of unknown function DUF343 [Escherichia coli KO11] gi|323938023|gb|EGB34285.1| Trm112p protein [Escherichia coli E1520] gi|323942833|gb|EGB38998.1| Trm112p protein [Escherichia coli E482] gi|323947294|gb|EGB43302.1| Trm112p protein [Escherichia coli H120] gi|323953375|gb|EGB49241.1| Trm112p protein [Escherichia coli H252] gi|323958222|gb|EGB53931.1| Trm112p protein [Escherichia coli H263] gi|323962909|gb|EGB58483.1| Trm112p protein [Escherichia coli H489] gi|323967164|gb|EGB62588.1| Trm112p protein [Escherichia coli M863] gi|323973208|gb|EGB68400.1| Trm112p protein [Escherichia coli TA007] gi|323976696|gb|EGB71784.1| Trm112p protein [Escherichia coli TW10509] gi|324009862|gb|EGB79081.1| hypothetical protein HMPREF9532_00413 [Escherichia coli MS 57-2] gi|324012944|gb|EGB82163.1| hypothetical protein HMPREF9533_03012 [Escherichia coli MS 60-1] gi|324019074|gb|EGB88293.1| hypothetical protein HMPREF9542_02269 [Escherichia coli MS 117-3] gi|324117218|gb|EGC11126.1| Trm112p protein [Escherichia coli E1167] gi|326338188|gb|EGD62017.1| UPF0434 protein YcaR [Escherichia coli O157:H7 str. 1125] gi|326346165|gb|EGD69903.1| UPF0434 protein YcaR [Escherichia coli O157:H7 str. 1044] gi|327253707|gb|EGE65336.1| trm112p-like family protein [Escherichia coli STEC_7v] gi|330910697|gb|EGH39207.1| UPF0434 protein YcaR [Escherichia coli AA86] gi|331038241|gb|EGI10461.1| putative inner membrane protein [Escherichia coli H736] gi|331044934|gb|EGI17061.1| putative inner membrane protein [Escherichia coli M605] gi|331050215|gb|EGI22273.1| putative inner membrane protein [Escherichia coli M718] gi|331060752|gb|EGI32716.1| putative inner membrane protein [Escherichia coli TA143] gi|331065650|gb|EGI37543.1| putative inner membrane protein [Escherichia coli TA271] gi|331075394|gb|EGI46692.1| putative inner membrane protein [Escherichia coli H591] gi|331080055|gb|EGI51234.1| putative inner membrane protein [Escherichia coli H299] gi|332091378|gb|EGI96465.1| trm112p-like family protein [Shigella dysenteriae 155-74] gi|332093488|gb|EGI98546.1| trm112p-like family protein [Shigella boydii 3594-74] gi|332104530|gb|EGJ07876.1| conserved hypothetical protein [Shigella sp. D9] gi|332342359|gb|AEE55693.1| conserved hypothetical protein [Escherichia coli UMNK88] gi|332759004|gb|EGJ89314.1| trm112p-like family protein [Shigella flexneri 4343-70] gi|332760107|gb|EGJ90405.1| trm112p-like family protein [Shigella flexneri 2747-71] gi|332762688|gb|EGJ92951.1| trm112p-like family protein [Shigella flexneri K-671] gi|332767866|gb|EGJ98056.1| hypothetical protein SF293071_1097 [Shigella flexneri 2930-71] gi|333006360|gb|EGK25868.1| trm112p-like family protein [Shigella flexneri VA-6] gi|333006963|gb|EGK26458.1| trm112p-like family protein [Shigella flexneri K-218] gi|333008901|gb|EGK28361.1| trm112p-like family protein [Shigella flexneri K-272] gi|333020010|gb|EGK39281.1| trm112p-like family protein [Shigella flexneri K-304] gi|333020211|gb|EGK39481.1| trm112p-like family protein [Shigella flexneri K-227] Length = 60 Score = 89.1 bits (221), Expect = 2e-16, Method: Composition-based stats. Identities = 23/56 (41%), Positives = 36/56 (64%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ G L E EL+ K +LA+P+R G+P++L +EAR + Sbjct: 1 MDHRLLEIIACPVCNGKLWYNQEKQELICKLDNLAFPLRDGIPVLLETEARVLTAD 56 >gi|157375959|ref|YP_001474559.1| hypothetical protein Ssed_2824 [Shewanella sediminis HAW-EB3] gi|189039783|sp|A8FX58|Y2824_SHESH RecName: Full=UPF0434 protein Ssed_2824 gi|157318333|gb|ABV37431.1| protein of unknown function DUF343 [Shewanella sediminis HAW-EB3] Length = 60 Score = 89.1 bits (221), Expect = 2e-16, Method: Composition-based stats. Identities = 21/57 (36%), Positives = 33/57 (57%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 + D +LLEI+ CP+ KG L L+ K LAYPI G+P++L ++A + + Sbjct: 1 MSFDKKLLEIVACPVCKGKLDYEKSSQRLICKADHLAYPINDGIPVLLENKAERWQE 57 >gi|261210520|ref|ZP_05924813.1| hypothetical protein VCJ_000772 [Vibrio sp. RC341] gi|260840305|gb|EEX66876.1| hypothetical protein VCJ_000772 [Vibrio sp. RC341] Length = 59 Score = 89.1 bits (221), Expect = 2e-16, Method: Composition-based stats. Identities = 27/58 (46%), Positives = 40/58 (68%), Gaps = 1/58 (1%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD-DQG 64 +D +LLEI+ CP+ KG LT + EL+ K LAYPI+ G+P++L EAR ++ D+G Sbjct: 1 MDHRLLEIVACPVCKGKLTYDKDRQELICKLDRLAYPIKEGIPVLLEPEARSMNMDEG 58 >gi|293606242|ref|ZP_06688605.1| tetraacyldisaccharide 4'-kinase [Achromobacter piechaudii ATCC 43553] gi|292815389|gb|EFF74507.1| tetraacyldisaccharide 4'-kinase [Achromobacter piechaudii ATCC 43553] Length = 59 Score = 89.1 bits (221), Expect = 2e-16, Method: Composition-based stats. Identities = 28/55 (50%), Positives = 39/55 (70%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 ++ +LL+ILVCPL KG L E EL+ + LA+PIR G+P+ML SEAR +D+ Sbjct: 1 MESRLLDILVCPLCKGRLEHDREQAELVCRADRLAFPIRDGIPVMLESEARVLDE 55 >gi|226940031|ref|YP_002795104.1| hypothetical protein LHK_01103 [Laribacter hongkongensis HLHK9] gi|254799937|sp|C1D6I8|Y1103_LARHH RecName: Full=UPF0434 protein LHK_01103 gi|226714957|gb|ACO74095.1| hypothetical protein LHK_01103 [Laribacter hongkongensis HLHK9] Length = 59 Score = 89.1 bits (221), Expect = 2e-16, Method: Composition-based stats. Identities = 26/56 (46%), Positives = 37/56 (66%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEILVCP+ KG L E EL+ K LA+P+R +P+ML S+AR++ Sbjct: 1 MDAKLLEILVCPICKGPLVYKKEAGELVCKGDRLAFPVRDDIPVMLESDARELAAD 56 >gi|332092555|gb|EGI97628.1| trm112p-like family protein [Shigella boydii 5216-82] Length = 60 Score = 89.1 bits (221), Expect = 2e-16, Method: Composition-based stats. Identities = 23/56 (41%), Positives = 36/56 (64%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ G L E EL+ K +LA+P+R G+P++L +EAR + Sbjct: 1 MDHRLLEIIACPVCNGKLWYNHEKQELICKLDNLAFPLRDGIPVLLETEARVLTAD 56 >gi|254508521|ref|ZP_05120639.1| tetraacyldisaccharide 4'-kinase (Lipid A 4'-kinase) [Vibrio parahaemolyticus 16] gi|219548546|gb|EED25553.1| tetraacyldisaccharide 4'-kinase (Lipid A 4'-kinase) [Vibrio parahaemolyticus 16] Length = 59 Score = 89.1 bits (221), Expect = 2e-16, Method: Composition-based stats. Identities = 28/58 (48%), Positives = 40/58 (68%), Gaps = 1/58 (1%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD-DQG 64 +D +LLEI+ CP+ KG LT + EL+ K LAYPI+ G+P++L EARQ+ D+G Sbjct: 1 MDHRLLEIVACPVCKGKLTFDKDKQELICKLDRLAYPIKEGIPVLLEPEARQMSMDEG 58 >gi|119385099|ref|YP_916155.1| hypothetical protein Pden_2369 [Paracoccus denitrificans PD1222] gi|148841350|sp|A1B4L5|Y2369_PARDP RecName: Full=UPF0434 protein Pden_2369 gi|119374866|gb|ABL70459.1| protein of unknown function DUF343 [Paracoccus denitrificans PD1222] Length = 63 Score = 89.1 bits (221), Expect = 2e-16, Method: Composition-based stats. Identities = 28/52 (53%), Positives = 38/52 (73%) Query: 9 DPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 D +LE LVCP+T L +E EL+S+ A LA+PIR G+PIML++EARQ+ Sbjct: 10 DRHMLEALVCPVTHATLRYDAEAQELISEAAGLAFPIRGGIPIMLLNEARQI 61 >gi|288941219|ref|YP_003443459.1| hypothetical protein Alvin_1494 [Allochromatium vinosum DSM 180] gi|288896591|gb|ADC62427.1| protein of unknown function DUF343 [Allochromatium vinosum DSM 180] Length = 63 Score = 89.1 bits (221), Expect = 2e-16, Method: Composition-based stats. Identities = 30/57 (52%), Positives = 38/57 (66%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LL+ILVCP+TKG L L EL+S A LAYPIR +PIML EAR++ Sbjct: 1 MLDKKLLDILVCPVTKGPLILDKARGELISLSAQLAYPIRDDIPIMLEDEARRLTLD 57 >gi|212218916|ref|YP_002305703.1| conserved cytosolic protein [Coxiella burnetii CbuK_Q154] gi|226734133|sp|B6J8F9|Y1382_COXB1 RecName: Full=UPF0434 protein CbuK_1382 gi|212013178|gb|ACJ20558.1| conserved cytosolic protein [Coxiella burnetii CbuK_Q154] Length = 56 Score = 89.1 bits (221), Expect = 2e-16, Method: Composition-based stats. Identities = 23/53 (43%), Positives = 32/53 (60%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 +D +LLEIL CP+ KG L + EL+ + LAYPI G+P+ML R + Sbjct: 1 MDRRLLEILACPICKGKLVYSQDEQELICRFDKLAYPIHDGIPVMLPDSTRPL 53 >gi|323190737|gb|EFZ76006.1| trm112p-like family protein [Escherichia coli RN587/1] Length = 60 Score = 88.8 bits (220), Expect = 2e-16, Method: Composition-based stats. Identities = 22/56 (39%), Positives = 36/56 (64%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ G L + EL+ K +LA+P+R G+P++L +EAR + Sbjct: 1 MDHRLLEIIACPVCNGKLWYNQQKQELICKLDNLAFPLRDGIPVLLETEARVLTAD 56 >gi|46205390|ref|ZP_00048599.2| COG2835: Uncharacterized conserved protein [Magnetospirillum magnetotacticum MS-1] Length = 68 Score = 88.8 bits (220), Expect = 2e-16, Method: Composition-based stats. Identities = 31/55 (56%), Positives = 41/55 (74%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 +DP+LLE+LVCPLTK +L + EL+S+ A LAYPIR G+PIML EAR + + Sbjct: 14 VDPRLLELLVCPLTKESLEYDAAREELISRSAKLAYPIRDGIPIMLPEEARSLAE 68 >gi|82702156|ref|YP_411722.1| hypothetical protein Nmul_A1027 [Nitrosospira multiformis ATCC 25196] gi|123544772|sp|Q2YA91|Y1027_NITMU RecName: Full=UPF0434 protein Nmul_A1027 gi|82410221|gb|ABB74330.1| Protein of unknown function DUF343 [Nitrosospira multiformis ATCC 25196] Length = 61 Score = 88.8 bits (220), Expect = 2e-16, Method: Composition-based stats. Identities = 28/56 (50%), Positives = 37/56 (66%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +DP+LL+ILVCPL K L EL+ K LA+PIR G+PIML EAR++ + Sbjct: 1 MDPKLLDILVCPLCKSPLLYRKPENELICKADRLAFPIRDGIPIMLEDEARRLPVE 56 >gi|146278928|ref|YP_001169087.1| hypothetical protein Rsph17025_2896 [Rhodobacter sphaeroides ATCC 17025] gi|166988544|sp|A4WWL8|Y2896_RHOS5 RecName: Full=UPF0434 protein Rsph17025_2896 gi|145557169|gb|ABP71782.1| protein of unknown function DUF343 [Rhodobacter sphaeroides ATCC 17025] Length = 59 Score = 88.8 bits (220), Expect = 2e-16, Method: Composition-based stats. Identities = 30/60 (50%), Positives = 45/60 (75%), Gaps = 1/60 (1%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 M E+ D ++LE LVCP+++ L+ +E EL+S++A LA+PIR G+PIMLVSEAR++ Sbjct: 1 MTESP-QFDRRMLEALVCPVSQSGLSYDAERQELVSRQARLAFPIRDGIPIMLVSEAREL 59 >gi|323496032|ref|ZP_08101095.1| hypothetical protein VISI1226_19132 [Vibrio sinaloensis DSM 21326] gi|323318923|gb|EGA71871.1| hypothetical protein VISI1226_19132 [Vibrio sinaloensis DSM 21326] Length = 59 Score = 88.8 bits (220), Expect = 2e-16, Method: Composition-based stats. Identities = 27/58 (46%), Positives = 40/58 (68%), Gaps = 1/58 (1%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD-DQG 64 +D +LLEI+ CP+ KG LT + EL+ K LAYPI+ G+P++L EAR++ D+G Sbjct: 1 MDHRLLEIVACPVCKGKLTFDKDKQELICKLDRLAYPIKEGIPVLLEPEARKMSMDEG 58 >gi|114563556|ref|YP_751069.1| hypothetical protein Sfri_2386 [Shewanella frigidimarina NCIMB 400] gi|122299443|sp|Q080T4|Y2386_SHEFN RecName: Full=UPF0434 protein Sfri_2386 gi|114334849|gb|ABI72231.1| protein of unknown function DUF343 [Shewanella frigidimarina NCIMB 400] Length = 58 Score = 88.8 bits (220), Expect = 2e-16, Method: Composition-based stats. Identities = 22/58 (37%), Positives = 33/58 (56%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 D +LLEI+ CP+ KG L E +L+ K LAYPI G+P++L + A + + Sbjct: 1 MAFDKKLLEIVACPVCKGKLDYDKESQQLICKFDKLAYPITEGIPVLLENRATAIVTE 58 >gi|149192129|ref|ZP_01870351.1| hypothetical protein VSAK1_03952 [Vibrio shilonii AK1] gi|260776186|ref|ZP_05885081.1| hypothetical protein VIC_001570 [Vibrio coralliilyticus ATCC BAA-450] gi|148834032|gb|EDL51047.1| hypothetical protein VSAK1_03952 [Vibrio shilonii AK1] gi|260607409|gb|EEX33674.1| hypothetical protein VIC_001570 [Vibrio coralliilyticus ATCC BAA-450] Length = 59 Score = 88.8 bits (220), Expect = 2e-16, Method: Composition-based stats. Identities = 26/56 (46%), Positives = 38/56 (67%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ KG LT + EL+ K LAYPI+ G+P++L EARQ+ + Sbjct: 1 MDHRLLEIVACPVCKGKLTFDKDKQELICKLDRLAYPIKEGIPVLLEPEARQMSME 56 >gi|294678848|ref|YP_003579463.1| hypothetical protein RCAP_rcc03332 [Rhodobacter capsulatus SB 1003] gi|294477668|gb|ADE87056.1| protein of unknown function DUF343 [Rhodobacter capsulatus SB 1003] Length = 70 Score = 88.8 bits (220), Expect = 2e-16, Method: Composition-based stats. Identities = 31/54 (57%), Positives = 40/54 (74%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 D ++LE LVCPLT+ L +E EL+SK A+LA+PIR G+PIMLV EAR +D Sbjct: 17 FDRRMLEALVCPLTQAPLHYDAERQELVSKAAALAFPIRRGIPIMLVDEARPLD 70 >gi|126734518|ref|ZP_01750264.1| hypothetical protein RCCS2_11614 [Roseobacter sp. CCS2] gi|126715073|gb|EBA11938.1| hypothetical protein RCCS2_11614 [Roseobacter sp. CCS2] Length = 59 Score = 88.8 bits (220), Expect = 2e-16, Method: Composition-based stats. Identities = 32/61 (52%), Positives = 45/61 (73%), Gaps = 2/61 (3%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 M ET DP++LE LVCP+T+ LT +E EL+SK +A+PIR+G+P+MLV EAR++ Sbjct: 1 MSET--AFDPKMLEALVCPMTQDTLTYDAESQELVSKAGKMAFPIRNGIPVMLVDEARKL 58 Query: 61 D 61 D Sbjct: 59 D 59 >gi|323492530|ref|ZP_08097678.1| hypothetical protein VIBR0546_15876 [Vibrio brasiliensis LMG 20546] gi|323313317|gb|EGA66433.1| hypothetical protein VIBR0546_15876 [Vibrio brasiliensis LMG 20546] Length = 59 Score = 88.8 bits (220), Expect = 2e-16, Method: Composition-based stats. Identities = 26/58 (44%), Positives = 38/58 (65%), Gaps = 1/58 (1%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD-DQG 64 +D +LLEI+ CP+ KG L + EL+ K LAYPI+ G+P++L EAR + D+G Sbjct: 1 MDHRLLEIVACPVCKGKLAFDKDKQELVCKLDRLAYPIKEGIPVLLEPEARNISMDEG 58 >gi|212635087|ref|YP_002311612.1| hypothetical protein swp_2279 [Shewanella piezotolerans WP3] gi|226701239|sp|B8CNQ6|Y2279_SHEPW RecName: Full=UPF0434 protein swp_2279 gi|212556571|gb|ACJ29025.1| Conserved hypothetical protein [Shewanella piezotolerans WP3] Length = 57 Score = 88.8 bits (220), Expect = 2e-16, Method: Composition-based stats. Identities = 19/57 (33%), Positives = 34/57 (59%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 D +LL+I+ CP+ KG L + +L+ K +AYPI G+P++L ++A + + Sbjct: 1 MAFDKKLLDIVACPVCKGKLEYNKQDNQLICKFDKIAYPINDGIPVLLENKAEPLAE 57 >gi|304394430|ref|ZP_07376353.1| tetraacyldisaccharide 4'-kinase [Ahrensia sp. R2A130] gi|303293870|gb|EFL88247.1| tetraacyldisaccharide 4'-kinase [Ahrensia sp. R2A130] Length = 85 Score = 88.8 bits (220), Expect = 2e-16, Method: Composition-based stats. Identities = 28/62 (45%), Positives = 41/62 (66%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 MR ++ ++LE+LVCP + G+L EL K++ LAYP+R GVPI+L SEAR + Sbjct: 24 MRGEAPSLSVKMLELLVCPRSHGSLVYDETAQELTCKRSLLAYPVRDGVPILLESEARAI 83 Query: 61 DD 62 +D Sbjct: 84 ED 85 >gi|227505063|ref|ZP_03935112.1| conserved hypothetical protein [Corynebacterium striatum ATCC 6940] gi|227198351|gb|EEI78399.1| conserved hypothetical protein [Corynebacterium striatum ATCC 6940] Length = 66 Score = 88.8 bits (220), Expect = 2e-16, Method: Composition-based stats. Identities = 27/54 (50%), Positives = 37/54 (68%) Query: 4 TIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEA 57 ++DPQLLEILVCP KG LT I + L++++ +AYPI G+P+MLV A Sbjct: 2 NAMSLDPQLLEILVCPQDKGPLTYIEDKEVLVNERLGVAYPIEDGIPVMLVDHA 55 >gi|262171157|ref|ZP_06038835.1| hypothetical protein VII_001973 [Vibrio mimicus MB-451] gi|261892233|gb|EEY38219.1| hypothetical protein VII_001973 [Vibrio mimicus MB-451] Length = 59 Score = 88.8 bits (220), Expect = 2e-16, Method: Composition-based stats. Identities = 27/58 (46%), Positives = 39/58 (67%), Gaps = 1/58 (1%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD-DQG 64 +D +LLEI+ CP+ KG LT + EL+ K LAYPI+ G+P++L EAR + D+G Sbjct: 1 MDHRLLEIVACPVCKGKLTYDKDRQELICKLDRLAYPIKEGIPVLLEPEARGMSMDEG 58 >gi|253688158|ref|YP_003017348.1| hypothetical protein PC1_1771 [Pectobacterium carotovorum subsp. carotovorum PC1] gi|259646482|sp|C6DFA3|Y1771_PECCP RecName: Full=UPF0434 protein PC1_1771 gi|251754736|gb|ACT12812.1| protein of unknown function DUF343 [Pectobacterium carotovorum subsp. carotovorum PC1] Length = 60 Score = 88.8 bits (220), Expect = 2e-16, Method: Composition-based stats. Identities = 24/53 (45%), Positives = 36/53 (67%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 +D +LLEI+ CP+ G L E EL+ K LAYP+R G+P++L +EAR++ Sbjct: 1 MDHRLLEIVACPVCNGRLYFNKEKLELICKVDGLAYPVRDGIPVLLENEARKL 53 >gi|297562689|ref|YP_003681663.1| hypothetical protein Ndas_3759 [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111] gi|296847137|gb|ADH69157.1| protein of unknown function DUF343 [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111] Length = 58 Score = 88.8 bits (220), Expect = 2e-16, Method: Composition-based stats. Identities = 26/53 (49%), Positives = 36/53 (67%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 ID LLEIL CP ++ L E EL+ ++ LAYPIR G+P++LV EAR++ Sbjct: 5 IDGWLLEILACPQSQAPLRHDPETDELVCDESGLAYPIRDGIPVLLVDEARKI 57 >gi|167648543|ref|YP_001686206.1| hypothetical protein Caul_4588 [Caulobacter sp. K31] gi|167350973|gb|ABZ73708.1| protein of unknown function DUF343 [Caulobacter sp. K31] Length = 66 Score = 88.4 bits (219), Expect = 3e-16, Method: Composition-based stats. Identities = 29/52 (55%), Positives = 36/52 (69%) Query: 11 QLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 +LLE+LVCP+T+ L EL+S A LAYPIR GVPIML EAR ++D Sbjct: 15 RLLEVLVCPVTRAPLFYDRARGELISNAAKLAYPIRDGVPIMLPEEARTLED 66 >gi|49475983|ref|YP_034024.1| hypothetical protein BH12860 [Bartonella henselae str. Houston-1] gi|81647675|sp|Q6G2E7|Y1286_BARHE RecName: Full=UPF0434 protein BH12860 gi|49238791|emb|CAF28060.1| hypothetical protein BH12860 [Bartonella henselae str. Houston-1] Length = 65 Score = 88.4 bits (219), Expect = 3e-16, Method: Composition-based stats. Identities = 33/59 (55%), Positives = 43/59 (72%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQG 64 DP++LE+LVCP+T G L+L + EL+S +A LAYPIR GVPIML SEAR + + G Sbjct: 1 MITDPKMLELLVCPITGGTLSLNRKTQELISLEAKLAYPIRDGVPIMLASEARPLQNNG 59 >gi|83950917|ref|ZP_00959650.1| hypothetical protein ISM_07445 [Roseovarius nubinhibens ISM] gi|83838816|gb|EAP78112.1| hypothetical protein ISM_07445 [Roseovarius nubinhibens ISM] Length = 64 Score = 88.4 bits (219), Expect = 3e-16, Method: Composition-based stats. Identities = 25/55 (45%), Positives = 40/55 (72%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 + D ++LE L+CP + L +E EL+S+++ LAYPIR+G+P++LV EAR +D Sbjct: 9 SFDRRMLEALICPRSHAVLEYDAEAQELISRQSGLAYPIRNGIPVLLVDEARVLD 63 >gi|242239634|ref|YP_002987815.1| hypothetical protein Dd703_2206 [Dickeya dadantii Ech703] gi|242131691|gb|ACS85993.1| protein of unknown function DUF343 [Dickeya dadantii Ech703] Length = 60 Score = 88.4 bits (219), Expect = 3e-16, Method: Composition-based stats. Identities = 24/56 (42%), Positives = 35/56 (62%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ G L E EL+ K LAYP+R G+P++L +EAR + Sbjct: 1 MDHRLLEIVACPVCTGRLIFNKEKQELICKADRLAYPLRDGIPVLLETEARTLAPD 56 >gi|311107325|ref|YP_003980178.1| trm112p-like family protein [Achromobacter xylosoxidans A8] gi|310762014|gb|ADP17463.1| trm112p-like family protein [Achromobacter xylosoxidans A8] Length = 60 Score = 88.4 bits (219), Expect = 3e-16, Method: Composition-based stats. Identities = 27/55 (49%), Positives = 39/55 (70%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 ++ +LL+ILVCPL KG L + EL+ + LA+P+R G+P+ML SEAR +DD Sbjct: 1 MESRLLDILVCPLCKGRLEHDRQQAELVCRADRLAFPVRDGIPVMLESEARALDD 55 >gi|224826275|ref|ZP_03699377.1| protein of unknown function DUF343 [Lutiella nitroferrum 2002] gi|224601376|gb|EEG07557.1| protein of unknown function DUF343 [Lutiella nitroferrum 2002] Length = 60 Score = 88.4 bits (219), Expect = 3e-16, Method: Composition-based stats. Identities = 27/56 (48%), Positives = 37/56 (66%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D + L+ILVCPL KG L EL+ K LA+PIR G+P+ML SEAR++ + Sbjct: 1 MDAKFLDILVCPLCKGPLVYRKAEQELVCKGDRLAFPIRDGIPMMLESEARELPAE 56 >gi|332162198|ref|YP_004298775.1| hypothetical protein YE105_C2576 [Yersinia enterocolitica subsp. palearctica 105.5R(r)] gi|318606253|emb|CBY27751.1| upf0434 protein YcaR [Yersinia enterocolitica subsp. palearctica Y11] gi|325666428|gb|ADZ43072.1| hypothetical protein YE105_C2576 [Yersinia enterocolitica subsp. palearctica 105.5R(r)] gi|330862905|emb|CBX73041.1| UPF0434 protein YE1549 [Yersinia enterocolitica W22703] Length = 60 Score = 88.4 bits (219), Expect = 3e-16, Method: Composition-based stats. Identities = 24/56 (42%), Positives = 36/56 (64%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ G L E EL+ K +LAYP+R G+P++L +EAR + Sbjct: 1 MDHRLLEIVACPVCNGKLCFNKENLELVCKADNLAYPVRDGIPVLLENEARPLSID 56 >gi|304320325|ref|YP_003853968.1| hypothetical protein PB2503_03757 [Parvularcula bermudensis HTCC2503] gi|303299227|gb|ADM08826.1| hypothetical protein PB2503_03757 [Parvularcula bermudensis HTCC2503] Length = 63 Score = 88.4 bits (219), Expect = 3e-16, Method: Composition-based stats. Identities = 32/54 (59%), Positives = 44/54 (81%) Query: 9 DPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 DP+LL +LVCP+++G L+ E EL+S KA LAYPIR+G+PIML +EAR++DD Sbjct: 8 DPKLLTLLVCPVSRGPLSYDKEMGELVSAKARLAYPIRNGIPIMLEAEARRLDD 61 >gi|146386708|pdb|2PK7|A Chain A, Crystal Structure Of The Q4kft4_psef5 Protein From Pseudomonas Fluorescens. Nesg Target Plr1 gi|146386709|pdb|2PK7|B Chain B, Crystal Structure Of The Q4kft4_psef5 Protein From Pseudomonas Fluorescens. Nesg Target Plr1 Length = 69 Score = 88.4 bits (219), Expect = 3e-16, Method: Composition-based stats. Identities = 30/55 (54%), Positives = 40/55 (72%) Query: 9 DPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 D +LL+IL CP+ KG L L ++ TEL+SK A LAYPIR G+P+ L SEAR + + Sbjct: 2 DTKLLDILACPICKGPLKLSADKTELISKGAGLAYPIRDGIPVXLESEARTLTTE 56 >gi|117619512|ref|YP_857281.1| hypothetical protein AHA_2776 [Aeromonas hydrophila subsp. hydrophila ATCC 7966] gi|148841362|sp|A0KLY0|Y2776_AERHH RecName: Full=UPF0434 protein AHA_2776 gi|117560919|gb|ABK37867.1| conserved domain protein [Aeromonas hydrophila subsp. hydrophila ATCC 7966] Length = 62 Score = 88.4 bits (219), Expect = 3e-16, Method: Composition-based stats. Identities = 20/58 (34%), Positives = 33/58 (56%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LL+I+ CP+ KG L EL+ + LAYP+ G+P++L + AR + Sbjct: 1 MALDIKLLDIIACPVCKGKLHYNKAVHELVCRFDKLAYPLEEGIPVLLENRARPLSSD 58 >gi|304312859|ref|YP_003812457.1| Protein of unknown function DUF343 [gamma proteobacterium HdN1] gi|301798592|emb|CBL46822.1| Protein of unknown function DUF343 [gamma proteobacterium HdN1] Length = 68 Score = 88.4 bits (219), Expect = 3e-16, Method: Composition-based stats. Identities = 28/57 (49%), Positives = 40/57 (70%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLE+LVCP++K L E EL+S ++LAYPIR+ +PIML SEAR + + Sbjct: 1 MLDKKLLELLVCPISKTPLEYDREHNELISLSSNLAYPIRNDIPIMLESEARALTLE 57 >gi|197284615|ref|YP_002150487.1| hypothetical protein PMI0721 [Proteus mirabilis HI4320] gi|227356798|ref|ZP_03841183.1| protein of hypothetical function DUF343 [Proteus mirabilis ATCC 29906] gi|226708042|sp|B4ET33|Y721_PROMH RecName: Full=UPF0434 protein PMI0721 gi|194682102|emb|CAR41687.1| conserved hypothetical protein [Proteus mirabilis HI4320] gi|227163088|gb|EEI48023.1| protein of hypothetical function DUF343 [Proteus mirabilis ATCC 29906] Length = 59 Score = 88.4 bits (219), Expect = 3e-16, Method: Composition-based stats. Identities = 23/56 (41%), Positives = 37/56 (66%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ G L E +EL+ K LAYP+R +P++L +EAR++ + Sbjct: 1 MDHRLLEIIACPVCHGKLIFDKENSELICKIDHLAYPVRDNIPVLLENEARELSLE 56 >gi|73666764|ref|YP_302780.1| hypothetical protein Ecaj_0131 [Ehrlichia canis str. Jake] gi|123615126|sp|Q3YSX3|Y131_EHRCJ RecName: Full=UPF0434 protein Ecaj_0131 gi|72393905|gb|AAZ68182.1| protein of unknown function DUF343 [Ehrlichia canis str. Jake] Length = 56 Score = 88.4 bits (219), Expect = 3e-16, Method: Composition-based stats. Identities = 31/55 (56%), Positives = 42/55 (76%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 ID ++LEILVCPLTK L + EL+S+KA LA+PIR G+PIML+ EAR+++ Sbjct: 1 MIDHRILEILVCPLTKDKLQYNKDTNELISQKAKLAFPIRDGIPIMLIDEARKLE 55 >gi|206576537|ref|YP_002239435.1| hypothetical protein KPK_3615 [Klebsiella pneumoniae 342] gi|288936285|ref|YP_003440344.1| hypothetical protein Kvar_3432 [Klebsiella variicola At-22] gi|226705811|sp|B5XY80|Y3615_KLEP3 RecName: Full=UPF0434 protein KPK_3615 gi|206565595|gb|ACI07371.1| conserved hypothetical protein [Klebsiella pneumoniae 342] gi|288890994|gb|ADC59312.1| protein of unknown function DUF343 [Klebsiella variicola At-22] Length = 60 Score = 88.4 bits (219), Expect = 3e-16, Method: Composition-based stats. Identities = 23/56 (41%), Positives = 37/56 (66%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ G L + EL+ K SLA+P+R G+P++L +EAR + + Sbjct: 1 MDHRLLEIIACPVCNGKLYYSQDKQELICKLDSLAFPLRDGIPVLLETEARALTVE 56 >gi|49474554|ref|YP_032596.1| hypothetical protein BQ10150 [Bartonella quintana str. Toulouse] gi|81646873|sp|Q6FYZ3|Y1015_BARQU RecName: Full=UPF0434 protein BQ10150 gi|49240058|emb|CAF26483.1| hypothetical protein BQ10150 [Bartonella quintana str. Toulouse] Length = 65 Score = 88.0 bits (218), Expect = 4e-16, Method: Composition-based stats. Identities = 33/55 (60%), Positives = 41/55 (74%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 DP++LE+LVCP+T G L+L + EL+S KA LAYPIR GVPIML SEAR + Sbjct: 1 MITDPKMLELLVCPITGGTLSLNRKTQELISFKAKLAYPIRDGVPIMLASEARPL 55 >gi|329847423|ref|ZP_08262451.1| trm112p-like family protein [Asticcacaulis biprosthecum C19] gi|328842486|gb|EGF92055.1| trm112p-like family protein [Asticcacaulis biprosthecum C19] Length = 71 Score = 88.0 bits (218), Expect = 4e-16, Method: Composition-based stats. Identities = 33/62 (53%), Positives = 43/62 (69%) Query: 2 RETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 + I IDP+LLE LVCP+T+ LT EL+S A LA+P+RSGVPIMLV +AR+ + Sbjct: 8 PKPILEIDPRLLEALVCPVTRRPLTYDKAAQELVSPTAGLAFPVRSGVPIMLVDQARKFE 67 Query: 62 DQ 63 Q Sbjct: 68 PQ 69 >gi|237730880|ref|ZP_04561361.1| ycaR [Citrobacter sp. 30_2] gi|283833792|ref|ZP_06353533.1| tetraacyldisaccharide 4'-kinase [Citrobacter youngae ATCC 29220] gi|226906419|gb|EEH92337.1| ycaR [Citrobacter sp. 30_2] gi|291070457|gb|EFE08566.1| tetraacyldisaccharide 4'-kinase [Citrobacter youngae ATCC 29220] Length = 60 Score = 88.0 bits (218), Expect = 4e-16, Method: Composition-based stats. Identities = 23/56 (41%), Positives = 36/56 (64%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ G L E EL+ K +LA+P+R G+P++L +EAR + Sbjct: 1 MDHRLLEIIACPVCNGKLWFNQEKQELICKLDNLAFPLRDGIPVLLETEARVLTAD 56 >gi|227329376|ref|ZP_03833400.1| hypothetical protein PcarcW_19352 [Pectobacterium carotovorum subsp. carotovorum WPP14] Length = 54 Score = 88.0 bits (218), Expect = 4e-16, Method: Composition-based stats. Identities = 24/53 (45%), Positives = 36/53 (67%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 +D +LLEI+ CP+ G L E EL+ K LAYP+R G+P++L +EAR++ Sbjct: 1 MDHRLLEIVACPVCNGRLYFNKEKLELICKVDGLAYPVRDGIPVLLENEARKL 53 >gi|171463105|ref|YP_001797218.1| protein of unknown function DUF343 [Polynucleobacter necessarius subsp. necessarius STIR1] gi|226703715|sp|B1XTC7|Y311_POLNS RecName: Full=UPF0434 protein Pnec_0311 gi|171192643|gb|ACB43604.1| protein of unknown function DUF343 [Polynucleobacter necessarius subsp. necessarius STIR1] Length = 59 Score = 88.0 bits (218), Expect = 4e-16, Method: Composition-based stats. Identities = 28/56 (50%), Positives = 35/56 (62%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LL+ILVCPL K L L + EL+ K LAYPIR VP+ LV EAR + Sbjct: 1 MDKRLLDILVCPLCKSQLHLDANKQELICKADRLAYPIRDDVPVTLVDEARSLSAD 56 >gi|87118934|ref|ZP_01074832.1| hypothetical protein MED121_11730 [Marinomonas sp. MED121] gi|86165325|gb|EAQ66592.1| hypothetical protein MED121_11730 [Marinomonas sp. MED121] Length = 64 Score = 88.0 bits (218), Expect = 4e-16, Method: Composition-based stats. Identities = 29/56 (51%), Positives = 41/56 (73%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 + LL+ILVCP+TK LT+ EGTEL+SK +AYPIR G+P++L +EAR + + Sbjct: 1 MKKALLDILVCPVTKTPLTMNQEGTELISKVGGMAYPIRDGIPVLLETEARTLTSE 56 >gi|254462474|ref|ZP_05075890.1| conserved hypothetical protein [Rhodobacterales bacterium HTCC2083] gi|206679063|gb|EDZ43550.1| conserved hypothetical protein [Rhodobacteraceae bacterium HTCC2083] Length = 63 Score = 88.0 bits (218), Expect = 4e-16, Method: Composition-based stats. Identities = 28/60 (46%), Positives = 40/60 (66%) Query: 2 RETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 DP +LE L+CP T+ L + EL+SKKA LA+PIR+G+P+ML+ EAR++D Sbjct: 4 DNDAPGFDPHMLEALICPHTQSRLEYDANAQELVSKKAGLAFPIRNGIPVMLLDEARKLD 63 >gi|325983678|ref|YP_004296080.1| hypothetical protein NAL212_3157 [Nitrosomonas sp. AL212] gi|325533197|gb|ADZ27918.1| protein of unknown function DUF343 [Nitrosomonas sp. AL212] Length = 60 Score = 88.0 bits (218), Expect = 5e-16, Method: Composition-based stats. Identities = 26/56 (46%), Positives = 38/56 (67%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LL+ILVCPL KG L + EL+ K LA+ I+ G+P+ML EAR++ D+ Sbjct: 1 MDSKLLDILVCPLCKGPLIYKKDDKELICKPDRLAFAIKDGIPVMLADEARRISDE 56 >gi|238022603|ref|ZP_04603029.1| hypothetical protein GCWU000324_02511 [Kingella oralis ATCC 51147] gi|237867217|gb|EEP68259.1| hypothetical protein GCWU000324_02511 [Kingella oralis ATCC 51147] Length = 60 Score = 87.6 bits (217), Expect = 5e-16, Method: Composition-based stats. Identities = 28/55 (50%), Positives = 38/55 (69%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 + P+ L LVCPLTK L ++ EL SK A LA+PIR G+PI+L +EAR++ D Sbjct: 1 MQPKYLAKLVCPLTKKPLEYHADKQELWSKAARLAFPIRDGIPILLENEARELSD 55 >gi|27365420|ref|NP_760948.1| protein YcaR [Vibrio vulnificus CMCP6] gi|37680538|ref|NP_935147.1| hypothetical protein VV2354 [Vibrio vulnificus YJ016] gi|320155805|ref|YP_004188184.1| hypothetical protein VVM_01880 [Vibrio vulnificus MO6-24/O] gi|81448357|sp|Q8DAV0|Y2087_VIBVU RecName: Full=UPF0434 protein VV1_2087 gi|81756960|sp|Q7MJ09|Y2354_VIBVY RecName: Full=UPF0434 protein VV2354 gi|27361567|gb|AAO10475.1| Protein ycaR [Vibrio vulnificus CMCP6] gi|37199286|dbj|BAC95118.1| conserved hypothetical protein [Vibrio vulnificus YJ016] gi|319931117|gb|ADV85981.1| UPF0434 protein YcaR [Vibrio vulnificus MO6-24/O] Length = 59 Score = 87.6 bits (217), Expect = 5e-16, Method: Composition-based stats. Identities = 28/58 (48%), Positives = 39/58 (67%), Gaps = 1/58 (1%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD-DQG 64 +D +LLEI+ CP+ KG LT E EL+ K LAYPI+ G+P++L EAR + D+G Sbjct: 1 MDHRLLEIVACPVCKGKLTFDKENQELICKLDRLAYPIKEGIPVLLEPEARSMGMDEG 58 >gi|325266389|ref|ZP_08133067.1| tetraacyldisaccharide 4'-kinase [Kingella denitrificans ATCC 33394] gi|324982182|gb|EGC17816.1| tetraacyldisaccharide 4'-kinase [Kingella denitrificans ATCC 33394] Length = 60 Score = 87.6 bits (217), Expect = 5e-16, Method: Composition-based stats. Identities = 28/55 (50%), Positives = 38/55 (69%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 +D + L++LVCPLTK L E EL S+ A LA+PIR G+PI+L EAR +D+ Sbjct: 1 MDKKHLQLLVCPLTKQALEYHPEQQELWSRAAKLAFPIRDGIPILLPDEARALDE 55 >gi|85703384|ref|ZP_01034488.1| hypothetical protein ROS217_21622 [Roseovarius sp. 217] gi|85672312|gb|EAQ27169.1| hypothetical protein ROS217_21622 [Roseovarius sp. 217] Length = 64 Score = 87.6 bits (217), Expect = 5e-16, Method: Composition-based stats. Identities = 28/64 (43%), Positives = 40/64 (62%), Gaps = 3/64 (4%) Query: 1 MRETIF---NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEA 57 M + I D ++LE L+CP T L EL+S+ A LAYPIR+G+P+ML+ EA Sbjct: 1 MSDDIQLPPAFDRRMLEALICPQTHATLEYDVAAQELISRSADLAYPIRNGIPVMLIDEA 60 Query: 58 RQVD 61 R++D Sbjct: 61 RKLD 64 >gi|308050210|ref|YP_003913776.1| hypothetical protein Fbal_2500 [Ferrimonas balearica DSM 9799] gi|307632400|gb|ADN76702.1| protein of unknown function DUF343 [Ferrimonas balearica DSM 9799] Length = 59 Score = 87.6 bits (217), Expect = 5e-16, Method: Composition-based stats. Identities = 23/58 (39%), Positives = 32/58 (55%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 D +LLEI+ CP+ KG L EG L+ K L YPI G+P++L A + D+ Sbjct: 1 MGFDNKLLEIIACPVCKGKLEYDREGDRLICKADRLVYPITEGIPVLLEDRAEPLRDE 58 >gi|218688760|ref|YP_002396972.1| hypothetical protein ECED1_0947 [Escherichia coli ED1a] gi|254807392|sp|B7MS35|YCAR_ECO81 RecName: Full=UPF0434 protein ycaR gi|218426324|emb|CAR07149.1| conserved hypothetical protein [Escherichia coli ED1a] Length = 60 Score = 87.6 bits (217), Expect = 6e-16, Method: Composition-based stats. Identities = 22/56 (39%), Positives = 36/56 (64%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ G L E E++ K +LA+P+R G+P++L +EAR + Sbjct: 1 MDHRLLEIIACPVCNGKLWYNQEKQEIICKLDNLAFPLRDGIPVLLETEARVLTAD 56 >gi|330722476|gb|EGH00307.1| UPF0434 protein YcaR [gamma proteobacterium IMCC2047] Length = 61 Score = 87.6 bits (217), Expect = 6e-16, Method: Composition-based stats. Identities = 24/56 (42%), Positives = 33/56 (58%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +L+ IL CP KG L E EL+ K LA+P+R G+P+ML EAR + Sbjct: 1 MDQRLISILACPFCKGELIHDKEKHELICKFDGLAFPVRDGIPVMLEGEARALSAD 56 >gi|212213038|ref|YP_002303974.1| conserved cytosolic protein [Coxiella burnetii CbuG_Q212] gi|215918972|ref|YP_002332965.1| conserved cytosolic protein [Coxiella burnetii RSA 493] gi|226734689|sp|B6J1K1|Y1535_COXB2 RecName: Full=UPF0434 protein CbuG_1535 gi|206583857|gb|ACI15256.1| conserved cytosolic protein [Coxiella burnetii RSA 493] gi|212011448|gb|ACJ18829.1| conserved cytosolic protein [Coxiella burnetii CbuG_Q212] Length = 56 Score = 87.6 bits (217), Expect = 6e-16, Method: Composition-based stats. Identities = 22/53 (41%), Positives = 31/53 (58%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 +D +LLEIL CP+ KG L + EL+ + L YPI G+P+ML R + Sbjct: 1 MDRRLLEILACPICKGKLVYSQDEQELICRFDKLVYPIHDGIPVMLPDSTRPL 53 >gi|262165988|ref|ZP_06033725.1| hypothetical protein VMA_002437 [Vibrio mimicus VM223] gi|262025704|gb|EEY44372.1| hypothetical protein VMA_002437 [Vibrio mimicus VM223] Length = 59 Score = 87.2 bits (216), Expect = 6e-16, Method: Composition-based stats. Identities = 25/56 (44%), Positives = 36/56 (64%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ KG LT + EL+ K LAYPI+ G+P++L EAR + Sbjct: 1 MDHRLLEIVACPVCKGKLTYDKDRQELICKLDRLAYPIKEGIPVLLEPEARGMSMD 56 >gi|84687990|ref|ZP_01015854.1| hypothetical protein 1099457000203_RB2654_15604 [Maritimibacter alkaliphilus HTCC2654] gi|84664022|gb|EAQ10522.1| hypothetical protein RB2654_15604 [Rhodobacterales bacterium HTCC2654] Length = 60 Score = 87.2 bits (216), Expect = 6e-16, Method: Composition-based stats. Identities = 28/56 (50%), Positives = 38/56 (67%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 D +LE LVCP+T+ L E EL+S+ A LA+PIR G+PIML+ EAR++ D Sbjct: 5 TFDRHMLEALVCPMTQRALDYDPEKQELVSRAAGLAFPIRDGIPIMLIDEARKLKD 60 >gi|330830190|ref|YP_004393142.1| hypothetical protein B565_2490 [Aeromonas veronii B565] gi|328805326|gb|AEB50525.1| hypothetical protein B565_2490 [Aeromonas veronii B565] Length = 62 Score = 87.2 bits (216), Expect = 6e-16, Method: Composition-based stats. Identities = 20/58 (34%), Positives = 34/58 (58%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LL+I+ CP+ KG L EL+ + LAYP+ G+P++L + AR ++ Sbjct: 1 MALDIKLLDIIACPVCKGKLHYNKAVHELVCRFDKLAYPLEEGIPVLLENRARPLNSD 58 >gi|34498800|ref|NP_903015.1| hypothetical protein CV_3345 [Chromobacterium violaceum ATCC 12472] gi|81654798|sp|Q7NSS5|Y3345_CHRVO RecName: Full=UPF0434 protein CV_3345 gi|34104652|gb|AAQ61009.1| conserved hypothetical protein [Chromobacterium violaceum ATCC 12472] Length = 60 Score = 87.2 bits (216), Expect = 6e-16, Method: Composition-based stats. Identities = 27/56 (48%), Positives = 37/56 (66%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D + LEILVCPL KG L EL+ K LA+PI+ G+P+ML SEAR++ + Sbjct: 1 MDAKFLEILVCPLCKGPLVFDKSKDELICKGDRLAFPIKDGIPMMLESEARELAPE 56 >gi|290473869|ref|YP_003466743.1| protein ycaR [Xenorhabdus bovienii SS-2004] gi|289173176|emb|CBJ79949.1| Protein ycaR [Xenorhabdus bovienii SS-2004] Length = 59 Score = 87.2 bits (216), Expect = 7e-16, Method: Composition-based stats. Identities = 23/56 (41%), Positives = 36/56 (64%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ G L E EL+ K LA+P+R G+P++L +EAR + + Sbjct: 1 MDHRLLEIIACPVCYGKLNYDKENFELICKLDRLAFPVRDGIPVLLENEARALPAE 56 >gi|91793550|ref|YP_563201.1| hypothetical protein Sden_2197 [Shewanella denitrificans OS217] gi|122968680|sp|Q12M48|Y2197_SHEDO RecName: Full=UPF0434 protein Sden_2197 gi|91715552|gb|ABE55478.1| protein of unknown function DUF343 [Shewanella denitrificans OS217] Length = 56 Score = 87.2 bits (216), Expect = 7e-16, Method: Composition-based stats. Identities = 20/56 (35%), Positives = 31/56 (55%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 D +LLEI+ CP+ KG L + L K LA+PI G+P++L + A+ + Sbjct: 1 MAFDKKLLEIVACPVCKGKLEFDKQAQTLNCKFDKLAFPITEGIPVLLENRAQPLS 56 >gi|145298548|ref|YP_001141389.1| hypothetical protein ASA_1553 [Aeromonas salmonicida subsp. salmonicida A449] gi|148841330|sp|A4SL69|Y1553_AERS4 RecName: Full=UPF0434 protein ASA_1553 gi|142851320|gb|ABO89641.1| conserved hypothetical protein [Aeromonas salmonicida subsp. salmonicida A449] Length = 62 Score = 87.2 bits (216), Expect = 7e-16, Method: Composition-based stats. Identities = 21/58 (36%), Positives = 35/58 (60%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LL+I+ CP+ KG L EL+ + LAYP+ G+P++L + ARQ++ Sbjct: 1 MALDIKLLDIIACPVCKGKLHYNKAVHELVCRFDKLAYPLEEGIPVLLENRARQLNSD 58 >gi|269139513|ref|YP_003296214.1| hypothetical protein ETAE_2168 [Edwardsiella tarda EIB202] gi|267985174|gb|ACY85003.1| hypothetical protein ETAE_2168 [Edwardsiella tarda EIB202] gi|304559402|gb|ADM42066.1| YcaR [Edwardsiella tarda FL6-60] Length = 58 Score = 87.2 bits (216), Expect = 7e-16, Method: Composition-based stats. Identities = 24/53 (45%), Positives = 36/53 (67%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 +D +LLEI+ CP+ G L+ E EL+ K LA+P+R G+P+ML +EAR + Sbjct: 1 MDHRLLEIVACPVCNGKLSFNQEHQELVCKIDRLAFPLRDGIPVMLENEARPL 53 >gi|254466476|ref|ZP_05079887.1| conserved hypothetical protein [Rhodobacterales bacterium Y4I] gi|206687384|gb|EDZ47866.1| conserved hypothetical protein [Rhodobacterales bacterium Y4I] Length = 62 Score = 87.2 bits (216), Expect = 7e-16, Method: Composition-based stats. Identities = 30/62 (48%), Positives = 45/62 (72%), Gaps = 1/62 (1%) Query: 1 MRE-TIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 M E + D ++LE LVCPLT+ L ++ EL+S+ A+LA+PIR+G+P+MLV EAR+ Sbjct: 1 MTEPQVPAFDRRMLEALVCPLTQTVLDYDAQAQELISRAANLAFPIRNGIPVMLVDEARE 60 Query: 60 VD 61 +D Sbjct: 61 LD 62 >gi|302877900|ref|YP_003846464.1| hypothetical protein Galf_0659 [Gallionella capsiferriformans ES-2] gi|302580689|gb|ADL54700.1| protein of unknown function DUF343 [Gallionella capsiferriformans ES-2] Length = 61 Score = 87.2 bits (216), Expect = 7e-16, Method: Composition-based stats. Identities = 23/56 (41%), Positives = 34/56 (60%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LL+ILVCPL K L EL+ + LA+ I G+P+ML EAR++ + Sbjct: 1 MDAKLLDILVCPLCKSPLIYRKAEQELICRADRLAFKIADGIPVMLADEARKLTPE 56 >gi|56416416|ref|YP_153490.1| hypothetical protein AM070 [Anaplasma marginale str. St. Maries] gi|254994645|ref|ZP_05276835.1| hypothetical protein AmarM_00271 [Anaplasma marginale str. Mississippi] gi|255002754|ref|ZP_05277718.1| hypothetical protein AmarPR_00261 [Anaplasma marginale str. Puerto Rico] gi|255003886|ref|ZP_05278687.1| hypothetical protein AmarV_00261 [Anaplasma marginale str. Virginia] gi|81359330|sp|Q5PBU4|Y070_ANAMM RecName: Full=UPF0434 protein AM070 gi|56387648|gb|AAV86235.1| hypothetical protein AM070 [Anaplasma marginale str. St. Maries] Length = 59 Score = 86.8 bits (215), Expect = 8e-16, Method: Composition-based stats. Identities = 26/57 (45%), Positives = 40/57 (70%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLE+LVCPLT G L ++ EL+S+ A LA+P+ G+P+ML EAR+++ Sbjct: 1 MLDKRLLEVLVCPLTGGELYYDADSCELVSENAGLAFPVHDGIPVMLADEARKLEPD 57 >gi|317407671|gb|EFV87607.1| hypothetical protein HMPREF0005_03622 [Achromobacter xylosoxidans C54] Length = 60 Score = 86.8 bits (215), Expect = 8e-16, Method: Composition-based stats. Identities = 27/55 (49%), Positives = 38/55 (69%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 ++ +LL+ILVCPL KG L EL+ + LA+P+R G+P+ML SEAR +DD Sbjct: 1 MESRLLDILVCPLCKGRLEHDRTQAELVCRADRLAFPLRDGIPVMLESEARSLDD 55 >gi|148841318|sp|A1UTQ7|Y1098_BARBK RecName: Full=UPF0434 protein BARBAKC583_1098 Length = 55 Score = 86.8 bits (215), Expect = 8e-16, Method: Composition-based stats. Identities = 33/55 (60%), Positives = 41/55 (74%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 DP++LE+LVCP+T GNL+ + EL+S KA LAYPIR GVPIML SEAR + Sbjct: 1 MTTDPKMLELLVCPITGGNLSFNRKTQELISLKAKLAYPIRDGVPIMLASEARPL 55 >gi|146311093|ref|YP_001176167.1| hypothetical protein Ent638_1436 [Enterobacter sp. 638] gi|166979846|sp|A4W8T6|Y1436_ENT38 RecName: Full=UPF0434 protein Ent638_1436 gi|145317969|gb|ABP60116.1| protein of unknown function DUF343 [Enterobacter sp. 638] Length = 60 Score = 86.8 bits (215), Expect = 9e-16, Method: Composition-based stats. Identities = 22/56 (39%), Positives = 37/56 (66%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ G L + EL+ K +LA+P+R G+P++L +EAR + + Sbjct: 1 MDHRLLEIIACPVCNGKLYYSQDKQELICKLDNLAFPLRDGIPVLLETEARSLAAE 56 >gi|83941777|ref|ZP_00954239.1| hypothetical protein EE36_06073 [Sulfitobacter sp. EE-36] gi|83847597|gb|EAP85472.1| hypothetical protein EE36_06073 [Sulfitobacter sp. EE-36] Length = 61 Score = 86.8 bits (215), Expect = 9e-16, Method: Composition-based stats. Identities = 29/61 (47%), Positives = 40/61 (65%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 M D ++LE L+CP T+ LT ++ EL+S A LAYPIR+G+P+MLV EAR + Sbjct: 1 MNAEEIPFDRRMLEALICPRTQMRLTYDADKQELISDAAGLAYPIRNGIPVMLVDEARVI 60 Query: 61 D 61 D Sbjct: 61 D 61 >gi|296103081|ref|YP_003613227.1| hypothetical protein ECL_02737 [Enterobacter cloacae subsp. cloacae ATCC 13047] gi|295057540|gb|ADF62278.1| hypothetical protein ECL_02737 [Enterobacter cloacae subsp. cloacae ATCC 13047] Length = 60 Score = 86.8 bits (215), Expect = 1e-15, Method: Composition-based stats. Identities = 23/53 (43%), Positives = 36/53 (67%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 +D +LLEI+ CP+ G L + EL+ K SLA+P+R G+P++L +EAR + Sbjct: 1 MDHRLLEIIACPVCNGKLYYSQDKQELICKPDSLAFPLRDGIPVLLENEARSL 53 >gi|260574461|ref|ZP_05842465.1| protein of unknown function DUF343 [Rhodobacter sp. SW2] gi|259023357|gb|EEW26649.1| protein of unknown function DUF343 [Rhodobacter sp. SW2] Length = 66 Score = 86.8 bits (215), Expect = 1e-15, Method: Composition-based stats. Identities = 30/59 (50%), Positives = 40/59 (67%) Query: 2 RETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 D ++LE LVCP++ L ++ EL+SK A+LA+PIR G+PIMLVSEARQV Sbjct: 7 PRDAAVFDRRMLEALVCPVSHAVLAYDADRGELVSKAANLAFPIRDGIPIMLVSEARQV 65 >gi|187478594|ref|YP_786618.1| hypothetical protein BAV2101 [Bordetella avium 197N] gi|123514704|sp|Q2KZE7|Y2101_BORA1 RecName: Full=UPF0434 protein BAV2101 gi|115423180|emb|CAJ49711.1| conserved hypothetical protein [Bordetella avium 197N] Length = 63 Score = 86.8 bits (215), Expect = 1e-15, Method: Composition-based stats. Identities = 25/54 (46%), Positives = 36/54 (66%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 ++ +LL+ILVCPL KG L + EL+ LA+P+R G+P+ML S AR +D Sbjct: 1 MESRLLDILVCPLCKGRLEFLRAQDELVCHADRLAFPVRDGIPVMLESAARPLD 54 >gi|251771037|gb|EES51621.1| conserved protein of unknown function [Leptospirillum ferrodiazotrophum] Length = 108 Score = 86.8 bits (215), Expect = 1e-15, Method: Composition-based stats. Identities = 27/61 (44%), Positives = 35/61 (57%) Query: 2 RETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 R + IDP LL ILVCP +G LTL E L+ L YP++ +P+MLV EA V Sbjct: 45 RRSSVAIDPFLLSILVCPQCRGPLTLSEEPAGLVCASCRLLYPVKDDIPVMLVEEALPVA 104 Query: 62 D 62 + Sbjct: 105 E 105 >gi|254468208|ref|ZP_05081614.1| tetraacyldisaccharide-1-P 4-kinase [beta proteobacterium KB13] gi|207087018|gb|EDZ64301.1| tetraacyldisaccharide-1-P 4-kinase [beta proteobacterium KB13] Length = 54 Score = 86.8 bits (215), Expect = 1e-15, Method: Composition-based stats. Identities = 29/53 (54%), Positives = 40/53 (75%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 +D LLE++VCP+TK L + EL+SK A LAY I++G+PIMLVSEAR++ Sbjct: 1 MDKNLLELIVCPVTKEKLVYDKKNNELISKGAGLAYSIKNGIPIMLVSEARKI 53 >gi|33593727|ref|NP_881371.1| hypothetical protein BP2767 [Bordetella pertussis Tohama I] gi|33597147|ref|NP_884790.1| hypothetical protein BPP2562 [Bordetella parapertussis 12822] gi|33600992|ref|NP_888552.1| hypothetical protein BB2007 [Bordetella bronchiseptica RB50] gi|81424655|sp|Q7VVB1|Y2767_BORPE RecName: Full=UPF0434 protein BP2767 gi|81426868|sp|Q7W7F8|Y2562_BORPA RecName: Full=UPF0434 protein BPP2562 gi|81431344|sp|Q7WKU6|Y2007_BORBR RecName: Full=UPF0434 protein BB2007 gi|33563800|emb|CAE43042.1| conserved hypothetical protein [Bordetella pertussis Tohama I] gi|33566598|emb|CAE37856.1| conserved hypothetical protein [Bordetella parapertussis] gi|33575427|emb|CAE32504.1| conserved hypothetical protein [Bordetella bronchiseptica RB50] gi|332383130|gb|AEE67977.1| hypothetical protein BPTD_2723 [Bordetella pertussis CS] Length = 62 Score = 86.8 bits (215), Expect = 1e-15, Method: Composition-based stats. Identities = 26/56 (46%), Positives = 37/56 (66%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 ++ +LL+ILVCP+ KG L EL+ LA+P+R GVPIML +EAR +D + Sbjct: 1 MESRLLDILVCPVCKGRLEFQRAQAELVCNADRLAFPVRDGVPIMLEAEARSLDAE 56 >gi|84500682|ref|ZP_00998931.1| hypothetical protein OB2597_12006 [Oceanicola batsensis HTCC2597] gi|84391635|gb|EAQ03967.1| hypothetical protein OB2597_12006 [Oceanicola batsensis HTCC2597] Length = 66 Score = 86.8 bits (215), Expect = 1e-15, Method: Composition-based stats. Identities = 29/54 (53%), Positives = 41/54 (75%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 D ++LE L+CPLT+ L +E EL+SK+A+LA+PIR+G+PIML EAR +D Sbjct: 12 FDRRMLEALICPLTQTTLAYDAERQELISKRANLAFPIRNGIPIMLEDEARSLD 65 >gi|237808977|ref|YP_002893417.1| hypothetical protein Tola_2233 [Tolumonas auensis DSM 9187] gi|259646606|sp|C4L8W1|Y2233_TOLAT RecName: Full=UPF0434 protein Tola_2233 gi|237501238|gb|ACQ93831.1| protein of unknown function DUF343 [Tolumonas auensis DSM 9187] Length = 62 Score = 86.4 bits (214), Expect = 1e-15, Method: Composition-based stats. Identities = 21/58 (36%), Positives = 36/58 (62%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ KG L E +EL+ + LAYP+ +P++L + AR + ++ Sbjct: 1 MALDYKLLEIVACPICKGKLNYDKERSELVCRADKLAYPVEDDIPVLLENRARPLKEE 58 >gi|209364122|ref|YP_002268352.1| conserved cytosolic protein [Coxiella burnetii Dugway 5J108-111] gi|226734728|sp|B5XHH0|Y1597_COXBN RecName: Full=UPF0434 protein CBUD_1597.1 gi|207082055|gb|ACI23190.1| conserved cytosolic protein [Coxiella burnetii Dugway 5J108-111] Length = 56 Score = 86.4 bits (214), Expect = 1e-15, Method: Composition-based stats. Identities = 23/53 (43%), Positives = 31/53 (58%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 +D LLEIL CP+ KG L + EL+ + LAYPI G+P+ML R + Sbjct: 1 MDRILLEILACPICKGKLVYSQDEQELICRFDKLAYPIHDGIPVMLPDSTRPL 53 >gi|152969501|ref|YP_001334610.1| hypothetical protein KPN_00944 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] gi|238893973|ref|YP_002918707.1| hypothetical protein KP1_1917 [Klebsiella pneumoniae NTUH-K2044] gi|262040984|ref|ZP_06014206.1| tetraacyldisaccharide 4'-kinase [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884] gi|330014003|ref|ZP_08307839.1| hypothetical protein HMPREF9538_05559 [Klebsiella sp. MS 92-3] gi|166918977|sp|A6T709|Y919_KLEP7 RecName: Full=UPF0434 protein KPN78578_09190 gi|150954350|gb|ABR76380.1| hypothetical protein KPN_00944 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] gi|238546289|dbj|BAH62640.1| hypothetical protein KP1_1917 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044] gi|259041678|gb|EEW42727.1| tetraacyldisaccharide 4'-kinase [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884] gi|328533296|gb|EGF60047.1| hypothetical protein HMPREF9538_05559 [Klebsiella sp. MS 92-3] Length = 60 Score = 86.4 bits (214), Expect = 1e-15, Method: Composition-based stats. Identities = 23/53 (43%), Positives = 36/53 (67%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 +D +LLEI+ CP+ G L + EL+ K SLA+P+R G+P++L +EAR + Sbjct: 1 MDHRLLEIIACPVCNGKLYYSQDKQELICKLDSLAFPLRDGIPVLLETEARPL 53 >gi|257092028|ref|YP_003165669.1| hypothetical protein CAP2UW1_0387 [Candidatus Accumulibacter phosphatis clade IIA str. UW-1] gi|257044552|gb|ACV33740.1| protein of unknown function DUF343 [Candidatus Accumulibacter phosphatis clade IIA str. UW-1] Length = 58 Score = 86.4 bits (214), Expect = 1e-15, Method: Composition-based stats. Identities = 26/56 (46%), Positives = 35/56 (62%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LL+ILVCP+ K NL EL+ K LA+P+R G+PIML EAR + Sbjct: 1 MDARLLDILVCPICKANLEYRKVEAELVCKPCRLAFPVRDGIPIMLQDEARPLAAD 56 >gi|121602896|ref|YP_989360.1| hypothetical protein BARBAKC583_1098 [Bartonella bacilliformis KC583] gi|120615073|gb|ABM45674.1| conserved hypothetical protein [Bartonella bacilliformis KC583] Length = 58 Score = 86.4 bits (214), Expect = 1e-15, Method: Composition-based stats. Identities = 33/57 (57%), Positives = 41/57 (71%) Query: 4 TIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 DP++LE+LVCP+T GNL+ + EL+S KA LAYPIR GVPIML SEAR + Sbjct: 2 KKMTTDPKMLELLVCPITGGNLSFNRKTQELISLKAKLAYPIRDGVPIMLASEARPL 58 >gi|117924218|ref|YP_864835.1| hypothetical protein Mmc1_0910 [Magnetococcus sp. MC-1] gi|148841376|sp|A0L636|Y910_MAGSM RecName: Full=UPF0434 protein Mmc1_0910 gi|117607974|gb|ABK43429.1| protein of unknown function DUF343 [Magnetococcus sp. MC-1] Length = 59 Score = 86.4 bits (214), Expect = 1e-15, Method: Composition-based stats. Identities = 26/57 (45%), Positives = 40/57 (70%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D QLL+ILVCP+ KG L++ TEL+ K LA+P+R +P+ML+ EAR+++ Sbjct: 1 MLDKQLLDILVCPVCKGTLSVDKGHTELVCDKDKLAFPVRDDIPVMLMEEARKLEAD 57 >gi|320540494|ref|ZP_08040144.1| putative conserved protein [Serratia symbiotica str. Tucson] gi|320029425|gb|EFW11454.1| putative conserved protein [Serratia symbiotica str. Tucson] Length = 60 Score = 86.4 bits (214), Expect = 1e-15, Method: Composition-based stats. Identities = 24/53 (45%), Positives = 34/53 (64%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 +D +LLEI+ CP+ GNL E EL+ K LAYP+R G+P++L AR + Sbjct: 1 MDHRLLEIVACPVCNGNLYFNKENQELICKVDGLAYPLRDGIPVLLEDAARAL 53 >gi|149203968|ref|ZP_01880936.1| hypothetical protein RTM1035_10620 [Roseovarius sp. TM1035] gi|149142410|gb|EDM30455.1| hypothetical protein RTM1035_10620 [Roseovarius sp. TM1035] Length = 64 Score = 86.4 bits (214), Expect = 1e-15, Method: Composition-based stats. Identities = 26/55 (47%), Positives = 40/55 (72%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 D ++LE L+CP T L + EL+S++ASLA+PIR+G+P+ML+ EAR++D Sbjct: 10 AFDRRMLEALICPQTHVTLEYDAAAQELISRRASLAFPIRNGIPVMLIDEARRLD 64 >gi|311262831|ref|XP_003129376.1| PREDICTED: hypothetical protein LOC100518264 [Sus scrofa] Length = 359 Score = 86.4 bits (214), Expect = 1e-15, Method: Composition-based stats. Identities = 23/52 (44%), Positives = 31/52 (59%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEAR 58 DP LLE LVCPL+K L EL++++ +AYPI G+P M+ AR Sbjct: 294 AFDPALLEFLVCPLSKKPLRYEPSTNELINEELGIAYPIIDGIPNMIPQAAR 345 >gi|294788477|ref|ZP_06753720.1| tetraacyldisaccharide 4'-kinase (Lipid A 4'-kinase) [Simonsiella muelleri ATCC 29453] gi|294483908|gb|EFG31592.1| tetraacyldisaccharide 4'-kinase (Lipid A 4'-kinase) [Simonsiella muelleri ATCC 29453] Length = 60 Score = 86.4 bits (214), Expect = 1e-15, Method: Composition-based stats. Identities = 25/55 (45%), Positives = 36/55 (65%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 ++ + +LVCP+TK L + EL S A LA+PIR G+PIML +EARQ+ + Sbjct: 1 MEQKYFNLLVCPITKKPLKYHEDKQELWSLSAKLAFPIRDGIPIMLENEARQLTN 55 >gi|163856983|ref|YP_001631281.1| hypothetical protein Bpet2671 [Bordetella petrii DSM 12804] gi|226701486|sp|A9IQ32|Y2671_BORPD RecName: Full=UPF0434 protein Bpet2671 gi|163260711|emb|CAP43013.1| Hypothetical protein similar to the N-terminus of LpxK [Bordetella petrii] Length = 61 Score = 86.1 bits (213), Expect = 1e-15, Method: Composition-based stats. Identities = 27/54 (50%), Positives = 37/54 (68%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 ++ +LL+ LVCP+ KG L ELL + LAYP+R G+P+ML SEARQ+D Sbjct: 1 MESRLLDTLVCPVCKGRLDFDRARAELLCRADRLAYPVRDGIPVMLESEARQLD 54 >gi|261339251|ref|ZP_05967109.1| hypothetical protein ENTCAN_05487 [Enterobacter cancerogenus ATCC 35316] gi|288319108|gb|EFC58046.1| tetraacyldisaccharide 4'-kinase (Lipid A 4'-kinase) [Enterobacter cancerogenus ATCC 35316] Length = 60 Score = 86.1 bits (213), Expect = 1e-15, Method: Composition-based stats. Identities = 23/53 (43%), Positives = 36/53 (67%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 +D +LLEI+ CP+ G L + EL+ K SLA+P+R G+P++L +EAR + Sbjct: 1 MDHRLLEIIACPVCNGKLYYSQDKQELICKLDSLAFPLRDGIPVLLENEARSL 53 >gi|317491468|ref|ZP_07949904.1| hypothetical protein HMPREF0864_00667 [Enterobacteriaceae bacterium 9_2_54FAA] gi|316921015|gb|EFV42338.1| hypothetical protein HMPREF0864_00667 [Enterobacteriaceae bacterium 9_2_54FAA] Length = 58 Score = 86.1 bits (213), Expect = 1e-15, Method: Composition-based stats. Identities = 23/56 (41%), Positives = 34/56 (60%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ G L E EL+ K L YP+R G+P++L +EAR + Sbjct: 1 MDHRLLEIIACPVCNGKLYFNKENQELVCKADRLGYPLRDGIPVLLENEARLLPVD 56 >gi|160872327|ref|ZP_02062459.1| conserved domain protein [Rickettsiella grylli] gi|159121126|gb|EDP46464.1| conserved domain protein [Rickettsiella grylli] Length = 63 Score = 86.1 bits (213), Expect = 2e-15, Method: Composition-based stats. Identities = 25/56 (44%), Positives = 34/56 (60%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D LL ILVCPL K +L EL+ + LAYPIR +P+ML EAR++ + Sbjct: 1 MDKYLLSILVCPLCKASLVYEKSAQELICRFDRLAYPIRDEIPVMLAHEARKISLE 56 >gi|152149169|pdb|2JS4|A Chain A, Solution Nmr Structure Of Bordetella Bronchiseptica Protein Bb2007. Northeast Structural Genomics Consortium Target Bor54 Length = 70 Score = 86.1 bits (213), Expect = 2e-15, Method: Composition-based stats. Identities = 26/56 (46%), Positives = 37/56 (66%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 ++ +LL+ILVCP+ KG L EL+ LA+P+R GVPIML +EAR +D + Sbjct: 1 MESRLLDILVCPVCKGRLEFQRAQAELVCNADRLAFPVRDGVPIMLEAEARSLDAE 56 >gi|37525577|ref|NP_928921.1| hypothetical protein plu1633 [Photorhabdus luminescens subsp. laumondii TTO1] gi|81419828|sp|Q7N6C3|Y1633_PHOLL RecName: Full=UPF0434 protein plu1633 gi|36785005|emb|CAE13926.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii TTO1] Length = 59 Score = 86.1 bits (213), Expect = 2e-15, Method: Composition-based stats. Identities = 23/53 (43%), Positives = 36/53 (67%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 +D +LLEI+ CP+ G L+ E EL+ K LA+P+R G+P++L EAR++ Sbjct: 1 MDHRLLEIIACPVCNGKLSYDKENFELICKLDRLAFPVRDGIPVLLEHEAREL 53 >gi|94499590|ref|ZP_01306127.1| hypothetical protein RED65_01115 [Oceanobacter sp. RED65] gi|94428344|gb|EAT13317.1| hypothetical protein RED65_01115 [Oceanobacter sp. RED65] Length = 62 Score = 86.1 bits (213), Expect = 2e-15, Method: Composition-based stats. Identities = 21/56 (37%), Positives = 34/56 (60%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +L+ ++VCP+ KG L + EL+ K +AY I+ G+P+ML EAR + Sbjct: 1 MDKKLISLMVCPMCKGALKYDKDAQELICKFDGVAYQIKDGIPVMLAEEARPLTVD 56 >gi|297183855|gb|ADI19978.1| hypothetical protein [uncultured marine bacterium EB000_55B11] Length = 57 Score = 85.7 bits (212), Expect = 2e-15, Method: Composition-based stats. Identities = 31/57 (54%), Positives = 41/57 (71%) Query: 5 IFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 + IDP +LEILVCP+T G+L +E L S A LAYPIR+G+P+ML EAR++D Sbjct: 1 MIQIDPXMLEILVCPITFGSLXYNAETQXLXSNSAKLAYPIRNGIPVMLPDEARKID 57 >gi|254371146|ref|ZP_04987148.1| conserved hypothetical protein [Francisella tularensis subsp. tularensis FSC033] gi|151569386|gb|EDN35040.1| conserved hypothetical protein [Francisella tularensis subsp. tularensis FSC033] gi|282159732|gb|ADA79123.1| hypothetical protein NE061598_08260 [Francisella tularensis subsp. tularensis NE061598] Length = 82 Score = 85.7 bits (212), Expect = 2e-15, Method: Composition-based stats. Identities = 24/56 (42%), Positives = 35/56 (62%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +L +LVCP+ K NL E L+ K LAYPIR +P+MLV EA+++ + Sbjct: 21 MDHSVLNVLVCPICKANLYYDKENQVLVCKADKLAYPIRENIPVMLVEEAKKMTLE 76 >gi|291613830|ref|YP_003523987.1| hypothetical protein Slit_1363 [Sideroxydans lithotrophicus ES-1] gi|291583942|gb|ADE11600.1| protein of unknown function DUF343 [Sideroxydans lithotrophicus ES-1] Length = 61 Score = 85.7 bits (212), Expect = 2e-15, Method: Composition-based stats. Identities = 23/54 (42%), Positives = 33/54 (61%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 +D +LL+ILVCPL K L EL+ K LA+ I+ +P+ML EAR++ Sbjct: 1 MDAKLLDILVCPLCKSPLIYHKAEQELICKADRLAFAIKDDIPVMLADEARELS 54 >gi|253990293|ref|YP_003041649.1| hypothetical protein PAU_02817 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949] gi|253781743|emb|CAQ84906.1| conserved hypothetical protein [Photorhabdus asymbiotica] Length = 59 Score = 85.7 bits (212), Expect = 2e-15, Method: Composition-based stats. Identities = 23/53 (43%), Positives = 36/53 (67%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 +D +LLEI+ CP+ G L+ E EL+ K LA+P+R G+P++L EAR++ Sbjct: 1 MDHRLLEIIACPVCNGKLSYDKENFELICKLDRLAFPVRDGIPVLLDHEAREL 53 >gi|171059237|ref|YP_001791586.1| hypothetical protein Lcho_2556 [Leptothrix cholodnii SP-6] gi|226701586|sp|B1Y6I5|Y2556_LEPCP RecName: Full=UPF0434 protein Lcho_2556 gi|170776682|gb|ACB34821.1| protein of unknown function DUF343 [Leptothrix cholodnii SP-6] Length = 67 Score = 85.7 bits (212), Expect = 2e-15, Method: Composition-based stats. Identities = 25/54 (46%), Positives = 36/54 (66%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 +D +L+++LVCPL KG L EL+ K LA+PIR G+ +ML S+AR +D Sbjct: 1 MDTRLMDLLVCPLCKGPLAHDHATHELVCKADRLAFPIRDGIAVMLESQARSID 54 >gi|300024972|ref|YP_003757583.1| hypothetical protein Hden_3471 [Hyphomicrobium denitrificans ATCC 51888] gi|299526793|gb|ADJ25262.1| protein of unknown function DUF343 [Hyphomicrobium denitrificans ATCC 51888] Length = 75 Score = 85.7 bits (212), Expect = 2e-15, Method: Composition-based stats. Identities = 31/61 (50%), Positives = 41/61 (67%) Query: 2 RETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 E +DP+LLE+LVCPLTK L + EL+SK A LA+PIR+GVP+M+ AR + Sbjct: 9 DEQASAVDPKLLELLVCPLTKTRLIYDASTRELISKAAGLAFPIRNGVPLMIEDAARPLT 68 Query: 62 D 62 D Sbjct: 69 D 69 >gi|254486065|ref|ZP_05099270.1| conserved hypothetical protein [Roseobacter sp. GAI101] gi|214042934|gb|EEB83572.1| conserved hypothetical protein [Roseobacter sp. GAI101] Length = 50 Score = 85.7 bits (212), Expect = 2e-15, Method: Composition-based stats. Identities = 29/50 (58%), Positives = 37/50 (74%) Query: 12 LLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 +LE LVCP T+ L +E EL+SK A LAYPIR+G+P+MLV EAR +D Sbjct: 1 MLEALVCPRTQTTLHYDAERQELVSKAAGLAYPIRNGIPVMLVDEARLLD 50 >gi|311694953|gb|ADP97826.1| YcaR-like protein [marine bacterium HP15] Length = 62 Score = 85.7 bits (212), Expect = 2e-15, Method: Composition-based stats. Identities = 24/56 (42%), Positives = 39/56 (69%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LL +L CP+ KG+L L + TEL+ + ++A+PIR G+P+ML +EAR + Sbjct: 1 MDKKLLALLACPVCKGDLKLNEDRTELVCYQDAMAFPIREGIPVMLATEARTLSTD 56 >gi|254374112|ref|ZP_04989594.1| conserved hypothetical protein [Francisella novicida GA99-3548] gi|151571832|gb|EDN37486.1| conserved hypothetical protein [Francisella novicida GA99-3548] Length = 82 Score = 85.7 bits (212), Expect = 2e-15, Method: Composition-based stats. Identities = 24/56 (42%), Positives = 35/56 (62%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +L +LVCP+ K NL E L+ K LAYPIR +P+MLV EA+++ + Sbjct: 21 MDHSVLNVLVCPICKANLYYDKENQVLVCKADKLAYPIRENIPVMLVEEAKKMTLE 76 >gi|295096382|emb|CBK85472.1| Uncharacterized conserved protein [Enterobacter cloacae subsp. cloacae NCTC 9394] Length = 60 Score = 85.7 bits (212), Expect = 2e-15, Method: Composition-based stats. Identities = 23/53 (43%), Positives = 36/53 (67%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 +D +LLEI+ CP+ G L + EL+ K SLA+P+R G+P++L +EAR + Sbjct: 1 MDHRLLEIIACPVCNGKLYYSQDKQELICKLDSLAFPLRDGIPVLLENEARSL 53 >gi|328675815|gb|AEB28490.1| UPF0434 protein YcaR [Francisella cf. novicida 3523] Length = 62 Score = 85.3 bits (211), Expect = 2e-15, Method: Composition-based stats. Identities = 24/56 (42%), Positives = 35/56 (62%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +L +LVCP+ K NL E L+ K LAYPIR +P+MLV EA+++ + Sbjct: 1 MDHSILNVLVCPICKANLHYDKEKQVLVCKADKLAYPIRENIPVMLVEEAKKLTLE 56 >gi|315121902|ref|YP_004062391.1| hypothetical protein CKC_00760 [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495304|gb|ADR51903.1| hypothetical protein CKC_00760 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 64 Score = 85.3 bits (211), Expect = 3e-15, Method: Composition-based stats. Identities = 50/61 (81%), Positives = 56/61 (91%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 M+E + NIDP+LLEILVCPLTKGNL LISEG ELLSKKASL YPIRSGVPIMLV+EAR++ Sbjct: 1 MKENVPNIDPKLLEILVCPLTKGNLILISEGKELLSKKASLVYPIRSGVPIMLVAEARKM 60 Query: 61 D 61 D Sbjct: 61 D 61 >gi|89256693|ref|YP_514055.1| hypothetical protein FTL_1400 [Francisella tularensis subsp. holarctica LVS] gi|167010485|ref|ZP_02275416.1| hypothetical protein Ftulh_07167 [Francisella tularensis subsp. holarctica FSC200] gi|169656667|ref|YP_001428918.2| hypothetical protein FTA_1487 [Francisella tularensis subsp. holarctica FTNF002-00] gi|194323581|ref|ZP_03057358.1| conserved hypothetical protein [Francisella tularensis subsp. novicida FTE] gi|208779071|ref|ZP_03246417.1| conserved hypothetical protein [Francisella novicida FTG] gi|89144524|emb|CAJ79839.1| conserved hypothetical protein [Francisella tularensis subsp. holarctica LVS] gi|164551735|gb|ABU61962.2| conserved hypothetical protein [Francisella tularensis subsp. holarctica FTNF002-00] gi|194322436|gb|EDX19917.1| conserved hypothetical protein [Francisella tularensis subsp. novicida FTE] gi|208744871|gb|EDZ91169.1| conserved hypothetical protein [Francisella novicida FTG] Length = 82 Score = 85.3 bits (211), Expect = 3e-15, Method: Composition-based stats. Identities = 24/56 (42%), Positives = 35/56 (62%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +L +LVCP+ K NL E L+ K LAYPIR +P+MLV EA+++ + Sbjct: 21 MDHSVLNVLVCPICKANLYYDKENQVLVCKADKLAYPIRENIPVMLVEEAKKMTLE 76 >gi|319405440|emb|CBI79059.1| conserved hypothetical protein [Bartonella sp. AR 15-3] Length = 64 Score = 84.9 bits (210), Expect = 3e-15, Method: Composition-based stats. Identities = 34/57 (59%), Positives = 42/57 (73%) Query: 4 TIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 DP++LE+LVCP+TK L+L + EL+S KA LAYPIRSGVPIML SEAR + Sbjct: 2 KKMTTDPKMLELLVCPITKEPLSLNKKKQELISLKAKLAYPIRSGVPIMLTSEARPL 58 >gi|331656988|ref|ZP_08357950.1| putative inner membrane protein [Escherichia coli TA206] gi|331055236|gb|EGI27245.1| putative inner membrane protein [Escherichia coli TA206] Length = 60 Score = 84.9 bits (210), Expect = 4e-15, Method: Composition-based stats. Identities = 22/56 (39%), Positives = 35/56 (62%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +L EI+ CP+ G L E EL+ K +LA+P+R G+P++L +EAR + Sbjct: 1 MDHRLPEIIACPVCNGKLWYNQEKQELICKLDNLAFPLRDGIPVLLETEARVLTAD 56 >gi|304413651|ref|ZP_07395095.1| hypothetical protein REG_0717 [Candidatus Regiella insecticola LSR1] gi|304283742|gb|EFL92136.1| hypothetical protein REG_0717 [Candidatus Regiella insecticola LSR1] Length = 93 Score = 84.5 bits (209), Expect = 4e-15, Method: Composition-based stats. Identities = 22/56 (39%), Positives = 36/56 (64%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ G L+ + L+ K LAYP+R+G+P++L +EAR + Sbjct: 34 MDRRLLEIIACPICNGKLSFDQKNLALVCKAEQLAYPVRNGIPVLLANEARAIKID 89 >gi|296196024|ref|XP_002745680.1| PREDICTED: protein preY, mitochondrial-like [Callithrix jacchus] Length = 201 Score = 84.5 bits (209), Expect = 4e-15, Method: Composition-based stats. Identities = 23/52 (44%), Positives = 32/52 (61%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEAR 58 DP LLE LVCPL+K L + EL++++ +AYPI G+P M+ AR Sbjct: 136 TFDPALLEFLVCPLSKKPLRYEASTNELINEELGIAYPIIDGIPNMIPQAAR 187 >gi|94263382|ref|ZP_01287196.1| Protein of unknown function DUF343 [delta proteobacterium MLMS-1] gi|93456218|gb|EAT06352.1| Protein of unknown function DUF343 [delta proteobacterium MLMS-1] Length = 58 Score = 84.5 bits (209), Expect = 4e-15, Method: Composition-based stats. Identities = 23/54 (42%), Positives = 32/54 (59%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 ++P+LL IL CP KG + L E L+ L Y IR G+PIML+ EA+ + Sbjct: 1 MLNPELLNILACPQCKGPVQLNEEENGLVCTSCRLLYEIRDGIPIMLIDEAKPL 54 >gi|311740482|ref|ZP_07714309.1| tetraacyldisaccharide 4'-kinase [Corynebacterium pseudogenitalium ATCC 33035] gi|311304002|gb|EFQ80078.1| tetraacyldisaccharide 4'-kinase [Corynebacterium pseudogenitalium ATCC 33035] Length = 57 Score = 84.5 bits (209), Expect = 4e-15, Method: Composition-based stats. Identities = 23/54 (42%), Positives = 38/54 (70%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 ++DP+LLE+LVCP KG LT + + L++++ +AYPI +P+MLV A++ Sbjct: 1 MSLDPKLLEVLVCPQDKGPLTYLEDKQVLVNERLGIAYPIEDDIPVMLVDHAQK 54 >gi|222055201|ref|YP_002537563.1| protein of unknown function DUF343 [Geobacter sp. FRC-32] gi|221564490|gb|ACM20462.1| protein of unknown function DUF343 [Geobacter sp. FRC-32] Length = 56 Score = 84.5 bits (209), Expect = 4e-15, Method: Composition-based stats. Identities = 25/56 (44%), Positives = 37/56 (66%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 I +LL IL CP KG L L+++G+ L+ + L YP+R G+P+MLV EA ++D Sbjct: 1 MTISQELLSILACPNCKGELVLLADGSGLVCEACRLRYPVRDGIPVMLVDEAEKLD 56 >gi|126724352|ref|ZP_01740195.1| hypothetical protein RB2150_10991 [Rhodobacterales bacterium HTCC2150] gi|126705516|gb|EBA04606.1| hypothetical protein RB2150_10991 [Rhodobacterales bacterium HTCC2150] Length = 59 Score = 84.5 bits (209), Expect = 4e-15, Method: Composition-based stats. Identities = 32/55 (58%), Positives = 42/55 (76%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 D ++LE+LVCP T+G L L E EL+SK A LAYPIR+G+PIM+V EAR++D Sbjct: 5 MYDRKMLEVLVCPETQGPLKLDVEKDELISKSAKLAYPIRNGIPIMIVDEARKLD 59 >gi|332702782|ref|ZP_08422870.1| UPF0434 protein ycaR [Desulfovibrio africanus str. Walvis Bay] gi|332552931|gb|EGJ49975.1| UPF0434 protein ycaR [Desulfovibrio africanus str. Walvis Bay] Length = 70 Score = 84.5 bits (209), Expect = 4e-15, Method: Composition-based stats. Identities = 25/56 (44%), Positives = 34/56 (60%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 ++ LL+IL CP KG+L L E L+ +K +AYPIR +PIMLV EA + Sbjct: 1 MTLNKDLLDILACPKCKGDLRLTPEEDGLICEKCGVAYPIRDEIPIMLVEEAIPLT 56 >gi|311280169|ref|YP_003942400.1| hypothetical protein Entcl_2868 [Enterobacter cloacae SCF1] gi|308749364|gb|ADO49116.1| protein of unknown function DUF343 [Enterobacter cloacae SCF1] Length = 60 Score = 84.5 bits (209), Expect = 4e-15, Method: Composition-based stats. Identities = 22/56 (39%), Positives = 37/56 (66%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP+ G L + EL+ K +LA+P+R G+P++L +EAR + + Sbjct: 1 MDHRLLEIIACPVCNGKLYYSQDKQELICKLDALAFPLREGIPVLLETEARPMSVE 56 >gi|94267212|ref|ZP_01290814.1| Protein of unknown function DUF343 [delta proteobacterium MLMS-1] gi|93452088|gb|EAT02770.1| Protein of unknown function DUF343 [delta proteobacterium MLMS-1] Length = 58 Score = 84.5 bits (209), Expect = 4e-15, Method: Composition-based stats. Identities = 23/54 (42%), Positives = 32/54 (59%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 ++P+LL IL CP KG + L E L+ L Y IR G+PIML+ EA+ + Sbjct: 1 MLNPELLNILACPQCKGPVQLNEEENGLVCTNCRLLYEIRDGIPIMLIDEAKPL 54 >gi|294340370|emb|CAZ88751.1| conserved hypothetical protein [Thiomonas sp. 3As] Length = 73 Score = 84.5 bits (209), Expect = 5e-15, Method: Composition-based stats. Identities = 23/54 (42%), Positives = 36/54 (66%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 +D +LL++LVCP+ KG+L + EL+ + LAYP+R +P+MLV AR + Sbjct: 1 MDSRLLDLLVCPICKGSLQFDAAAQELICPRDKLAYPVRDDIPLMLVDLARDMT 54 >gi|189184691|ref|YP_001938476.1| hypothetical protein OTT_1784 [Orientia tsutsugamushi str. Ikeda] gi|189181462|dbj|BAG41242.1| hypothetical protein OTT_1784 [Orientia tsutsugamushi str. Ikeda] Length = 55 Score = 84.5 bits (209), Expect = 5e-15, Method: Composition-based stats. Identities = 24/55 (43%), Positives = 37/55 (67%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 I LL ILVCP+TK L + + L+SK+A LAYPI++G+P++L +A ++ Sbjct: 1 MKISTSLLNILVCPVTKSKLVYDEKSSTLISKEARLAYPIKNGIPVLLPDQAIKI 55 >gi|258404846|ref|YP_003197588.1| hypothetical protein Dret_0718 [Desulfohalobium retbaense DSM 5692] gi|257797073|gb|ACV68010.1| protein of unknown function DUF343 [Desulfohalobium retbaense DSM 5692] Length = 67 Score = 84.1 bits (208), Expect = 5e-15, Method: Composition-based stats. Identities = 19/57 (33%), Positives = 32/57 (56%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 +I+ +LL++L CP KG L L+ ++ YP+ G+P+ML+ EA + D Sbjct: 1 MSINKELLDLLACPQCKGELEPTGAEDGLICHSCAVVYPVEDGIPVMLIDEAVSLSD 57 >gi|294085369|ref|YP_003552129.1| hypothetical protein SAR116_1802 [Candidatus Puniceispirillum marinum IMCC1322] gi|292664944|gb|ADE40045.1| protein of unknown function DUF343 [Candidatus Puniceispirillum marinum IMCC1322] Length = 89 Score = 84.1 bits (208), Expect = 5e-15, Method: Composition-based stats. Identities = 29/56 (51%), Positives = 40/56 (71%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 IDP L++ILVCP+ + L ++ EL+S +A AYP+R GVPIML+ EAR +DD Sbjct: 29 MIDPTLMDILVCPIARCPLVYNAKTNELISVQARKAYPVRDGVPIMLIDEARDLDD 84 >gi|319408983|emb|CBI82642.1| conserved hypothetical protein [Bartonella schoenbuchensis R1] Length = 63 Score = 84.1 bits (208), Expect = 5e-15, Method: Composition-based stats. Identities = 33/57 (57%), Positives = 41/57 (71%) Query: 4 TIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 DP++LE+LVCP+T G L+L + EL+S KA LAYPIR GVPIML SEAR + Sbjct: 2 KKMITDPKMLELLVCPITGGTLSLNRKTQELISLKAKLAYPIRDGVPIMLASEARSL 58 >gi|319403999|emb|CBI77587.1| conserved hypothetical protein [Bartonella rochalimae ATCC BAA-1498] Length = 64 Score = 84.1 bits (208), Expect = 5e-15, Method: Composition-based stats. Identities = 35/57 (61%), Positives = 42/57 (73%) Query: 4 TIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 DP++LE+LVCPLTK L+L + EL+S KA LAYPIRSGVPIML SEAR + Sbjct: 2 KKMTTDPKMLELLVCPLTKEPLSLNKKTQELISLKAKLAYPIRSGVPIMLTSEARPL 58 >gi|315499316|ref|YP_004088120.1| hypothetical protein Astex_2315 [Asticcacaulis excentricus CB 48] gi|315417328|gb|ADU13969.1| protein of unknown function DUF343 [Asticcacaulis excentricus CB 48] Length = 78 Score = 84.1 bits (208), Expect = 6e-15, Method: Composition-based stats. Identities = 34/60 (56%), Positives = 41/60 (68%) Query: 4 TIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 IDP+LLE LVCP+T+ LT ELLS A LA+PIRSGVPIMLV +AR+ + Q Sbjct: 17 DTSEIDPRLLEALVCPVTRRPLTYDKTAQELLSPTAGLAFPIRSGVPIMLVDQARRFEPQ 76 >gi|294636899|ref|ZP_06715227.1| tetraacyldisaccharide 4'-kinase [Edwardsiella tarda ATCC 23685] gi|291089890|gb|EFE22451.1| tetraacyldisaccharide 4'-kinase [Edwardsiella tarda ATCC 23685] Length = 58 Score = 84.1 bits (208), Expect = 6e-15, Method: Composition-based stats. Identities = 24/53 (45%), Positives = 34/53 (64%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 +D +LLEI+ CP+ G L E EL+ K LA+P+R G+P+ML EAR + Sbjct: 1 MDHRLLEIVACPVCNGKLVFDQEHQELVCKIDRLAFPLRDGIPVMLECEARTL 53 >gi|319407012|emb|CBI80649.1| conserved hypothetical protein [Bartonella sp. 1-1C] Length = 64 Score = 84.1 bits (208), Expect = 6e-15, Method: Composition-based stats. Identities = 35/57 (61%), Positives = 42/57 (73%) Query: 4 TIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 DP++LE+LVCPLTK L+L + EL+S KA LAYPIRSGVPIML SEAR + Sbjct: 2 KKMTTDPKMLELLVCPLTKEPLSLNKKTQELISLKAKLAYPIRSGVPIMLTSEARPL 58 >gi|296119700|ref|ZP_06838258.1| tetraacyldisaccharide 4'-kinase [Corynebacterium ammoniagenes DSM 20306] gi|295967583|gb|EFG80850.1| tetraacyldisaccharide 4'-kinase [Corynebacterium ammoniagenes DSM 20306] Length = 59 Score = 84.1 bits (208), Expect = 6e-15, Method: Composition-based stats. Identities = 23/54 (42%), Positives = 38/54 (70%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 ++DP L+EILVCP KG L+ + + L++++ +AYPI G+P+MLV +A+ Sbjct: 1 MSLDPALVEILVCPQDKGPLSYLEDEQVLVNERLGIAYPIEDGIPVMLVDDAKP 54 >gi|261867899|ref|YP_003255821.1| hypothetical protein D11S_1220 [Aggregatibacter actinomycetemcomitans D11S-1] gi|261413231|gb|ACX82602.1| hypothetical protein D11S_1220 [Aggregatibacter actinomycetemcomitans D11S-1] Length = 59 Score = 84.1 bits (208), Expect = 6e-15, Method: Composition-based stats. Identities = 17/56 (30%), Positives = 35/56 (62%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 ++ +LLEI+ CP G L + L+ + +AYPI++G+P++L +A+ ++ + Sbjct: 1 MNGKLLEIVACPSCHGRLKYDEQHQRLICRFEKIAYPIKNGIPVLLAEQAQPLNQE 56 >gi|148284097|ref|YP_001248187.1| hypothetical protein OTBS_0199 [Orientia tsutsugamushi str. Boryong] gi|146739536|emb|CAM79265.1| conserved hypothetical protein [Orientia tsutsugamushi str. Boryong] Length = 55 Score = 83.7 bits (207), Expect = 7e-15, Method: Composition-based stats. Identities = 24/55 (43%), Positives = 37/55 (67%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 I LL ILVCP+TK L + + L+SK+A LAYPI++G+P++L +A ++ Sbjct: 1 MKISTSLLNILVCPVTKSKLVYDEKSSTLISKEARLAYPIKNGIPVLLPDQAIRI 55 >gi|240170131|ref|ZP_04748790.1| hypothetical protein MkanA1_12513 [Mycobacterium kansasii ATCC 12478] Length = 72 Score = 83.7 bits (207), Expect = 7e-15, Method: Composition-based stats. Identities = 25/57 (43%), Positives = 36/57 (63%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 ID +LL+ILVCP +G L L+ +G L + + AY I G+P++LV +AR V D Sbjct: 1 MIDEKLLDILVCPADQGPLLLVDDGQALYNPRLRRAYRIEDGIPVLLVDQARDVGDD 57 >gi|225022591|ref|ZP_03711783.1| hypothetical protein CORMATOL_02633 [Corynebacterium matruchotii ATCC 33806] gi|224944499|gb|EEG25708.1| hypothetical protein CORMATOL_02633 [Corynebacterium matruchotii ATCC 33806] Length = 59 Score = 83.7 bits (207), Expect = 7e-15, Method: Composition-based stats. Identities = 22/58 (37%), Positives = 35/58 (60%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 ++DPQLLE+L CP G LT + + L++ + +AYPI +P+ML+ EA + Sbjct: 1 MSLDPQLLEVLACPQDHGPLTYLEDKNVLVNPRLKIAYPIVDDIPVMLIDEAIPYSPE 58 >gi|78223549|ref|YP_385296.1| hypothetical protein Gmet_2346 [Geobacter metallireducens GS-15] gi|78194804|gb|ABB32571.1| conserved hypothetical protein [Geobacter metallireducens GS-15] Length = 62 Score = 83.7 bits (207), Expect = 8e-15, Method: Composition-based stats. Identities = 21/59 (35%), Positives = 33/59 (55%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQG 64 + +LL+IL CP KG + + L+ L YP+R G+P+MLV EA ++ + G Sbjct: 1 MALSSELLKILACPQCKGEVVFQDDEVGLVCDSCRLVYPVRDGIPVMLVDEAEKIGEAG 59 >gi|56708519|ref|YP_170415.1| hypothetical protein FTT_1479c [Francisella tularensis subsp. tularensis SCHU S4] gi|110670990|ref|YP_667547.1| hypothetical protein FTF1479c [Francisella tularensis subsp. tularensis FSC198] gi|115315101|ref|YP_763824.1| hypothetical protein FTH_1362 [Francisella tularensis subsp. holarctica OSU18] gi|118497278|ref|YP_898328.1| hypothetical protein FTN_0682 [Francisella tularensis subsp. novicida U112] gi|134301678|ref|YP_001121646.1| hypothetical protein FTW_0619 [Francisella tularensis subsp. tularensis WY96-3418] gi|224457684|ref|ZP_03666157.1| hypothetical protein FtultM_08634 [Francisella tularensis subsp. tularensis MA00-2987] gi|254368001|ref|ZP_04984021.1| hypothetical protein FTHG_01311 [Francisella tularensis subsp. holarctica 257] gi|254369553|ref|ZP_04985564.1| conserved hypothetical protein [Francisella tularensis subsp. holarctica FSC022] gi|254372651|ref|ZP_04988140.1| conserved hypothetical protein [Francisella tularensis subsp. novicida GA99-3549] gi|254875368|ref|ZP_05248078.1| conserved hypothetical protein [Francisella tularensis subsp. tularensis MA00-2987] gi|290954363|ref|ZP_06558984.1| hypothetical protein FtulhU_09124 [Francisella tularensis subsp. holarctica URFT1] gi|295312210|ref|ZP_06803011.1| hypothetical protein FtulhU_09111 [Francisella tularensis subsp. holarctica URFT1] gi|81597182|sp|Q5NEX7|Y1479_FRATT RecName: Full=UPF0434 protein FTT_1479c gi|122324896|sp|Q0BL47|Y1362_FRATO RecName: Full=UPF0434 protein FTH_1362 gi|123359384|sp|Q14GD0|Y1479_FRAT1 RecName: Full=UPF0434 protein FTF1479c gi|148841322|sp|Q2A2J7|Y1400_FRATH RecName: Full=UPF0434 protein FTL_1400 gi|148841371|sp|A0Q5Q9|Y682_FRATN RecName: Full=UPF0434 protein FTN_0682 gi|166979866|sp|A7NDA9|Y1487_FRATF RecName: Full=UPF0434 protein FTA_1487 gi|56605011|emb|CAG46112.1| conserved hypothetical protein [Francisella tularensis subsp. tularensis SCHU S4] gi|110321323|emb|CAL09495.1| conserved hypothetical protein [Francisella tularensis subsp. tularensis FSC198] gi|115130000|gb|ABI83187.1| conserved hypothetical protein [Francisella tularensis subsp. holarctica OSU18] gi|118423184|gb|ABK89574.1| conserved protein of unknown function [Francisella novicida U112] gi|134049455|gb|ABO46526.1| conserved domain protein [Francisella tularensis subsp. tularensis WY96-3418] gi|134253811|gb|EBA52905.1| hypothetical protein FTHG_01311 [Francisella tularensis subsp. holarctica 257] gi|151570378|gb|EDN36032.1| conserved hypothetical protein [Francisella novicida GA99-3549] gi|157122507|gb|EDO66642.1| conserved hypothetical protein [Francisella tularensis subsp. holarctica FSC022] gi|254841367|gb|EET19803.1| conserved hypothetical protein [Francisella tularensis subsp. tularensis MA00-2987] gi|328676767|gb|AEB27637.1| conserved hypothetical protein [Francisella cf. novicida Fx1] Length = 62 Score = 83.7 bits (207), Expect = 8e-15, Method: Composition-based stats. Identities = 24/56 (42%), Positives = 35/56 (62%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +L +LVCP+ K NL E L+ K LAYPIR +P+MLV EA+++ + Sbjct: 1 MDHSVLNVLVCPICKANLYYDKENQVLVCKADKLAYPIRENIPVMLVEEAKKMTLE 56 >gi|311743631|ref|ZP_07717437.1| tetraacyldisaccharide 4'-kinase [Aeromicrobium marinum DSM 15272] gi|311312761|gb|EFQ82672.1| tetraacyldisaccharide 4'-kinase [Aeromicrobium marinum DSM 15272] Length = 55 Score = 83.7 bits (207), Expect = 8e-15, Method: Composition-based stats. Identities = 27/55 (49%), Positives = 36/55 (65%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 +DP LLEILVCP + L + E +EL+ + LAY +R GVP+MLV EAR + Sbjct: 1 MFLDPALLEILVCPQCRDTLFVDEEASELVCQACGLAYAVRGGVPVMLVDEARTL 55 >gi|167628089|ref|YP_001678589.1| hypothetical protein Fphi_1862 [Francisella philomiragia subsp. philomiragia ATCC 25017] gi|241668628|ref|ZP_04756206.1| hypothetical protein FphipA2_07666 [Francisella philomiragia subsp. philomiragia ATCC 25015] gi|254877162|ref|ZP_05249872.1| conserved hypothetical protein [Francisella philomiragia subsp. philomiragia ATCC 25015] gi|189039047|sp|B0U169|Y1867_FRAP2 RecName: Full=UPF0434 protein Fphi_1862 gi|167598090|gb|ABZ88088.1| conserved hypothetical protein [Francisella philomiragia subsp. philomiragia ATCC 25017] gi|254843183|gb|EET21597.1| conserved hypothetical protein [Francisella philomiragia subsp. philomiragia ATCC 25015] Length = 62 Score = 83.7 bits (207), Expect = 8e-15, Method: Composition-based stats. Identities = 23/56 (41%), Positives = 34/56 (60%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +L +LVCP+ NL E L+ K LAYPIR +P+MLV EA+++ + Sbjct: 1 MDHSVLNVLVCPVCNSNLHYDKENQLLICKADKLAYPIRENIPVMLVEEAKKLTLE 56 >gi|85058975|ref|YP_454677.1| hypothetical protein SG0997 [Sodalis glossinidius str. 'morsitans'] gi|123519658|sp|Q2NUA3|Y997_SODGM RecName: Full=UPF0434 protein SG0997 gi|84779495|dbj|BAE74272.1| conserved hypothetical protein [Sodalis glossinidius str. 'morsitans'] Length = 60 Score = 83.7 bits (207), Expect = 8e-15, Method: Composition-based stats. Identities = 23/53 (43%), Positives = 34/53 (64%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 +D +LLEI+ CP+ G E EL+ K +LAYP+ G+P++L SEAR + Sbjct: 1 MDHRLLEIVACPVCNGKFYYNKERQELICKSDALAYPLCDGIPVLLESEARAI 53 >gi|307293995|ref|ZP_07573839.1| protein of unknown function DUF343 [Sphingobium chlorophenolicum L-1] gi|306880146|gb|EFN11363.1| protein of unknown function DUF343 [Sphingobium chlorophenolicum L-1] Length = 57 Score = 83.7 bits (207), Expect = 9e-15, Method: Composition-based stats. Identities = 28/57 (49%), Positives = 36/57 (63%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 IDP LL LVCP T+ L + EL+S A LA+P+R GVPI+L+ EAR + D Sbjct: 1 MTIDPALLAKLVCPATRTPLRWDAARGELISDAAGLAFPVREGVPILLLREARPLSD 57 >gi|83595038|ref|YP_428790.1| hypothetical protein Rru_A3709 [Rhodospirillum rubrum ATCC 11170] gi|83577952|gb|ABC24503.1| Protein of unknown function DUF343 [Rhodospirillum rubrum ATCC 11170] Length = 64 Score = 83.4 bits (206), Expect = 9e-15, Method: Composition-based stats. Identities = 27/54 (50%), Positives = 38/54 (70%) Query: 9 DPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 DP+LLE+LV P ++ L ++ EL+ A LA+PIR G+PIML+ EAR+ DD Sbjct: 8 DPKLLELLVAPGSQNPLRYDAQAQELIDDIAGLAFPIRDGIPIMLIDEARRFDD 61 >gi|254453362|ref|ZP_05066799.1| tetraacyldisaccharide-1-P 4-kinase [Octadecabacter antarcticus 238] gi|198267768|gb|EDY92038.1| tetraacyldisaccharide-1-P 4-kinase [Octadecabacter antarcticus 238] Length = 52 Score = 83.4 bits (206), Expect = 1e-14, Method: Composition-based stats. Identities = 26/52 (50%), Positives = 36/52 (69%) Query: 12 LLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +LE LVCP +G LT + EL S+ A LAYPIR+G+P++L+ EAR +D Sbjct: 1 MLEALVCPQCQGRLTYDAAAQELTSRAAHLAYPIRAGIPVLLIDEARVIDKD 52 >gi|114776277|ref|ZP_01451322.1| hypothetical protein SPV1_01117 [Mariprofundus ferrooxydans PV-1] gi|114553107|gb|EAU55505.1| hypothetical protein SPV1_01117 [Mariprofundus ferrooxydans PV-1] Length = 56 Score = 83.4 bits (206), Expect = 1e-14, Method: Composition-based stats. Identities = 21/55 (38%), Positives = 30/55 (54%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 +D L+EIL CP KG + E L+ L YPIR +P+ML+ EA ++ Sbjct: 1 MLDQALMEILACPKCKGEVHYNEEKNGLICDACQLQYPIRDEIPVMLIDEASKLT 55 >gi|293390237|ref|ZP_06634571.1| tetraacyldisaccharide 4'-kinase [Aggregatibacter actinomycetemcomitans D7S-1] gi|290950771|gb|EFE00890.1| tetraacyldisaccharide 4'-kinase [Aggregatibacter actinomycetemcomitans D7S-1] Length = 59 Score = 83.4 bits (206), Expect = 1e-14, Method: Composition-based stats. Identities = 17/56 (30%), Positives = 35/56 (62%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 ++ +LLEI+ CP G L + L+ + +AYPI++G+P++L +A+ ++ + Sbjct: 1 MNGRLLEIVACPSCHGRLKYDEQHQRLICRFEKIAYPIKNGIPVLLAEQAQPLNQE 56 >gi|47212770|emb|CAF95204.1| unnamed protein product [Tetraodon nigroviridis] Length = 104 Score = 83.4 bits (206), Expect = 1e-14, Method: Composition-based stats. Identities = 24/59 (40%), Positives = 34/59 (57%) Query: 2 RETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 E D LL+ LVCPL+K L E EL++++ +AYPI G+P M+ EAR + Sbjct: 44 DEVPQTFDTSLLQFLVCPLSKKPLRYEPETNELINEELGIAYPIIDGIPNMIPQEARLL 102 >gi|291401440|ref|XP_002717049.1| PREDICTED: islet cell autoantigen 1,69kDa-like [Oryctolagus cuniculus] Length = 109 Score = 83.4 bits (206), Expect = 1e-14, Method: Composition-based stats. Identities = 23/52 (44%), Positives = 32/52 (61%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEAR 58 DP LLE LVCPL+K L + EL++++ +AYPI G+P M+ AR Sbjct: 44 AFDPALLEFLVCPLSKKPLRYEASTNELINEELGIAYPIIDGIPNMIPQAAR 95 >gi|56460617|ref|YP_155898.1| metal-binding domain-containing protein [Idiomarina loihiensis L2TR] gi|81362179|sp|Q5QU38|Y1511_IDILO RecName: Full=UPF0434 protein IL1511 gi|56179627|gb|AAV82349.1| Uncharacterized conserved protein, possible metal-binding domain [Idiomarina loihiensis L2TR] Length = 65 Score = 83.4 bits (206), Expect = 1e-14, Method: Composition-based stats. Identities = 21/58 (36%), Positives = 33/58 (56%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 ID L IL CP KG LT ++ EL+ + LAYPI +P+++ +AR++ + Sbjct: 1 MAIDKTTLAILACPKCKGKLTYYADKDELVCRGERLAYPIDENIPVLIADKARELSSE 58 >gi|119944663|ref|YP_942343.1| hypothetical protein Ping_0902 [Psychromonas ingrahamii 37] gi|148841375|sp|A1STC9|Y902_PSYIN RecName: Full=UPF0434 protein Ping_0902 gi|119863267|gb|ABM02744.1| protein of unknown function DUF343 [Psychromonas ingrahamii 37] Length = 59 Score = 83.0 bits (205), Expect = 1e-14, Method: Composition-based stats. Identities = 22/57 (38%), Positives = 33/57 (57%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LL+I+ CPL KG L+ EL+ K LAYP+ G+P +L +AR + Sbjct: 1 MLDIKLLDIIACPLCKGKLSYKKNSNELICKFDHLAYPVIDGIPALLKVKARTISSD 57 >gi|149378076|ref|ZP_01895798.1| hypothetical protein MDG893_05709 [Marinobacter algicola DG893] gi|149357645|gb|EDM46145.1| hypothetical protein MDG893_05709 [Marinobacter algicola DG893] Length = 62 Score = 83.0 bits (205), Expect = 1e-14, Method: Composition-based stats. Identities = 23/56 (41%), Positives = 38/56 (67%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +L+ +L CP+ KG+L L TEL+ + ++A+PIR G+P+ML +EAR + Sbjct: 1 MDKKLMALLACPVCKGDLKLNDAKTELVCYQDAMAFPIREGIPVMLATEARTLTTD 56 >gi|238897473|ref|YP_002923150.1| hypothetical protein HDEF_0234 [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)] gi|259646619|sp|C4K359|Y234_HAMD5 RecName: Full=UPF0434 protein HDEF_0234 gi|229465228|gb|ACQ67002.1| conserved hypothetical protein [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)] Length = 59 Score = 83.0 bits (205), Expect = 1e-14, Method: Composition-based stats. Identities = 22/55 (40%), Positives = 33/55 (60%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 +D LLEI+ CP+ G L + EL+ + LAYPI +G+P++L S AR + Sbjct: 1 MDHHLLEIIACPICNGKLHFDKKNLELICQTDELAYPISNGIPVLLESHARDLSS 55 >gi|319898675|ref|YP_004158768.1| hypothetical protein BARCL_0503 [Bartonella clarridgeiae 73] gi|319402639|emb|CBI76184.1| conserved protein of unknown function [Bartonella clarridgeiae 73] Length = 64 Score = 83.0 bits (205), Expect = 1e-14, Method: Composition-based stats. Identities = 34/57 (59%), Positives = 42/57 (73%) Query: 4 TIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 DP++LE+LVCP+TK L+L + EL+S KA LAYPIRSGVPIML SEAR + Sbjct: 2 KKMITDPKMLELLVCPITKEPLSLNKKTQELISLKAKLAYPIRSGVPIMLASEARPL 58 >gi|301755554|ref|XP_002913644.1| PREDICTED: protein preY, mitochondrial-like [Ailuropoda melanoleuca] Length = 164 Score = 83.0 bits (205), Expect = 1e-14, Method: Composition-based stats. Identities = 23/52 (44%), Positives = 32/52 (61%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEAR 58 DP LLE LVCPL+K L + EL++++ +AYPI G+P M+ AR Sbjct: 99 AFDPALLEFLVCPLSKKPLRYEASTNELINEELGIAYPIIDGIPNMIPQAAR 150 >gi|259505647|ref|ZP_05748549.1| conserved hypothetical protein [Corynebacterium efficiens YS-314] gi|259166778|gb|EEW51332.1| conserved hypothetical protein [Corynebacterium efficiens YS-314] Length = 62 Score = 83.0 bits (205), Expect = 1e-14, Method: Composition-based stats. Identities = 21/56 (37%), Positives = 35/56 (62%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 ++DP+LLE+L CP KG L + L++++ LAY I G+P++L+ EA + Sbjct: 4 MSLDPKLLEVLACPKDKGPLRYLESEQLLVNERLGLAYRIDDGIPVLLIDEATEWT 59 >gi|262184148|ref|ZP_06043569.1| hypothetical protein CaurA7_09167 [Corynebacterium aurimucosum ATCC 700975] Length = 59 Score = 83.0 bits (205), Expect = 1e-14, Method: Composition-based stats. Identities = 23/54 (42%), Positives = 36/54 (66%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 ++D QLL+ILVCP KG L ++E L++++ +AYPI + +P+MLV A Sbjct: 1 MSLDSQLLDILVCPQDKGPLKYLAEEQVLVNERLGVAYPIENDIPVMLVDHATP 54 >gi|320354898|ref|YP_004196237.1| hypothetical protein Despr_2812 [Desulfobulbus propionicus DSM 2032] gi|320123400|gb|ADW18946.1| protein of unknown function DUF343 [Desulfobulbus propionicus DSM 2032] Length = 57 Score = 83.0 bits (205), Expect = 1e-14, Method: Composition-based stats. Identities = 23/57 (40%), Positives = 34/57 (59%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 I +LLEIL CP KG + L E ++ + L YP+R +PIML+ EA+ +D + Sbjct: 1 MIKQELLEILACPQCKGPVELNPESNGIVCRACGLLYPVRDDIPIMLIDEAKPLDKE 57 >gi|25028095|ref|NP_738149.1| hypothetical protein CE1539 [Corynebacterium efficiens YS-314] gi|23493379|dbj|BAC18349.1| conserved hypothetical protein [Corynebacterium efficiens YS-314] Length = 69 Score = 83.0 bits (205), Expect = 1e-14, Method: Composition-based stats. Identities = 21/56 (37%), Positives = 35/56 (62%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 ++DP+LLE+L CP KG L + L++++ LAY I G+P++L+ EA + Sbjct: 11 MSLDPKLLEVLACPKDKGPLRYLESEQLLVNERLGLAYRIDDGIPVLLIDEATEWT 66 >gi|209734166|gb|ACI67952.1| preY, mitochondrial precursor [Salmo salar] Length = 119 Score = 82.6 bits (204), Expect = 2e-14, Method: Composition-based stats. Identities = 22/61 (36%), Positives = 36/61 (59%) Query: 3 ETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 + D LLE LVCPL+K L + EL++++ +AYPI G+P M+ ++AR + + Sbjct: 43 KDTLPFDTSLLEFLVCPLSKKQLRYEEKTNELINEELGIAYPIIDGIPNMIPTDARLIKN 102 Query: 63 Q 63 Sbjct: 103 D 103 >gi|198282789|ref|YP_002219110.1| hypothetical protein Lferr_0650 [Acidithiobacillus ferrooxidans ATCC 53993] gi|218666425|ref|YP_002424986.1| hypothetical protein AFE_0490 [Acidithiobacillus ferrooxidans ATCC 23270] gi|198247310|gb|ACH82903.1| protein of unknown function DUF343 [Acidithiobacillus ferrooxidans ATCC 53993] gi|218518638|gb|ACK79224.1| conserved hypothetical protein [Acidithiobacillus ferrooxidans ATCC 23270] Length = 60 Score = 82.2 bits (203), Expect = 2e-14, Method: Composition-based stats. Identities = 21/58 (36%), Positives = 36/58 (62%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +ID +LL++L CP KG+L ++ L + L YPIR +P++L+ EA+ +D+ Sbjct: 1 MSIDHRLLDLLACPQCKGSLQPCAQRQALCCPRCHLQYPIRDDIPVLLIDEAKPYEDK 58 >gi|158521925|ref|YP_001529795.1| hypothetical protein Dole_1914 [Desulfococcus oleovorans Hxd3] gi|158510751|gb|ABW67718.1| protein of unknown function DUF343 [Desulfococcus oleovorans Hxd3] Length = 58 Score = 82.2 bits (203), Expect = 2e-14, Method: Composition-based stats. Identities = 24/56 (42%), Positives = 31/56 (55%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 +I +LLEIL CP KG++ L+ L Y IR G+PIML+ EA VD Sbjct: 1 MSIKKELLEILACPKCKGDIHTDDAENWLICDACRLKYEIRDGIPIMLIEEAVSVD 56 >gi|126308924|ref|XP_001380185.1| PREDICTED: hypothetical protein [Monodelphis domestica] Length = 115 Score = 82.2 bits (203), Expect = 2e-14, Method: Composition-based stats. Identities = 22/54 (40%), Positives = 32/54 (59%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 DP LL+ LVCPL+K L EL++++ +AYPI G+P M+ AR + Sbjct: 50 AFDPALLDFLVCPLSKKPLRYEMSTNELINEELGIAYPIIDGIPNMIPQAARMI 103 >gi|209730776|gb|ACI66257.1| preY, mitochondrial precursor [Salmo salar] Length = 119 Score = 82.2 bits (203), Expect = 2e-14, Method: Composition-based stats. Identities = 22/61 (36%), Positives = 36/61 (59%) Query: 3 ETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 + D LLE LVCPL+K L + EL++++ +AYPI G+P M+ ++AR + + Sbjct: 43 KDTLPFDTSLLEFLVCPLSKKQLRYEEKTNELINEELGIAYPIIDGIPNMIPTDARLIKN 102 Query: 63 Q 63 Sbjct: 103 D 103 >gi|148224974|ref|NP_001082841.1| hypothetical protein LOC555881 [Danio rerio] gi|126631588|gb|AAI34054.1| Zgc:162634 protein [Danio rerio] Length = 110 Score = 82.2 bits (203), Expect = 2e-14, Method: Composition-based stats. Identities = 22/54 (40%), Positives = 33/54 (61%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 D LLE+LVCPL+K L EL++++ +AYPI G+P M+ +AR + Sbjct: 45 PFDEALLEVLVCPLSKKPLRYNGSSNELINEELGIAYPIIDGIPNMIPQDARMI 98 >gi|126330874|ref|XP_001375963.1| PREDICTED: hypothetical protein [Monodelphis domestica] Length = 115 Score = 82.2 bits (203), Expect = 2e-14, Method: Composition-based stats. Identities = 22/54 (40%), Positives = 32/54 (59%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 DP LL+ LVCPL+K L EL++++ +AYPI G+P M+ AR + Sbjct: 50 AFDPALLDFLVCPLSKKPLRYEMSTNELINEELGIAYPIIDGIPNMIPQAARMI 103 >gi|308273831|emb|CBX30432.1| UPF0434 protein Bcep18194_A5877 [uncultured Desulfobacterium sp.] Length = 55 Score = 82.2 bits (203), Expect = 2e-14, Method: Composition-based stats. Identities = 24/55 (43%), Positives = 32/55 (58%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 I +LLEIL CP KG + L G L+ K L Y IR G+P+ML+ EA+ + Sbjct: 1 MTISKELLEILACPKCKGRIHLNDAGDGLICKNCKLLYEIRDGIPVMLIDEAKPI 55 >gi|332306131|ref|YP_004433982.1| hypothetical protein Glaag_1764 [Glaciecola agarilytica 4H-3-7+YE-5] gi|332173460|gb|AEE22714.1| protein of unknown function DUF343 [Glaciecola agarilytica 4H-3-7+YE-5] Length = 67 Score = 82.2 bits (203), Expect = 2e-14, Method: Composition-based stats. Identities = 21/61 (34%), Positives = 34/61 (55%), Gaps = 3/61 (4%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTE---LLSKKASLAYPIRSGVPIMLVSEARQVDD 62 D +LLEI+ CP+ KG L L + L+ + LAYPI +P++L +EA+ + Sbjct: 1 MAFDKKLLEIVACPVCKGTLILNKDANGNERLVCRLDRLAYPIEQNIPVLLETEAQALSS 60 Query: 63 Q 63 + Sbjct: 61 E 61 >gi|305682028|ref|ZP_07404832.1| conserved hypothetical protein [Corynebacterium matruchotii ATCC 14266] gi|305658501|gb|EFM48004.1| conserved hypothetical protein [Corynebacterium matruchotii ATCC 14266] Length = 59 Score = 81.8 bits (202), Expect = 3e-14, Method: Composition-based stats. Identities = 22/58 (37%), Positives = 35/58 (60%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 ++DPQLLE+L CP G LT + + L++ + +AYPI +P+ML+ EA + Sbjct: 1 MSLDPQLLEVLACPQDHGPLTYLEDKNVLVNPRLKIAYPIIDDIPVMLIDEATPYSLE 58 >gi|120554659|ref|YP_959010.1| hypothetical protein Maqu_1739 [Marinobacter aquaeolei VT8] gi|148841336|sp|A1U1F4|Y1739_MARAV RecName: Full=UPF0434 protein Maqu_1739 gi|120324508|gb|ABM18823.1| protein of unknown function DUF343 [Marinobacter aquaeolei VT8] Length = 62 Score = 81.8 bits (202), Expect = 3e-14, Method: Composition-based stats. Identities = 24/56 (42%), Positives = 36/56 (64%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LL +L CP+ KG L L TEL+ + ++A+PIR G+P+ML EAR + Sbjct: 1 MDKKLLAMLACPVCKGELKLNDARTELICYQDAMAFPIREGIPVMLAVEARTLSTD 56 >gi|297673953|ref|XP_002815009.1| PREDICTED: protein preY, mitochondrial-like [Pongo abelii] Length = 113 Score = 81.8 bits (202), Expect = 3e-14, Method: Composition-based stats. Identities = 23/52 (44%), Positives = 32/52 (61%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEAR 58 DP LLE LVCPL+K L + EL++++ +AYPI G+P M+ AR Sbjct: 49 AFDPALLEFLVCPLSKKPLRYEASTNELINEELGIAYPIIDGIPNMIPQAAR 100 >gi|315634136|ref|ZP_07889425.1| tetraacyldisaccharide 4'-kinase [Aggregatibacter segnis ATCC 33393] gi|315477386|gb|EFU68129.1| tetraacyldisaccharide 4'-kinase [Aggregatibacter segnis ATCC 33393] Length = 59 Score = 81.8 bits (202), Expect = 3e-14, Method: Composition-based stats. Identities = 19/54 (35%), Positives = 33/54 (61%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 ++ QLL+I+ CP G+L + L+ + LAYPI++G+PI+L +A + Sbjct: 1 MNKQLLDIVACPTCHGHLEYDEQHQRLICRIEKLAYPIKNGIPILLAEQAETLS 54 >gi|187931503|ref|YP_001891487.1| hypothetical protein FTM_0733 [Francisella tularensis subsp. mediasiatica FSC147] gi|226708055|sp|B2SG50|Y733_FRATM RecName: Full=UPF0434 protein FTM_0733 gi|187712412|gb|ACD30709.1| conserved domain protein [Francisella tularensis subsp. mediasiatica FSC147] Length = 62 Score = 81.8 bits (202), Expect = 3e-14, Method: Composition-based stats. Identities = 24/56 (42%), Positives = 35/56 (62%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +L +LVCP+ K NL E L+ K LAYPIR +P+MLV EA+++ + Sbjct: 1 MDHSVLNVLVCPICKANLYYGKENQVLVCKADKLAYPIRENIPVMLVEEAKKMTLE 56 >gi|225704868|gb|ACO08280.1| preY, mitochondrial precursor [Oncorhynchus mykiss] Length = 111 Score = 81.8 bits (202), Expect = 3e-14, Method: Composition-based stats. Identities = 22/61 (36%), Positives = 36/61 (59%) Query: 3 ETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 + D LLE LVCPL+K L + EL++++ +AYPI G+P M+ ++AR + + Sbjct: 43 KDALPFDTSLLEFLVCPLSKKQLRYEEKTNELINEELGIAYPIIDGIPNMIPTDARLIKN 102 Query: 63 Q 63 Sbjct: 103 D 103 >gi|239993686|ref|ZP_04714210.1| hypothetical protein AmacA2_04281 [Alteromonas macleodii ATCC 27126] Length = 64 Score = 81.8 bits (202), Expect = 3e-14, Method: Composition-based stats. Identities = 20/58 (34%), Positives = 35/58 (60%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 D +LLE+L CP+ KG L L + T+L+ + LA+ I+ G+P+++ S+A + Sbjct: 1 MAFDKKLLEVLACPVCKGKLVLSDDSTQLVCRFDRLAFDIKDGIPVLIESKATALSLD 58 >gi|251792696|ref|YP_003007422.1| hypothetical protein NT05HA_0960 [Aggregatibacter aphrophilus NJ8700] gi|247534089|gb|ACS97335.1| conserved domain protein [Aggregatibacter aphrophilus NJ8700] Length = 59 Score = 81.8 bits (202), Expect = 3e-14, Method: Composition-based stats. Identities = 18/54 (33%), Positives = 31/54 (57%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 ++ +LLEI+ CP G L + L+ + LAYPI++G+P++L +A Sbjct: 1 MNGKLLEIVACPTCHGRLEYDEQHQRLICRFEKLAYPIKNGIPVLLAEQAETFS 54 >gi|325674257|ref|ZP_08153946.1| hypothetical protein HMPREF0724_11728 [Rhodococcus equi ATCC 33707] gi|325554937|gb|EGD24610.1| hypothetical protein HMPREF0724_11728 [Rhodococcus equi ATCC 33707] Length = 71 Score = 81.8 bits (202), Expect = 3e-14, Method: Composition-based stats. Identities = 25/57 (43%), Positives = 35/57 (61%), Gaps = 1/57 (1%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 IDP LL IL CP KG L L+ + L + + AYPI +G+P++L+ EAR V + Sbjct: 1 MAIDPTLLSILACPQDKGPLLLVGDE-VLYNPRLRRAYPIENGIPVLLIDEARDVTE 56 >gi|114794358|pdb|2HF1|A Chain A, Crystal Structure Of The Putative Tetraacyldisaccharide-1-P 4-Kinase From Chromobacterium Violaceum. Nesg Target Cvr39. gi|114794359|pdb|2HF1|B Chain B, Crystal Structure Of The Putative Tetraacyldisaccharide-1-P 4-Kinase From Chromobacterium Violaceum. Nesg Target Cvr39 Length = 68 Score = 81.8 bits (202), Expect = 3e-14, Method: Composition-based stats. Identities = 26/55 (47%), Positives = 34/55 (61%) Query: 9 DPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 D + LEILVCPL KG L EL+ K LA+PI+ G+P L SEAR++ + Sbjct: 2 DAKFLEILVCPLCKGPLVFDKSKDELICKGDRLAFPIKDGIPXXLESEARELAPE 56 >gi|92113712|ref|YP_573640.1| hypothetical protein Csal_1588 [Chromohalobacter salexigens DSM 3043] gi|122420057|sp|Q1QX67|Y1588_CHRSD RecName: Full=UPF0434 protein Csal_1588 gi|91796802|gb|ABE58941.1| protein of unknown function DUF343 [Chromohalobacter salexigens DSM 3043] Length = 71 Score = 81.8 bits (202), Expect = 3e-14, Method: Composition-based stats. Identities = 22/56 (39%), Positives = 31/56 (55%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LL +LVCP +G L E EL LA+PI +P+ML +AR +D Sbjct: 1 MDKELLAMLVCPRCQGKLKYDRERAELKCHFDGLAFPIEDEIPVMLEEQARHMDAD 56 >gi|74002229|ref|XP_544975.2| PREDICTED: hypothetical protein XP_544975 [Canis familiaris] Length = 175 Score = 81.8 bits (202), Expect = 3e-14, Method: Composition-based stats. Identities = 23/52 (44%), Positives = 32/52 (61%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEAR 58 DP LLE LVCPL+K L + EL++++ +AYPI G+P M+ AR Sbjct: 110 AFDPALLEFLVCPLSKKPLRYEASTNELINEELGIAYPIIDGIPNMIPQAAR 161 >gi|296136135|ref|YP_003643377.1| protein of unknown function DUF343 [Thiomonas intermedia K12] gi|295796257|gb|ADG31047.1| protein of unknown function DUF343 [Thiomonas intermedia K12] Length = 75 Score = 81.8 bits (202), Expect = 3e-14, Method: Composition-based stats. Identities = 23/56 (41%), Positives = 36/56 (64%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 +D +LL++LVCP+ KG+L + EL+ + LAYP+R +P+MLV AR + Sbjct: 1 MPVDSRLLDLLVCPICKGSLQFDAAAQELICPRDKLAYPVRDDIPLMLVDLARDMT 56 >gi|300781254|ref|ZP_07091108.1| tetraacyldisaccharide 4'-kinase [Corynebacterium genitalium ATCC 33030] gi|300532961|gb|EFK54022.1| tetraacyldisaccharide 4'-kinase [Corynebacterium genitalium ATCC 33030] Length = 66 Score = 81.4 bits (201), Expect = 4e-14, Method: Composition-based stats. Identities = 23/59 (38%), Positives = 34/59 (57%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 M +DPQLLE+L CP KG L E L++ + +AY I G+P++L+ EA+ Sbjct: 1 MTADKLTLDPQLLEVLACPQDKGPLDYDHEEQLLINPRMGIAYRIDDGIPVLLIDEAQP 59 >gi|109898102|ref|YP_661357.1| hypothetical protein Patl_1782 [Pseudoalteromonas atlantica T6c] gi|122972026|sp|Q15UY5|Y1782_PSEA6 RecName: Full=UPF0434 protein Patl_1782 gi|109700383|gb|ABG40303.1| protein of unknown function DUF343 [Pseudoalteromonas atlantica T6c] Length = 67 Score = 81.4 bits (201), Expect = 4e-14, Method: Composition-based stats. Identities = 21/61 (34%), Positives = 33/61 (54%), Gaps = 3/61 (4%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTE---LLSKKASLAYPIRSGVPIMLVSEARQVDD 62 D +LLEI+ CP+ KG L L + L+ + LAYPI +P++L +EA + Sbjct: 1 MAFDKKLLEIVACPVCKGTLILNKDSNGNERLVCRFDRLAYPIEQNIPVLLETEALVLSS 60 Query: 63 Q 63 + Sbjct: 61 E 61 >gi|109074967|ref|XP_001100687.1| PREDICTED: protein preY, mitochondrial-like isoform 2 [Macaca mulatta] Length = 114 Score = 81.4 bits (201), Expect = 4e-14, Method: Composition-based stats. Identities = 23/52 (44%), Positives = 33/52 (63%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEAR 58 +DP LLE LVCPL+K L + EL++++ +AYPI G+P M+ AR Sbjct: 49 ALDPALLEFLVCPLSKKPLRYEASTNELINEELGIAYPIIDGIPNMIPQAAR 100 >gi|332141281|ref|YP_004427019.1| hypothetical protein MADE_1009415 [Alteromonas macleodii str. 'Deep ecotype'] gi|226696151|sp|B4RYE3|Y1858_ALTMD RecName: Full=UPF0434 protein MADE_01858 gi|327551303|gb|AEA98021.1| hypothetical protein MADE_1009415 [Alteromonas macleodii str. 'Deep ecotype'] Length = 64 Score = 81.4 bits (201), Expect = 4e-14, Method: Composition-based stats. Identities = 20/58 (34%), Positives = 35/58 (60%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 D +LLE+L CP+ KG L L + T+L+ + LA+ I+ G+P+++ S+A + Sbjct: 1 MAFDKKLLEVLACPVCKGKLVLNEDMTQLVCRFDRLAFDIKDGIPVLIESKATALSLD 58 >gi|206889424|ref|YP_002249791.1| hypothetical protein THEYE_A2002 [Thermodesulfovibrio yellowstonii DSM 11347] gi|206741362|gb|ACI20419.1| conserved domain protein [Thermodesulfovibrio yellowstonii DSM 11347] Length = 58 Score = 81.4 bits (201), Expect = 4e-14, Method: Composition-based stats. Identities = 25/58 (43%), Positives = 38/58 (65%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+VCP KG+L E L+ K S+ YPIR +PI+L+ EA++++ Q Sbjct: 1 MPLDKELLEIIVCPKCKGDLIYEEEKERLVCKNCSVYYPIREDIPILLIEEAKKLETQ 58 >gi|269128259|ref|YP_003301629.1| hypothetical protein Tcur_4062 [Thermomonospora curvata DSM 43183] gi|268313217|gb|ACY99591.1| protein of unknown function DUF343 [Thermomonospora curvata DSM 43183] Length = 58 Score = 81.1 bits (200), Expect = 4e-14, Method: Composition-based stats. Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 1/55 (1%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSK-KASLAYPIRSGVPIMLVSEARQ 59 +D LL+IL CP +G L + EL+ + AYP+R +P++LV EAR Sbjct: 1 MKLDSWLLDILACPNCRGALRADEKADELVCTGECGYAYPVRDDIPVLLVDEART 55 >gi|113460802|ref|YP_718869.1| hypothetical protein HS_0657 [Haemophilus somnus 129PT] gi|123327237|sp|Q0I2X6|Y657_HAES1 RecName: Full=UPF0434 protein HS_0657 gi|112822845|gb|ABI24934.1| conserved hypothetical protein [Haemophilus somnus 129PT] Length = 65 Score = 81.1 bits (200), Expect = 4e-14, Method: Composition-based stats. Identities = 20/54 (37%), Positives = 34/54 (62%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 ++ +LLEI+ CP+ +G L SE +L+ +AYPI+ G+PI+L +A + Sbjct: 1 MNGRLLEIVACPICQGRLKYDSENEQLICHFDHIAYPIKQGIPILLSDQAISLS 54 >gi|55622894|ref|XP_517336.1| PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase subunit Y isoform 2 [Pan troglodytes] gi|332819802|ref|XP_003310433.1| PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase subunit Y [Pan troglodytes] Length = 114 Score = 81.1 bits (200), Expect = 5e-14, Method: Composition-based stats. Identities = 23/52 (44%), Positives = 32/52 (61%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEAR 58 DP LLE LVCPL+K L + EL++++ +AYPI G+P M+ AR Sbjct: 49 AFDPALLEFLVCPLSKKPLRYEASTNELINEELGIAYPIIDGIPNMIPQAAR 100 >gi|260835069|ref|XP_002612532.1| hypothetical protein BRAFLDRAFT_214423 [Branchiostoma floridae] gi|229297909|gb|EEN68541.1| hypothetical protein BRAFLDRAFT_214423 [Branchiostoma floridae] Length = 72 Score = 81.1 bits (200), Expect = 5e-14, Method: Composition-based stats. Identities = 23/51 (45%), Positives = 34/51 (66%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEAR 58 D +LEILVCPL+K L E +EL+S + +AYPI +G+P ++ +AR Sbjct: 3 FDTNMLEILVCPLSKKPLRYDPEKSELVSDELGVAYPIVNGIPNLIPEDAR 53 >gi|284029563|ref|YP_003379494.1| hypothetical protein Kfla_1599 [Kribbella flavida DSM 17836] gi|283808856|gb|ADB30695.1| protein of unknown function DUF343 [Kribbella flavida DSM 17836] Length = 68 Score = 81.1 bits (200), Expect = 5e-14, Method: Composition-based stats. Identities = 24/64 (37%), Positives = 37/64 (57%), Gaps = 2/64 (3%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKAS--LAYPIRSGVPIMLVSEAR 58 M + N+DP LL ILVCP + + + EL+ A LAYP+R +P++L+ EAR Sbjct: 1 MAASKINLDPDLLAILVCPKCRSEFRVDDDANELVCTNAGCALAYPVRDDIPVLLIDEAR 60 Query: 59 QVDD 62 + + Sbjct: 61 ETKE 64 >gi|227548149|ref|ZP_03978198.1| conserved hypothetical protein [Corynebacterium lipophiloflavum DSM 44291] gi|227079811|gb|EEI17774.1| conserved hypothetical protein [Corynebacterium lipophiloflavum DSM 44291] Length = 61 Score = 81.1 bits (200), Expect = 6e-14, Method: Composition-based stats. Identities = 20/56 (35%), Positives = 36/56 (64%) Query: 4 TIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 T+ ++DP+LL++L CP KG L L++++ +AY I G+P++L+ EA+ Sbjct: 2 TLMSLDPKLLDVLACPQDKGPLVFNEAEQLLINERLGIAYRIDDGIPVLLIDEAQT 57 >gi|119626427|gb|EAX06022.1| hCG2042259 [Homo sapiens] Length = 122 Score = 80.7 bits (199), Expect = 6e-14, Method: Composition-based stats. Identities = 23/52 (44%), Positives = 33/52 (63%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEAR 58 + DP LLE LVCPL+K L + EL++++ +AYPI G+P M+ AR Sbjct: 57 DFDPALLEFLVCPLSKKPLRYEASTNELINEELGIAYPIIDGIPNMIPQAAR 108 >gi|332526252|ref|ZP_08402381.1| hypothetical protein RBXJA2T_10329 [Rubrivivax benzoatilyticus JA2] gi|332110086|gb|EGJ10714.1| hypothetical protein RBXJA2T_10329 [Rubrivivax benzoatilyticus JA2] Length = 65 Score = 80.7 bits (199), Expect = 7e-14, Method: Composition-based stats. Identities = 24/60 (40%), Positives = 39/60 (65%), Gaps = 4/60 (6%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEG----TELLSKKASLAYPIRSGVPIMLVSEARQVD 61 +D +L+++LVCP+ KG L + + T+L+ LA+PIR G+P+ML +EAR +D Sbjct: 1 MTLDHRLIDLLVCPVCKGPLEVSRDELQRPTDLVCNADRLAFPIRDGIPVMLETEARSLD 60 >gi|260914320|ref|ZP_05920789.1| tetraacyldisaccharide 4'-kinase [Pasteurella dagmatis ATCC 43325] gi|260631421|gb|EEX49603.1| tetraacyldisaccharide 4'-kinase [Pasteurella dagmatis ATCC 43325] Length = 67 Score = 80.7 bits (199), Expect = 7e-14, Method: Composition-based stats. Identities = 22/56 (39%), Positives = 34/56 (60%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 N+D +LLEI+ CP+ G LTL L+ + +AY I G+P++L +A Q+ D Sbjct: 5 NMDSKLLEIVACPMCHGRLTLDKNKQHLVCQFDKVAYVINQGIPVLLAEQAIQLAD 60 >gi|126667247|ref|ZP_01738220.1| hypothetical protein MELB17_14932 [Marinobacter sp. ELB17] gi|126628192|gb|EAZ98816.1| hypothetical protein MELB17_14932 [Marinobacter sp. ELB17] Length = 62 Score = 80.7 bits (199), Expect = 7e-14, Method: Composition-based stats. Identities = 25/56 (44%), Positives = 38/56 (67%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LL +L CP+ KG L L E TELL + ++A+P+R G+P+ML +EAR + Sbjct: 1 MDKKLLALLACPVCKGELKLNDEKTELLCYQDAMAFPLREGIPVMLATEARTLSTD 56 >gi|149033235|gb|EDL88036.1| similar to RIKEN cDNA 2610022G08, isoform CRA_b [Rattus norvegicus] Length = 161 Score = 80.7 bits (199), Expect = 7e-14, Method: Composition-based stats. Identities = 22/53 (41%), Positives = 30/53 (56%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 P LL+ LVCPL+K L + EL++ + +AYPI GVP M+ AR Sbjct: 47 TFHPALLQFLVCPLSKKPLRYDASTNELINDELGIAYPIIDGVPNMIPQAART 99 >gi|145295539|ref|YP_001138360.1| hypothetical protein cgR_1467 [Corynebacterium glutamicum R] gi|140845459|dbj|BAF54458.1| hypothetical protein [Corynebacterium glutamicum R] Length = 59 Score = 80.7 bits (199), Expect = 7e-14, Method: Composition-based stats. Identities = 22/56 (39%), Positives = 36/56 (64%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 ++DPQLLE+L CP KG L + L++++ +LAY I G+P++L+ EA + Sbjct: 1 MSLDPQLLEVLACPKDKGPLRYLKSEQLLVNERLNLAYRIDDGIPVLLIDEATEWT 56 >gi|77918866|ref|YP_356681.1| hypothetical protein Pcar_1262 [Pelobacter carbinolicus DSM 2380] gi|77544949|gb|ABA88511.1| conserved hypothetical protein [Pelobacter carbinolicus DSM 2380] Length = 65 Score = 80.3 bits (198), Expect = 7e-14, Method: Composition-based stats. Identities = 22/57 (38%), Positives = 33/57 (57%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 I +LLEIL CP KG + + L+ + L YP+ G+P+MLV EA+ ++D Sbjct: 1 MAISQELLEILACPQCKGAVRQVEAPESLICDRCCLKYPVEDGIPVMLVEEAQPLED 57 >gi|54023954|ref|YP_118196.1| hypothetical protein nfa19860 [Nocardia farcinica IFM 10152] gi|54015462|dbj|BAD56832.1| hypothetical protein [Nocardia farcinica IFM 10152] Length = 76 Score = 80.3 bits (198), Expect = 8e-14, Method: Composition-based stats. Identities = 28/66 (42%), Positives = 38/66 (57%), Gaps = 4/66 (6%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTE---LLSKKASLAYPIRSGVPIMLVSEA 57 M E +DP LLE+L CP KG L L+ + L + + AYPI +G+P++LV EA Sbjct: 1 MSERTV-LDPTLLELLACPQDKGPLLLVRDNAGADVLYNPRLRRAYPIENGIPVLLVDEA 59 Query: 58 RQVDDQ 63 R V D Sbjct: 60 RDVADD 65 >gi|296486690|gb|DAA28803.1| phosphatidylinositol glycan anchor biosynthesis, class Y precursor [Bos taurus] Length = 114 Score = 80.3 bits (198), Expect = 8e-14, Method: Composition-based stats. Identities = 22/52 (42%), Positives = 31/52 (59%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEAR 58 D LLE LVCPL+K L + EL++++ +AYPI G+P M+ AR Sbjct: 49 AFDQALLEFLVCPLSKKPLRYEASTNELINEELGIAYPIIDGIPNMIPQAAR 100 >gi|148672795|gb|EDL04742.1| phosphatidylinositol glycan anchor biosynthesis, class Y, isoform CRA_a [Mus musculus] Length = 115 Score = 80.3 bits (198), Expect = 8e-14, Method: Composition-based stats. Identities = 22/60 (36%), Positives = 34/60 (56%) Query: 2 RETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 E P LL+ LVCPL+K L + EL++++ +AYPI G+P M+ AR++ Sbjct: 44 AEQPHTFHPALLQFLVCPLSKKPLRYEASTNELVNEELGIAYPIIDGIPNMIPQAARRMS 103 >gi|148265255|ref|YP_001231961.1| hypothetical protein Gura_3227 [Geobacter uraniireducens Rf4] gi|146398755|gb|ABQ27388.1| protein of unknown function DUF343 [Geobacter uraniireducens Rf4] Length = 56 Score = 80.3 bits (198), Expect = 8e-14, Method: Composition-based stats. Identities = 24/55 (43%), Positives = 35/55 (63%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 + +LL+IL CP KG L L+++ LL + L +PIR G+P+MLV EA Q+ Sbjct: 1 MALSQELLDILACPKCKGELRLLADDAGLLCETCRLRFPIRDGIPVMLVDEAEQI 55 >gi|19552622|ref|NP_600624.1| hypothetical protein NCgl1351 [Corynebacterium glutamicum ATCC 13032] gi|62390290|ref|YP_225692.1| hypothetical protein cg1592 [Corynebacterium glutamicum ATCC 13032] gi|21324173|dbj|BAB98798.1| Uncharacterized BCR [Corynebacterium glutamicum ATCC 13032] gi|41325627|emb|CAF21416.1| conserved hypothetical protein [Corynebacterium glutamicum ATCC 13032] Length = 59 Score = 80.3 bits (198), Expect = 8e-14, Method: Composition-based stats. Identities = 22/56 (39%), Positives = 36/56 (64%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 ++DPQLLE+L CP KG L + L++++ +LAY I G+P++L+ EA + Sbjct: 1 MSLDPQLLEVLACPKDKGPLRYLESEQLLVNERLNLAYRIDDGIPVLLIDEATEWT 56 >gi|119897762|ref|YP_932975.1| hypothetical protein azo1471 [Azoarcus sp. BH72] gi|148841327|sp|A1K5I3|Y1471_AZOSB RecName: Full=UPF0434 protein azo1471 gi|119670175|emb|CAL94088.1| conserved hypothetical protein [Azoarcus sp. BH72] Length = 62 Score = 80.3 bits (198), Expect = 9e-14, Method: Composition-based stats. Identities = 24/45 (53%), Positives = 32/45 (71%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIM 52 +D +LLEILVCPL KG L + + EL+ K LA+PIR G+P+M Sbjct: 1 MDARLLEILVCPLCKGPLDYLKDKQELVCKADRLAFPIRDGIPVM 45 >gi|170719184|ref|YP_001784327.1| hypothetical protein HSM_0997 [Haemophilus somnus 2336] gi|226696070|sp|B0UT78|Y997_HAES2 RecName: Full=UPF0434 protein HSM_0997 gi|168827313|gb|ACA32684.1| protein of unknown function DUF343 [Haemophilus somnus 2336] Length = 65 Score = 80.3 bits (198), Expect = 9e-14, Method: Composition-based stats. Identities = 20/54 (37%), Positives = 34/54 (62%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 ++ +LLEI+ CP+ +G L SE +L+ +AYPI+ G+PI+L +A + Sbjct: 1 MNGRLLEIVACPICQGRLKYDSENEQLICHFDHIAYPIKQGIPILLSDQAIGLS 54 >gi|84000173|ref|NP_001033191.1| protein preY, mitochondrial precursor [Bos taurus] gi|110815957|sp|Q2T9V7|PREY_BOVIN RecName: Full=Protein preY, mitochondrial; Flags: Precursor gi|83405354|gb|AAI11247.1| Phosphatidylinositol glycan anchor biosynthesis, class Y [Bos taurus] Length = 114 Score = 80.3 bits (198), Expect = 9e-14, Method: Composition-based stats. Identities = 22/52 (42%), Positives = 31/52 (59%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEAR 58 D LLE LVCPL+K L + EL++++ +AYPI G+P M+ AR Sbjct: 49 AFDQALLEFLVCPLSKKPLRYEASTNELINEELGIAYPIIDGIPNMIPQAAR 100 >gi|300858379|ref|YP_003783362.1| hypothetical protein cpfrc_00961 [Corynebacterium pseudotuberculosis FRC41] gi|300685833|gb|ADK28755.1| hypothetical protein cpfrc_00961 [Corynebacterium pseudotuberculosis FRC41] gi|302206092|gb|ADL10434.1| Hypothetical protein CpC231_0956 [Corynebacterium pseudotuberculosis C231] gi|302330645|gb|ADL20839.1| Conserved hypothetical protein [Corynebacterium pseudotuberculosis 1002] gi|308276329|gb|ADO26228.1| Hypothetical protein CpI19_0959 [Corynebacterium pseudotuberculosis I19] Length = 61 Score = 80.3 bits (198), Expect = 9e-14, Method: Composition-based stats. Identities = 22/52 (42%), Positives = 33/52 (63%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEA 57 +IDPQLLE+L CP KG L + + L++ + +AY I +P+ML +EA Sbjct: 1 MSIDPQLLEVLACPRDKGPLRYLEQDNVLVNDRLGIAYRIEDNIPVMLENEA 52 >gi|90406908|ref|ZP_01215099.1| hypothetical protein PCNPT3_05404 [Psychromonas sp. CNPT3] gi|90311950|gb|EAS40044.1| hypothetical protein PCNPT3_05404 [Psychromonas sp. CNPT3] Length = 60 Score = 79.9 bits (197), Expect = 1e-13, Method: Composition-based stats. Identities = 21/57 (36%), Positives = 34/57 (59%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 ID +LL+I+ CP+ KG L+ + EL+ K LA+P+ G+ +L S+AR + Sbjct: 1 MIDIKLLDIIACPVCKGKLSFKKDSNELICKFDHLAFPVIDGIAALLRSKARVITSD 57 >gi|319944099|ref|ZP_08018377.1| tetraacyldisaccharide 4'-kinase [Lautropia mirabilis ATCC 51599] gi|319742593|gb|EFV95002.1| tetraacyldisaccharide 4'-kinase [Lautropia mirabilis ATCC 51599] Length = 67 Score = 79.9 bits (197), Expect = 1e-13, Method: Composition-based stats. Identities = 24/52 (46%), Positives = 30/52 (57%) Query: 13 LEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQG 64 L+ILVCPL KG L + L K L +PIR GVP+M+V EA + G Sbjct: 4 LDILVCPLCKGPLAHDRQQQTLTCKADRLVFPIRDGVPVMIVEEAGHLAADG 55 >gi|14249680|ref|NP_116295.1| protein preY, mitochondrial isoform 1 [Homo sapiens] gi|74732012|sp|Q96I23|PREY_HUMAN RecName: Full=Protein preY, mitochondrial; Flags: Precursor gi|189065295|dbj|BAG35018.1| unnamed protein product [Homo sapiens] Length = 114 Score = 79.9 bits (197), Expect = 1e-13, Method: Composition-based stats. Identities = 23/52 (44%), Positives = 33/52 (63%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEAR 58 + DP LLE LVCPL+K L + EL++++ +AYPI G+P M+ AR Sbjct: 49 DFDPALLEFLVCPLSKKPLRYEASTNELINEELGIAYPIIDGIPNMIPQAAR 100 >gi|66730545|ref|NP_001019541.1| protein preY, mitochondrial precursor [Rattus norvegicus] gi|81889646|sp|Q5U1Z8|PREY_RAT RecName: Full=Protein preY, mitochondrial; Flags: Precursor gi|55562743|gb|AAH86361.1| Phosphatidylinositol glycan anchor biosynthesis, class Y [Rattus norvegicus] gi|149033234|gb|EDL88035.1| similar to RIKEN cDNA 2610022G08, isoform CRA_a [Rattus norvegicus] Length = 112 Score = 79.9 bits (197), Expect = 1e-13, Method: Composition-based stats. Identities = 22/53 (41%), Positives = 30/53 (56%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 P LL+ LVCPL+K L + EL++ + +AYPI GVP M+ AR Sbjct: 47 TFHPALLQFLVCPLSKKPLRYDASTNELINDELGIAYPIIDGVPNMIPQAART 99 >gi|218778223|ref|YP_002429541.1| hypothetical protein Dalk_0364 [Desulfatibacillum alkenivorans AK-01] gi|218759607|gb|ACL02073.1| protein of unknown function DUF343 [Desulfatibacillum alkenivorans AK-01] Length = 61 Score = 79.9 bits (197), Expect = 1e-13, Method: Composition-based stats. Identities = 22/57 (38%), Positives = 32/57 (56%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 + LEIL CP KG L L + L+ + L Y IR +PIML+SEA+ +++ Sbjct: 1 MPVKKDFLEILACPKCKGKLELNEQENGLICRPCKLVYEIRDEIPIMLISEAKALEE 57 >gi|115530791|emb|CAL49425.1| novel Trm112p-like protein protein [Xenopus (Silurana) tropicalis] Length = 122 Score = 79.9 bits (197), Expect = 1e-13, Method: Composition-based stats. Identities = 21/57 (36%), Positives = 33/57 (57%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 DP LL+ LVCPL++ +L EL++ + +AYPI G+P M+ +AR + Sbjct: 54 TFDPTLLQFLVCPLSRKSLRYEESTNELINDELGIAYPIVDGIPNMIPQDARMIHKD 110 >gi|224368944|ref|YP_002603108.1| hypothetical protein HRM2_18420 [Desulfobacterium autotrophicum HRM2] gi|223691661|gb|ACN14944.1| hypothetical protein HRM2_18420 [Desulfobacterium autotrophicum HRM2] Length = 57 Score = 79.5 bits (196), Expect = 1e-13, Method: Composition-based stats. Identities = 23/57 (40%), Positives = 31/57 (54%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 + +LLEIL CP KG +TL L+ + L Y IR +PIMLV EA+ + Sbjct: 1 MAVSKELLEILACPKCKGEVTLNKNKDGLVCRACCLVYEIRDDIPIMLVEEAKPFKE 57 >gi|146386932|pdb|2JNY|A Chain A, Solution Nmr Structure Of Protein Uncharacterized Bcr, Northeast Structural Genomics Consortium Target Cgr1 Length = 67 Score = 79.5 bits (196), Expect = 1e-13, Method: Composition-based stats. Identities = 22/56 (39%), Positives = 36/56 (64%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 ++DPQLLE+L CP KG L + L++++ +LAY I G+P++L+ EA + Sbjct: 1 MSLDPQLLEVLACPKDKGPLRYLESEQLLVNERLNLAYRIDDGIPVLLIDEATEWT 56 >gi|225705932|gb|ACO08812.1| preY, mitochondrial precursor [Oncorhynchus mykiss] Length = 111 Score = 79.5 bits (196), Expect = 1e-13, Method: Composition-based stats. Identities = 22/61 (36%), Positives = 36/61 (59%) Query: 3 ETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 + D LLE LVCPL+K L + EL++++ +AYPI G+P M+ ++AR + + Sbjct: 43 KDALPFDTSLLEFLVCPLSKKQLRYEEKTDELINEELRIAYPIIDGIPNMIPTDARLIKN 102 Query: 63 Q 63 Sbjct: 103 D 103 >gi|256830983|ref|YP_003159711.1| hypothetical protein Dbac_3220 [Desulfomicrobium baculatum DSM 4028] gi|256580159|gb|ACU91295.1| protein of unknown function DUF343 [Desulfomicrobium baculatum DSM 4028] Length = 65 Score = 79.5 bits (196), Expect = 1e-13, Method: Composition-based stats. Identities = 21/54 (38%), Positives = 31/54 (57%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 ++ +LL+IL CP KG+L L+ + L L YPIR +P+ML+ EA Sbjct: 1 MALNKELLQILACPKCKGDLELLPQEEGLKCGACGLVYPIREEIPVMLIDEAVP 54 >gi|58332128|ref|NP_001011216.1| protein preY, mitochondrial precursor [Xenopus (Silurana) tropicalis] gi|82179515|sp|Q5M8Z2|PREY_XENTR RecName: Full=Protein preY, mitochondrial; Flags: Precursor gi|56556521|gb|AAH87772.1| hypothetical LOC496649 [Xenopus (Silurana) tropicalis] Length = 122 Score = 79.5 bits (196), Expect = 1e-13, Method: Composition-based stats. Identities = 21/57 (36%), Positives = 33/57 (57%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 DP LL+ LVCPL++ +L EL++ + +AYPI G+P M+ +AR + Sbjct: 54 TFDPTLLQFLVCPLSRKSLRYEESTNELINDELGIAYPIVDGIPNMIPQDARMIHKD 110 >gi|303248921|ref|ZP_07335168.1| protein of unknown function DUF343 [Desulfovibrio fructosovorans JJ] gi|302489644|gb|EFL49580.1| protein of unknown function DUF343 [Desulfovibrio fructosovorans JJ] Length = 67 Score = 79.5 bits (196), Expect = 1e-13, Method: Composition-based stats. Identities = 26/54 (48%), Positives = 32/54 (59%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 I+P LL IL CP KG LT++ EG L K + YP+R +PIMLV EA Sbjct: 1 MTINPDLLTILACPKCKGELTVLGEGEGLACKPCGVVYPVRDDIPIMLVEEAVP 54 >gi|227488149|ref|ZP_03918465.1| conserved hypothetical protein [Corynebacterium glucuronolyticum ATCC 51867] gi|227541547|ref|ZP_03971596.1| conserved hypothetical protein [Corynebacterium glucuronolyticum ATCC 51866] gi|227092011|gb|EEI27323.1| conserved hypothetical protein [Corynebacterium glucuronolyticum ATCC 51867] gi|227182703|gb|EEI63675.1| conserved hypothetical protein [Corynebacterium glucuronolyticum ATCC 51866] Length = 66 Score = 79.5 bits (196), Expect = 1e-13, Method: Composition-based stats. Identities = 20/54 (37%), Positives = 36/54 (66%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 +IDP+LL+++VCP KG L + + L++++ +AY I +P++L SEA+ Sbjct: 1 MSIDPKLLDVVVCPKDKGPLRYLEDEQLLVNERLGIAYRIEDSIPVLLESEAQP 54 >gi|262277825|ref|ZP_06055618.1| conserved domain protein [alpha proteobacterium HIMB114] gi|262224928|gb|EEY75387.1| conserved domain protein [alpha proteobacterium HIMB114] Length = 56 Score = 79.5 bits (196), Expect = 1e-13, Method: Composition-based stats. Identities = 24/56 (42%), Positives = 37/56 (66%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 D LL+ +VCP +K L E L++K + LAYPI++G+PIML+ EA+++D Sbjct: 1 MEFDKNLLKTIVCPHSKEKLIYDEESNCLIAKTSKLAYPIKNGIPIMLIEEAKKID 56 >gi|254499066|ref|ZP_05111758.1| tetraacyldisaccharide-1-P-4-kinase [Legionella drancourtii LLAP12] gi|254351693|gb|EET10536.1| tetraacyldisaccharide-1-P-4-kinase [Legionella drancourtii LLAP12] Length = 59 Score = 79.5 bits (196), Expect = 2e-13, Method: Composition-based stats. Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 2/56 (3%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLE+LVCPL KG L + + EL+ K LA+PI G+P+ML EAR + + Sbjct: 1 MDKRLLELLVCPLCKGKLII--KKQELICKFDRLAFPIHDGIPVMLEHEARVISLE 54 >gi|213966315|ref|ZP_03394497.1| tetraacyldisaccharide 4'-kinase [Corynebacterium amycolatum SK46] gi|213951021|gb|EEB62421.1| tetraacyldisaccharide 4'-kinase [Corynebacterium amycolatum SK46] Length = 57 Score = 79.5 bits (196), Expect = 2e-13, Method: Composition-based stats. Identities = 22/56 (39%), Positives = 34/56 (60%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 ++DP+LL+IL CP KG L + + L++ + +AY I G+P+ML EA D Sbjct: 1 MSLDPKLLDILACPRDKGPLEYLEDEQVLVNPRLKIAYRIDEGIPVMLSDEAIAWD 56 >gi|289548372|ref|YP_003473360.1| hypothetical protein Thal_0599 [Thermocrinis albus DSM 14484] gi|289181989|gb|ADC89233.1| protein of unknown function DUF343 [Thermocrinis albus DSM 14484] Length = 65 Score = 79.1 bits (195), Expect = 2e-13, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 34/57 (59%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 + +LL IL CP KG+L I + + L+ ++ + YP+ +P++L+ EA+ + + Sbjct: 1 MALPEELLNILACPRCKGDLIYIRDKSILVCERCGVYYPVEDDIPVLLIEEAKPLSE 57 >gi|52842138|ref|YP_095937.1| tetraacyldisaccharide-1-P-4'-kinase [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] gi|54297843|ref|YP_124212.1| hypothetical protein lpp1895 [Legionella pneumophila str. Paris] gi|148359467|ref|YP_001250674.1| tetraacyldisaccharide-1-P-4'-kinase [Legionella pneumophila str. Corby] gi|296107512|ref|YP_003619213.1| tetraacyldisaccharide-1-P-4'-kinase [Legionella pneumophila 2300/99 Alcoy] gi|81370334|sp|Q5X3Y6|Y1895_LEGPA RecName: Full=UPF0434 protein lpp1895 gi|81377232|sp|Q5ZU87|Y1920_LEGPH RecName: Full=UPF0434 protein lpg1920 gi|166979748|sp|A5ID78|Y1374_LEGPC RecName: Full=UPF0434 protein LPC_1374 gi|52629249|gb|AAU27990.1| tetraacyldisaccharide-1-P-4'-kinase [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] gi|53751628|emb|CAH13047.1| hypothetical protein lpp1895 [Legionella pneumophila str. Paris] gi|148281240|gb|ABQ55328.1| tetraacyldisaccharide-1-P-4'-kinase [Legionella pneumophila str. Corby] gi|295649414|gb|ADG25261.1| tetraacyldisaccharide-1-P-4'-kinase [Legionella pneumophila 2300/99 Alcoy] Length = 59 Score = 79.1 bits (195), Expect = 2e-13, Method: Composition-based stats. Identities = 26/53 (49%), Positives = 35/53 (66%), Gaps = 2/53 (3%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 +D +LLEILVCPL KG L + EL+ K LA+P+R +P+ML EAR + Sbjct: 1 MDKKLLEILVCPLCKGKLLF--KKQELICKFDRLAFPVRDDIPVMLEQEARLI 51 >gi|327273049|ref|XP_003221295.1| PREDICTED: protein preY, mitochondrial-like [Anolis carolinensis] Length = 106 Score = 79.1 bits (195), Expect = 2e-13, Method: Composition-based stats. Identities = 23/62 (37%), Positives = 34/62 (54%) Query: 2 RETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 +E D LL+ILVCPL+K L EL++++ +AYPI G+P M+ AR + Sbjct: 36 QEPKPPFDASLLQILVCPLSKKPLRYEESTNELINEELGIAYPITDGIPNMIPQAARMIG 95 Query: 62 DQ 63 Sbjct: 96 KD 97 >gi|284992676|ref|YP_003411230.1| hypothetical protein Gobs_4297 [Geodermatophilus obscurus DSM 43160] gi|284065921|gb|ADB76859.1| protein of unknown function DUF343 [Geodermatophilus obscurus DSM 43160] Length = 73 Score = 79.1 bits (195), Expect = 2e-13, Method: Composition-based stats. Identities = 21/55 (38%), Positives = 32/55 (58%), Gaps = 1/55 (1%) Query: 6 FNIDPQLLEILVCPLTK-GNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 +DP LL IL CP T L + +EL+ A+P+R G+P++L+ EAR+ Sbjct: 13 LGLDPALLAILACPDTHHSPLVVDEAASELVCSTCDRAFPVRDGIPVLLLDEARR 67 >gi|332992972|gb|AEF03027.1| hypothetical protein ambt_07495 [Alteromonas sp. SN2] Length = 64 Score = 79.1 bits (195), Expect = 2e-13, Method: Composition-based stats. Identities = 21/58 (36%), Positives = 34/58 (58%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 D +LLE+L CP+ KG L L E +L+ + LAY I+ G+P+++ S+A + Sbjct: 1 MAFDNKLLEVLACPVCKGKLVLNDEKDKLICRFDRLAYDIKDGIPVLIESKATVMTLD 58 >gi|83855255|ref|ZP_00948785.1| hypothetical protein NAS141_11006 [Sulfitobacter sp. NAS-14.1] gi|83843098|gb|EAP82265.1| hypothetical protein NAS141_11006 [Sulfitobacter sp. NAS-14.1] Length = 50 Score = 79.1 bits (195), Expect = 2e-13, Method: Composition-based stats. Identities = 27/50 (54%), Positives = 38/50 (76%) Query: 12 LLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 +LE L+CP T+ LT ++ EL+S+ A LAYPIR+G+P+MLV EAR +D Sbjct: 1 MLEALICPRTQMRLTYDADKQELISEAAGLAYPIRNGIPVMLVDEARVID 50 >gi|148672796|gb|EDL04743.1| phosphatidylinositol glycan anchor biosynthesis, class Y, isoform CRA_b [Mus musculus] Length = 114 Score = 78.7 bits (194), Expect = 2e-13, Method: Composition-based stats. Identities = 22/58 (37%), Positives = 32/58 (55%) Query: 2 RETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 E P LL+ LVCPL+K L + EL++++ +AYPI G+P M+ AR Sbjct: 44 AEQPHTFHPALLQFLVCPLSKKPLRYEASTNELVNEELGIAYPIIDGIPNMIPQAART 101 >gi|301060997|ref|ZP_07201796.1| conserved hypothetical protein [delta proteobacterium NaphS2] gi|300444916|gb|EFK08882.1| conserved hypothetical protein [delta proteobacterium NaphS2] Length = 71 Score = 78.7 bits (194), Expect = 2e-13, Method: Composition-based stats. Identities = 21/56 (37%), Positives = 31/56 (55%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 I +LL+IL CP KG++ L L+ L Y I+ +PIML+ EA+ +D Sbjct: 1 MAISKELLDILACPKCKGDIHLTESKDGLICDHCKLLYEIKDDIPIMLIDEAKPLD 56 >gi|281344275|gb|EFB19859.1| hypothetical protein PANDA_001438 [Ailuropoda melanoleuca] Length = 73 Score = 78.7 bits (194), Expect = 2e-13, Method: Composition-based stats. Identities = 23/52 (44%), Positives = 32/52 (61%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEAR 58 DP LLE LVCPL+K L + EL++++ +AYPI G+P M+ AR Sbjct: 9 AFDPALLEFLVCPLSKKPLRYEASTNELINEELGIAYPIIDGIPNMIPQAAR 60 >gi|323699500|ref|ZP_08111412.1| protein of unknown function DUF343 [Desulfovibrio sp. ND132] gi|323459432|gb|EGB15297.1| protein of unknown function DUF343 [Desulfovibrio desulfuricans ND132] Length = 62 Score = 78.7 bits (194), Expect = 3e-13, Method: Composition-based stats. Identities = 23/57 (40%), Positives = 31/57 (54%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 ++ LL+IL CP KG LT G L K + YP+R+ +PIMLV +A D Sbjct: 1 MTLNKDLLDILACPKCKGGLTPTPAGDGLACPKCKVVYPVRNDIPIMLVDQAVPETD 57 >gi|21313456|ref|NP_079850.1| protein preY, mitochondrial precursor [Mus musculus] gi|81904723|sp|Q9D1C3|PREY_MOUSE RecName: Full=Protein preY, mitochondrial; Flags: Precursor gi|12834548|dbj|BAB22953.1| unnamed protein product [Mus musculus] gi|22137424|gb|AAH29232.1| Phosphatidylinositol glycan anchor biosynthesis, class Y [Mus musculus] gi|26325176|dbj|BAC26342.1| unnamed protein product [Mus musculus] gi|26328211|dbj|BAC27846.1| unnamed protein product [Mus musculus] Length = 112 Score = 78.7 bits (194), Expect = 3e-13, Method: Composition-based stats. Identities = 22/58 (37%), Positives = 32/58 (55%) Query: 2 RETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 E P LL+ LVCPL+K L + EL++++ +AYPI G+P M+ AR Sbjct: 42 AEQPHTFHPALLQFLVCPLSKKPLRYEASTNELVNEELGIAYPIIDGIPNMIPQAART 99 >gi|153005435|ref|YP_001379760.1| hypothetical protein Anae109_2575 [Anaeromyxobacter sp. Fw109-5] gi|152029008|gb|ABS26776.1| protein of unknown function DUF343 [Anaeromyxobacter sp. Fw109-5] Length = 70 Score = 78.7 bits (194), Expect = 3e-13, Method: Composition-based stats. Identities = 20/55 (36%), Positives = 31/55 (56%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 + P+L EIL CP KG+L + E+ + LA+ I +P+ML+ EAR + Sbjct: 1 MALAPELKEILACPRCKGDLEFREDVHEIRCHRCQLAFRIEDDIPVMLLDEARPL 55 >gi|120603347|ref|YP_967747.1| hypothetical protein Dvul_2304 [Desulfovibrio vulgaris DP4] gi|120563576|gb|ABM29320.1| protein of unknown function DUF343 [Desulfovibrio vulgaris DP4] Length = 87 Score = 78.4 bits (193), Expect = 3e-13, Method: Composition-based stats. Identities = 23/61 (37%), Positives = 36/61 (59%) Query: 2 RETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 +ET ++ +LL+IL CP +G LTL+ L ++ YP+R +P+MLV EA + Sbjct: 15 QETNVPLNKELLDILACPACRGELTLLDGEEGLRCPACAVVYPVRDEIPVMLVEEAVPAE 74 Query: 62 D 62 D Sbjct: 75 D 75 >gi|54294807|ref|YP_127222.1| hypothetical protein lpl1884 [Legionella pneumophila str. Lens] gi|81368380|sp|Q5WVD1|Y1884_LEGPL RecName: Full=UPF0434 protein lpl1884 gi|53754639|emb|CAH16123.1| hypothetical protein lpl1884 [Legionella pneumophila str. Lens] gi|307610626|emb|CBX00214.1| hypothetical protein LPW_19591 [Legionella pneumophila 130b] Length = 59 Score = 78.4 bits (193), Expect = 3e-13, Method: Composition-based stats. Identities = 26/53 (49%), Positives = 35/53 (66%), Gaps = 2/53 (3%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 +D +LLEILVCPL KG L + EL+ K LA+P+R +P+ML EAR + Sbjct: 1 MDKKLLEILVCPLCKGKLLF--KKHELICKFDRLAFPVRDDIPVMLEQEARLI 51 >gi|38233765|ref|NP_939532.1| hypothetical protein DIP1175 [Corynebacterium diphtheriae NCTC 13129] gi|38200026|emb|CAE49695.1| Conserved hypothetical protein [Corynebacterium diphtheriae] Length = 70 Score = 78.0 bits (192), Expect = 4e-13, Method: Composition-based stats. Identities = 23/52 (44%), Positives = 34/52 (65%) Query: 5 IFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 I +IDP+LLE+L CP KG L + L++++ +AY I G+P+MLV E Sbjct: 10 IMSIDPKLLEVLACPQDKGPLKYLEAEQVLVNERLEIAYRIDDGIPVMLVDE 61 >gi|52424989|ref|YP_088126.1| hypothetical protein MS0934 [Mannheimia succiniciproducens MBEL55E] gi|81387225|sp|Q65U19|Y934_MANSM RecName: Full=UPF0434 protein MS0934 gi|52307041|gb|AAU37541.1| unknown [Mannheimia succiniciproducens MBEL55E] Length = 61 Score = 78.0 bits (192), Expect = 4e-13, Method: Composition-based stats. Identities = 21/56 (37%), Positives = 34/56 (60%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LLEI+ CP +G L L E L+ + +A+PI G+P++LV EA + + Sbjct: 1 MDSRLLEIIACPRCQGRLQLDKENERLICRFEHIAFPIVQGIPVLLVEEAVSLAED 56 >gi|297171077|gb|ADI22089.1| hypothetical protein [uncultured Planctomycetales bacterium HF0200_11L05] Length = 61 Score = 78.0 bits (192), Expect = 4e-13, Method: Composition-based stats. Identities = 27/59 (45%), Positives = 40/59 (67%), Gaps = 2/59 (3%) Query: 5 IFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 + IDP+L++ILVCP++K L + EL+ ++ LAYPIR G+PIML EAR++ Sbjct: 1 MSKIDPKLMQILVCPVSKKALV--QKDAELVCYESGLAYPIRDGIPIMLPEEARKLKKD 57 >gi|226225639|ref|YP_002759745.1| hypothetical protein GAU_0233 [Gemmatimonas aurantiaca T-27] gi|226088830|dbj|BAH37275.1| hypothetical protein [Gemmatimonas aurantiaca T-27] Length = 74 Score = 78.0 bits (192), Expect = 4e-13, Method: Composition-based stats. Identities = 23/59 (38%), Positives = 37/59 (62%), Gaps = 1/59 (1%) Query: 5 IFNIDPQLLEILVCPLTKGNLTLISEGTE-LLSKKASLAYPIRSGVPIMLVSEARQVDD 62 + ++ P LLEILVCP +K L + E L+ +++ L Y + GVP+ML+ EA +D+ Sbjct: 9 LMSLSPTLLEILVCPKSKAPLEYHAGPPEVLICRESRLVYRVEEGVPVMLIDEAEPLDE 67 >gi|313673277|ref|YP_004051388.1| hypothetical protein Calni_1317 [Calditerrivibrio nitroreducens DSM 19672] gi|312940033|gb|ADR19225.1| protein of unknown function DUF343 [Calditerrivibrio nitroreducens DSM 19672] Length = 61 Score = 78.0 bits (192), Expect = 5e-13, Method: Composition-based stats. Identities = 23/57 (40%), Positives = 33/57 (57%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 I +LL+IL CP KG++ L L+ K L Y IR +PIML+ EA++V+ Sbjct: 1 MAIKKELLDILACPKCKGDIRLSKNEDALICDKCKLIYEIRDDIPIMLIDEAKKVES 57 >gi|159899757|ref|YP_001546004.1| hypothetical protein Haur_3239 [Herpetosiphon aurantiacus ATCC 23779] gi|159892796|gb|ABX05876.1| protein of unknown function DUF343 [Herpetosiphon aurantiacus ATCC 23779] Length = 119 Score = 78.0 bits (192), Expect = 5e-13, Method: Composition-based stats. Identities = 23/59 (38%), Positives = 34/59 (57%), Gaps = 3/59 (5%) Query: 7 NIDPQLLEILVCPLTKGNLTLISE---GTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 +I P+LLEIL CP+ K + L ++ LL+ + YPI G+PIML+ E + D Sbjct: 55 SISPELLEILACPVDKKPVELYTDASGKEWLLNPRNGYRYPIEDGIPIMLIDEGEKHKD 113 >gi|291398664|ref|XP_002715954.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis, class Y-like [Oryctolagus cuniculus] Length = 107 Score = 78.0 bits (192), Expect = 5e-13, Method: Composition-based stats. Identities = 23/52 (44%), Positives = 30/52 (57%), Gaps = 2/52 (3%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEAR 58 DP LLE LVCPL+K L + EL++ +AYPI G+P M+ AR Sbjct: 44 AFDPALLEFLVCPLSKKPLRYEASTNELIN--LGIAYPIVDGIPNMIPQAAR 93 >gi|226360092|ref|YP_002777870.1| hypothetical protein ROP_06780 [Rhodococcus opacus B4] gi|226238577|dbj|BAH48925.1| hypothetical protein [Rhodococcus opacus B4] Length = 70 Score = 77.6 bits (191), Expect = 5e-13, Method: Composition-based stats. Identities = 26/58 (44%), Positives = 35/58 (60%), Gaps = 1/58 (1%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 IDP LL IL CP KG L L+ + L + + AYPI +G+P++L+ EAR VD Sbjct: 1 MVIDPTLLGILACPQDKGPLLLVGDEL-LYNPRLRRAYPIENGIPVLLIDEARDVDAD 57 >gi|327398372|ref|YP_004339241.1| hypothetical protein Hipma_0205 [Hippea maritima DSM 10411] gi|327181001|gb|AEA33182.1| UPF0434 protein ycaR [Hippea maritima DSM 10411] Length = 56 Score = 77.6 bits (191), Expect = 5e-13, Method: Composition-based stats. Identities = 22/56 (39%), Positives = 36/56 (64%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 I +LL+I+ CP KG+L L +G L+ ++ L YPI +PI+++ EA+ +DD Sbjct: 1 MIKKELLDIIACPKCKGDLKLDKDGKFLICERCKLKYPIEDDIPILIIDEAQPLDD 56 >gi|317507373|ref|ZP_07965108.1| hypothetical protein HMPREF9336_01480 [Segniliparus rugosus ATCC BAA-974] gi|316254321|gb|EFV13656.1| hypothetical protein HMPREF9336_01480 [Segniliparus rugosus ATCC BAA-974] Length = 68 Score = 77.6 bits (191), Expect = 5e-13, Method: Composition-based stats. Identities = 22/57 (38%), Positives = 35/57 (61%), Gaps = 1/57 (1%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 ID +LLEIL CP G L +++ L + + +AYP+ +G+P++L AR VD+ Sbjct: 1 MAIDAKLLEILACPQDHGPLLYVADEL-LYNPRLRVAYPVENGLPVLLADHARAVDE 56 >gi|319790297|ref|YP_004151930.1| protein of unknown function DUF343 [Thermovibrio ammonificans HB-1] gi|317114799|gb|ADU97289.1| protein of unknown function DUF343 [Thermovibrio ammonificans HB-1] Length = 56 Score = 77.6 bits (191), Expect = 5e-13, Method: Composition-based stats. Identities = 19/56 (33%), Positives = 33/56 (58%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 + +LL++L CP KG+L + +L+ K LAYP+ +P+ML EA +++ Sbjct: 1 MLPEELLKLLACPKCKGDLEYREKEQKLVCHKCKLAYPVIDDIPVMLPDEAEPLEE 56 >gi|119715662|ref|YP_922627.1| hypothetical protein Noca_1426 [Nocardioides sp. JS614] gi|119536323|gb|ABL80940.1| protein of unknown function DUF343 [Nocardioides sp. JS614] Length = 56 Score = 77.6 bits (191), Expect = 6e-13, Method: Composition-based stats. Identities = 27/56 (48%), Positives = 37/56 (66%), Gaps = 2/56 (3%) Query: 4 TIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 NIDP+LLEI+VCP + L L+ EL+ + LAYPIR +P++LV EAR+ Sbjct: 2 NAVNIDPELLEIIVCPACRSELDLVEA--ELVCRGCGLAYPIRDDIPVLLVDEARK 55 >gi|226306762|ref|YP_002766722.1| hypothetical protein RER_32750 [Rhodococcus erythropolis PR4] gi|229492711|ref|ZP_04386512.1| conserved hypothetical protein [Rhodococcus erythropolis SK121] gi|226185879|dbj|BAH33983.1| conserved hypothetical protein [Rhodococcus erythropolis PR4] gi|229320370|gb|EEN86190.1| conserved hypothetical protein [Rhodococcus erythropolis SK121] Length = 68 Score = 77.6 bits (191), Expect = 6e-13, Method: Composition-based stats. Identities = 25/58 (43%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 ID LL IL CP KG L L+ + L + + AYPI +G+P++L+ EAR V D Sbjct: 1 MAIDSTLLSILACPQDKGPLLLVGDEL-LYNPRLRRAYPIENGIPVLLIDEARDVADD 57 >gi|219871244|ref|YP_002475619.1| hypothetical protein HAPS_1052 [Haemophilus parasuis SH0165] gi|219691448|gb|ACL32671.1| conserved hypothetical protein [Haemophilus parasuis SH0165] Length = 53 Score = 77.6 bits (191), Expect = 6e-13, Method: Composition-based stats. Identities = 18/53 (33%), Positives = 35/53 (66%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 ++ +LL + CP+T+ L E L+S+ A++AYPI +G+P++L +A ++ Sbjct: 1 MNEKLLNTIACPITQTKLEWDKENNRLISRSANVAYPIENGIPVLLPEKAEKL 53 >gi|218887733|ref|YP_002437054.1| hypothetical protein DvMF_2647 [Desulfovibrio vulgaris str. 'Miyazaki F'] gi|218758687|gb|ACL09586.1| protein of unknown function DUF343 [Desulfovibrio vulgaris str. 'Miyazaki F'] Length = 66 Score = 77.6 bits (191), Expect = 6e-13, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 29/54 (53%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 +++ +LLEIL CP + + + L + + YP+R +P+MLV EA Sbjct: 1 MSLNKELLEILACPKCRQPVEPVDNERGLKCAQCKVVYPVRDEIPVMLVEEAVP 54 >gi|78358133|ref|YP_389582.1| hypothetical protein Dde_3093 [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] gi|78220538|gb|ABB39887.1| conserved hypothetical protein [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] Length = 70 Score = 77.6 bits (191), Expect = 6e-13, Method: Composition-based stats. Identities = 21/54 (38%), Positives = 32/54 (59%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 N+ +LLEIL CP K ++ S+G L + ++ YP+R +P+MLV EA Sbjct: 1 MNVSKELLEILACPKCKSSVEPTSDGEGLACAQCAVVYPVREDIPVMLVEEAIP 54 >gi|116751053|ref|YP_847740.1| hypothetical protein Sfum_3635 [Syntrophobacter fumaroxidans MPOB] gi|116700117|gb|ABK19305.1| protein of unknown function DUF343 [Syntrophobacter fumaroxidans MPOB] Length = 57 Score = 77.6 bits (191), Expect = 6e-13, Method: Composition-based stats. Identities = 22/54 (40%), Positives = 30/54 (55%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 I +LL+IL CP KG++ L L+ K L Y IR +PIML+ EA+ Sbjct: 1 MTISQELLDILACPKCKGDIRLNETQDGLICDKCKLLYEIRDDIPIMLIDEAKP 54 >gi|298530540|ref|ZP_07017942.1| protein of unknown function DUF343 [Desulfonatronospira thiodismutans ASO3-1] gi|298509914|gb|EFI33818.1| protein of unknown function DUF343 [Desulfonatronospira thiodismutans ASO3-1] Length = 66 Score = 77.2 bits (190), Expect = 6e-13, Method: Composition-based stats. Identities = 22/57 (38%), Positives = 35/57 (61%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 +++ ++L+IL CP K +LTL + L + +L YPIR +P+ML+ EA V D Sbjct: 1 MSLNKEILQILACPKCKSDLTLTGQEEGLKCSECALVYPIREEIPVMLIDEAIPVQD 57 >gi|297569369|ref|YP_003690713.1| protein of unknown function DUF343 [Desulfurivibrio alkaliphilus AHT2] gi|296925284|gb|ADH86094.1| protein of unknown function DUF343 [Desulfurivibrio alkaliphilus AHT2] Length = 54 Score = 77.2 bits (190), Expect = 7e-13, Method: Composition-based stats. Identities = 24/54 (44%), Positives = 35/54 (64%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 ++PQLLEIL CP KG + L + + L+ K L Y IR +PIML+ EA+++ Sbjct: 1 MLNPQLLEILACPKCKGPVKLNEQESGLVCDKCKLLYEIRDEIPIMLIDEAKEL 54 >gi|46579070|ref|YP_009878.1| hypothetical protein DVU0656 [Desulfovibrio vulgaris str. Hildenborough] gi|46448483|gb|AAS95137.1| conserved hypothetical protein [Desulfovibrio vulgaris str. Hildenborough] gi|311232915|gb|ADP85769.1| protein of unknown function DUF343 [Desulfovibrio vulgaris RCH1] Length = 69 Score = 77.2 bits (190), Expect = 8e-13, Method: Composition-based stats. Identities = 21/57 (36%), Positives = 33/57 (57%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 ++ +LL+IL CP +G LTL+ L ++ YP+R +P+MLV EA +D Sbjct: 1 MPLNKELLDILACPACRGELTLLDGEEGLRCPACAVVYPVRDEIPVMLVEEAVPAED 57 >gi|94497899|ref|ZP_01304464.1| hypothetical protein SKA58_00130 [Sphingomonas sp. SKA58] gi|94422627|gb|EAT07663.1| hypothetical protein SKA58_00130 [Sphingomonas sp. SKA58] Length = 63 Score = 77.2 bits (190), Expect = 8e-13, Method: Composition-based stats. Identities = 24/59 (40%), Positives = 36/59 (61%) Query: 2 RETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 IDP LLE LVCP+T+ L + L+S+ A LA+P+R GVP+++ +AR + Sbjct: 5 DANFPPIDPWLLEKLVCPVTRTPLRWDAGRHALVSEAAGLAFPVRDGVPLLVARQARPL 63 >gi|239908603|ref|YP_002955345.1| hypothetical protein DMR_39680 [Desulfovibrio magneticus RS-1] gi|239798470|dbj|BAH77459.1| hypothetical protein [Desulfovibrio magneticus RS-1] Length = 71 Score = 76.8 bits (189), Expect = 8e-13, Method: Composition-based stats. Identities = 22/52 (42%), Positives = 29/52 (55%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEA 57 +I P LL IL CP KG LT++ L + +P+R +PIMLV EA Sbjct: 1 MSIHPDLLTILACPKCKGALTVVDNEAGLFCPTCDIVFPVRDDIPIMLVEEA 52 >gi|296268743|ref|YP_003651375.1| hypothetical protein Tbis_0757 [Thermobispora bispora DSM 43833] gi|296091530|gb|ADG87482.1| protein of unknown function DUF343 [Thermobispora bispora DSM 43833] Length = 57 Score = 76.8 bits (189), Expect = 9e-13, Method: Composition-based stats. Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 2/56 (3%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLS--KKASLAYPIRSGVPIMLVSEARQ 59 ID LL+ILVCP K L ++ EL + L YP+R +P++LV EAR+ Sbjct: 1 MKIDDWLLDILVCPACKSPLRAATDADELACTSETCGLIYPVRDDIPVLLVDEARR 56 >gi|271962930|ref|YP_003337126.1| hypothetical protein Sros_1388 [Streptosporangium roseum DSM 43021] gi|270506105|gb|ACZ84383.1| conserved hypothetical protein [Streptosporangium roseum DSM 43021] Length = 57 Score = 76.8 bits (189), Expect = 9e-13, Method: Composition-based stats. Identities = 24/56 (42%), Positives = 29/56 (51%), Gaps = 2/56 (3%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSK--KASLAYPIRSGVPIMLVSEARQ 59 ID LLEIL CP K L E EL L YP+R +P++LV EAR+ Sbjct: 1 MKIDDWLLEILACPNCKSPLRAEPEVDELSCTSASCGLVYPVRDDIPVLLVDEARK 56 >gi|148244904|ref|YP_001219598.1| hypothetical protein COSY_0767 [Candidatus Vesicomyosocius okutanii HA] gi|167016795|sp|A5CVZ8|Y767_VESOH RecName: Full=UPF0434 protein COSY_0767 gi|146326731|dbj|BAF61874.1| conserved hypothetical protein [Candidatus Vesicomyosocius okutanii HA] Length = 59 Score = 76.8 bits (189), Expect = 9e-13, Method: Composition-based stats. Identities = 27/55 (49%), Positives = 38/55 (69%), Gaps = 2/55 (3%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 ID LL++LVCP +K L + G EL+ + + LAYPI G+PI+LV EAR++D Sbjct: 1 MIDEALLKLLVCPKSKAPLKQV--GNELICEVSGLAYPIEDGIPILLVEEARELD 53 >gi|163783954|ref|ZP_02178922.1| hypothetical protein HG1285_08196 [Hydrogenivirga sp. 128-5-R1-1] gi|159880771|gb|EDP74307.1| hypothetical protein HG1285_08196 [Hydrogenivirga sp. 128-5-R1-1] Length = 58 Score = 76.8 bits (189), Expect = 1e-12, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 31/57 (54%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 ID +LLEI+ CP K +L L+ + + Y I +P++++ EA+ ++D Sbjct: 1 MIDEKLLEIIACPKCKLDLKYDQNKNILICENCRVYYEIIDDIPVLIIEEAKPLNDD 57 >gi|291278927|ref|YP_003495762.1| hypothetical protein DEFDS_0512 [Deferribacter desulfuricans SSM1] gi|290753629|dbj|BAI80006.1| conserved hypothetical protein [Deferribacter desulfuricans SSM1] Length = 61 Score = 76.8 bits (189), Expect = 1e-12, Method: Composition-based stats. Identities = 22/57 (38%), Positives = 36/57 (63%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 +ID +LLEIL CP +G++ L + ++ L Y IR +P+ML+ EA+QV++ Sbjct: 1 MSIDKELLEILACPKCRGDIRLSKDEKYIVCDNCKLLYEIREDIPVMLIDEAKQVEN 57 >gi|325294879|ref|YP_004281393.1| ycaR [Desulfurobacterium thermolithotrophum DSM 11699] gi|325065327|gb|ADY73334.1| UPF0434 protein ycaR [Desulfurobacterium thermolithotrophum DSM 11699] Length = 56 Score = 76.8 bits (189), Expect = 1e-12, Method: Composition-based stats. Identities = 22/56 (39%), Positives = 34/56 (60%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 +D +LL+IL CP KG+L + +L+ K LAY I +P+ML+ EA +D+ Sbjct: 1 MLDGELLQILACPQCKGDLEYREKEDKLICHKCKLAYKIVDDIPVMLIDEAEVIDE 56 >gi|317154882|ref|YP_004122930.1| hypothetical protein Daes_3192 [Desulfovibrio aespoeensis Aspo-2] gi|316945133|gb|ADU64184.1| protein of unknown function DUF343 [Desulfovibrio aespoeensis Aspo-2] Length = 64 Score = 76.8 bits (189), Expect = 1e-12, Method: Composition-based stats. Identities = 20/52 (38%), Positives = 30/52 (57%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEA 57 +D +L +IL CP G++TL+ G L + YP+R +PIMLV +A Sbjct: 1 MALDKELTDILACPKCTGSVTLLPAGDGLFCPACRVVYPVRDDIPIMLVDQA 52 >gi|15608822|ref|NP_216200.1| hypothetical protein Rv1684 [Mycobacterium tuberculosis H37Rv] gi|15841141|ref|NP_336178.1| hypothetical protein MT1724 [Mycobacterium tuberculosis CDC1551] gi|31792870|ref|NP_855363.1| hypothetical protein Mb1710A [Mycobacterium bovis AF2122/97] gi|121637591|ref|YP_977814.1| hypothetical protein BCG_1722 [Mycobacterium bovis BCG str. Pasteur 1173P2] gi|148661481|ref|YP_001283004.1| hypothetical protein MRA_1694A [Mycobacterium tuberculosis H37Ra] gi|167969198|ref|ZP_02551475.1| hypothetical protein MtubH3_14690 [Mycobacterium tuberculosis H37Ra] gi|215404013|ref|ZP_03416194.1| hypothetical protein Mtub0_10066 [Mycobacterium tuberculosis 02_1987] gi|215411331|ref|ZP_03420139.1| hypothetical protein Mtub9_08427 [Mycobacterium tuberculosis 94_M4241A] gi|215427007|ref|ZP_03424926.1| hypothetical protein MtubT9_11717 [Mycobacterium tuberculosis T92] gi|215430576|ref|ZP_03428495.1| hypothetical protein MtubE_07868 [Mycobacterium tuberculosis EAS054] gi|215445871|ref|ZP_03432623.1| hypothetical protein MtubT_07996 [Mycobacterium tuberculosis T85] gi|218753392|ref|ZP_03532188.1| hypothetical protein MtubG1_08119 [Mycobacterium tuberculosis GM 1503] gi|219557606|ref|ZP_03536682.1| hypothetical protein MtubT1_10037 [Mycobacterium tuberculosis T17] gi|224990066|ref|YP_002644753.1| hypothetical protein JTY_1697 [Mycobacterium bovis BCG str. Tokyo 172] gi|253799277|ref|YP_003032278.1| hypothetical protein TBMG_04060 [Mycobacterium tuberculosis KZN 1435] gi|254231879|ref|ZP_04925206.1| conserved hypothetical protein [Mycobacterium tuberculosis C] gi|254550693|ref|ZP_05141140.1| hypothetical protein Mtube_09589 [Mycobacterium tuberculosis '98-R604 INH-RIF-EM'] gi|260186637|ref|ZP_05764111.1| hypothetical protein MtubCP_11501 [Mycobacterium tuberculosis CPHL_A] gi|260200748|ref|ZP_05768239.1| hypothetical protein MtubT4_11662 [Mycobacterium tuberculosis T46] gi|260204953|ref|ZP_05772444.1| hypothetical protein MtubK8_11695 [Mycobacterium tuberculosis K85] gi|289443141|ref|ZP_06432885.1| conserved hypothetical protein [Mycobacterium tuberculosis T46] gi|289447298|ref|ZP_06437042.1| conserved hypothetical protein [Mycobacterium tuberculosis CPHL_A] gi|289569732|ref|ZP_06449959.1| conserved hypothetical protein [Mycobacterium tuberculosis T17] gi|289574352|ref|ZP_06454579.1| conserved hypothetical protein [Mycobacterium tuberculosis K85] gi|289745879|ref|ZP_06505257.1| conserved hypothetical protein [Mycobacterium tuberculosis 02_1987] gi|289750240|ref|ZP_06509618.1| conserved hypothetical protein [Mycobacterium tuberculosis T92] gi|289761839|ref|ZP_06521217.1| conserved hypothetical protein [Mycobacterium tuberculosis GM 1503] gi|294996634|ref|ZP_06802325.1| hypothetical protein Mtub2_19548 [Mycobacterium tuberculosis 210] gi|297634236|ref|ZP_06952016.1| hypothetical protein MtubK4_08952 [Mycobacterium tuberculosis KZN 4207] gi|297731223|ref|ZP_06960341.1| hypothetical protein MtubKR_09042 [Mycobacterium tuberculosis KZN R506] gi|298525183|ref|ZP_07012592.1| conserved hypothetical protein [Mycobacterium tuberculosis 94_M4241A] gi|306775869|ref|ZP_07414206.1| hypothetical protein TMAG_01517 [Mycobacterium tuberculosis SUMu001] gi|306779687|ref|ZP_07418024.1| hypothetical protein TMBG_00228 [Mycobacterium tuberculosis SUMu002] gi|306784420|ref|ZP_07422742.1| hypothetical protein TMCG_03384 [Mycobacterium tuberculosis SUMu003] gi|306788787|ref|ZP_07427109.1| hypothetical protein TMDG_03401 [Mycobacterium tuberculosis SUMu004] gi|306793122|ref|ZP_07431424.1| hypothetical protein TMEG_01583 [Mycobacterium tuberculosis SUMu005] gi|306797502|ref|ZP_07435804.1| hypothetical protein TMFG_00769 [Mycobacterium tuberculosis SUMu006] gi|306807965|ref|ZP_07444633.1| hypothetical protein TMGG_00231 [Mycobacterium tuberculosis SUMu007] gi|306971978|ref|ZP_07484639.1| hypothetical protein TMJG_03115 [Mycobacterium tuberculosis SUMu010] gi|307079691|ref|ZP_07488861.1| hypothetical protein TMKG_02190 [Mycobacterium tuberculosis SUMu011] gi|307084267|ref|ZP_07493380.1| hypothetical protein TMLG_00666 [Mycobacterium tuberculosis SUMu012] gi|313658555|ref|ZP_07815435.1| hypothetical protein MtubKV_09057 [Mycobacterium tuberculosis KZN V2475] gi|2326727|emb|CAB10941.1| CONSERVED HYPOTHETICAL PROTEIN [Mycobacterium tuberculosis H37Rv] gi|13881360|gb|AAK45992.1| conserved hypothetical protein [Mycobacterium tuberculosis CDC1551] gi|31618460|emb|CAD96378.1| CONSERVED HYPOTHETICAL PROTEIN [Mycobacterium bovis AF2122/97] gi|121493238|emb|CAL71709.1| Conserved hypothetical protein [Mycobacterium bovis BCG str. Pasteur 1173P2] gi|124600938|gb|EAY59948.1| conserved hypothetical protein [Mycobacterium tuberculosis C] gi|148505633|gb|ABQ73442.1| hypothetical protein MRA_1694A [Mycobacterium tuberculosis H37Ra] gi|224773179|dbj|BAH25985.1| hypothetical protein JTY_1697 [Mycobacterium bovis BCG str. Tokyo 172] gi|253320780|gb|ACT25383.1| conserved hypothetical protein [Mycobacterium tuberculosis KZN 1435] gi|289416060|gb|EFD13300.1| conserved hypothetical protein [Mycobacterium tuberculosis T46] gi|289420256|gb|EFD17457.1| conserved hypothetical protein [Mycobacterium tuberculosis CPHL_A] gi|289538783|gb|EFD43361.1| conserved hypothetical protein [Mycobacterium tuberculosis K85] gi|289543486|gb|EFD47134.1| conserved hypothetical protein [Mycobacterium tuberculosis T17] gi|289686407|gb|EFD53895.1| conserved hypothetical protein [Mycobacterium tuberculosis 02_1987] gi|289690827|gb|EFD58256.1| conserved hypothetical protein [Mycobacterium tuberculosis T92] gi|289709345|gb|EFD73361.1| conserved hypothetical protein [Mycobacterium tuberculosis GM 1503] gi|298494977|gb|EFI30271.1| conserved hypothetical protein [Mycobacterium tuberculosis 94_M4241A] gi|308215621|gb|EFO75020.1| hypothetical protein TMAG_01517 [Mycobacterium tuberculosis SUMu001] gi|308327339|gb|EFP16190.1| hypothetical protein TMBG_00228 [Mycobacterium tuberculosis SUMu002] gi|308330781|gb|EFP19632.1| hypothetical protein TMCG_03384 [Mycobacterium tuberculosis SUMu003] gi|308334604|gb|EFP23455.1| hypothetical protein TMDG_03401 [Mycobacterium tuberculosis SUMu004] gi|308338391|gb|EFP27242.1| hypothetical protein TMEG_01583 [Mycobacterium tuberculosis SUMu005] gi|308342114|gb|EFP30965.1| hypothetical protein TMFG_00769 [Mycobacterium tuberculosis SUMu006] gi|308345585|gb|EFP34436.1| hypothetical protein TMGG_00231 [Mycobacterium tuberculosis SUMu007] gi|308358499|gb|EFP47350.1| hypothetical protein TMJG_03115 [Mycobacterium tuberculosis SUMu010] gi|308362439|gb|EFP51290.1| hypothetical protein TMKG_02190 [Mycobacterium tuberculosis SUMu011] gi|308366123|gb|EFP54974.1| hypothetical protein TMLG_00666 [Mycobacterium tuberculosis SUMu012] gi|323719774|gb|EGB28888.1| hypothetical protein TMMG_00934 [Mycobacterium tuberculosis CDC1551A] gi|326903298|gb|EGE50231.1| hypothetical protein TBPG_01166 [Mycobacterium tuberculosis W-148] Length = 74 Score = 76.4 bits (188), Expect = 1e-12, Method: Composition-based stats. Identities = 25/59 (42%), Positives = 36/59 (61%), Gaps = 2/59 (3%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEG--TELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D LL ILVCP +G L L+ +G L + + AY I G+P++LV EAR+VD+ Sbjct: 1 MLDEALLAILVCPADRGPLVLVEDGDIQVLYNPRLRRAYRIEDGIPVLLVDEAREVDED 59 >gi|156385432|ref|XP_001633634.1| predicted protein [Nematostella vectensis] gi|156220707|gb|EDO41571.1| predicted protein [Nematostella vectensis] Length = 102 Score = 76.4 bits (188), Expect = 1e-12, Method: Composition-based stats. Identities = 19/60 (31%), Positives = 36/60 (60%) Query: 2 RETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 + D +LL+ILVCPL+K L +E EL+S + +A+ I G+P ++ ++ + ++ Sbjct: 34 SQEKQKFDVKLLDILVCPLSKKPLRYNAETNELISDEIGVAFSIEQGIPNLVPTDGKLLN 93 >gi|307250528|ref|ZP_07532472.1| hypothetical protein appser4_13080 [Actinobacillus pleuropneumoniae serovar 4 str. M62] gi|306857421|gb|EFM89533.1| hypothetical protein appser4_13080 [Actinobacillus pleuropneumoniae serovar 4 str. M62] Length = 55 Score = 76.0 bits (187), Expect = 1e-12, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 34/55 (61%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 ++ +L+ L CP+T L L+S++A LAYPI++G+P++L +++D Sbjct: 1 MNEKLINNLACPVTNTKLEWDKANNRLISREAKLAYPIQNGIPVLLPEAGEKLED 55 >gi|302865495|ref|YP_003834132.1| hypothetical protein Micau_0993 [Micromonospora aurantiaca ATCC 27029] gi|315502043|ref|YP_004080930.1| hypothetical protein ML5_1240 [Micromonospora sp. L5] gi|302568354|gb|ADL44556.1| protein of unknown function DUF343 [Micromonospora aurantiaca ATCC 27029] gi|315408662|gb|ADU06779.1| protein of unknown function DUF343 [Micromonospora sp. L5] Length = 68 Score = 76.0 bits (187), Expect = 1e-12, Method: Composition-based stats. Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Query: 6 FNIDPQLLEILVCPLTK-GNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEAR 58 +DPQLL+IL CP T L ++ L + + +R VP++L+ EAR Sbjct: 1 MALDPQLLDILACPDTHHAPLDYDAQAQTLTCTECGRIFEVRDDVPVLLLDEAR 54 >gi|85711271|ref|ZP_01042330.1| Uncharacterized conserved protein, possible metal-binding domain [Idiomarina baltica OS145] gi|85694772|gb|EAQ32711.1| Uncharacterized conserved protein, possible metal-binding domain [Idiomarina baltica OS145] Length = 65 Score = 76.0 bits (187), Expect = 1e-12, Method: Composition-based stats. Identities = 15/58 (25%), Positives = 28/58 (48%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 + D LL I+ CP KG L L+ + LA+ + G+P+++ +A+ + Sbjct: 1 MSFDKGLLNIIACPSCKGKLVWHEAKQWLVCRGEQLAFELEEGIPVLMSEKAKTLSSD 58 >gi|258592302|emb|CBE68611.1| conserved protein of unknown function [NC10 bacterium 'Dutch sediment'] Length = 59 Score = 76.0 bits (187), Expect = 1e-12, Method: Composition-based stats. Identities = 20/51 (39%), Positives = 27/51 (52%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEA 57 ID +LLEIL CP K + L ++ YPIR +P+ML+ EA Sbjct: 1 MIDKELLEILACPACKAEVVLDEPAVRIVCTACGRRYPIRDDIPVMLIDEA 51 >gi|111017961|ref|YP_700933.1| hypothetical protein RHA1_ro00947 [Rhodococcus jostii RHA1] gi|110817491|gb|ABG92775.1| conserved hypothetical protein [Rhodococcus jostii RHA1] Length = 70 Score = 76.0 bits (187), Expect = 2e-12, Method: Composition-based stats. Identities = 25/58 (43%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 IDP LL IL CP KG L L+ + L + + AYPI +G+P++L+ EAR V Sbjct: 1 MVIDPTLLGILACPQDKGPLLLVGDEL-LYNPRLRRAYPIENGIPVLLIDEARDVGAD 57 >gi|86159030|ref|YP_465815.1| hypothetical protein Adeh_2608 [Anaeromyxobacter dehalogenans 2CP-C] gi|85775541|gb|ABC82378.1| protein of unknown function DUF343 [Anaeromyxobacter dehalogenans 2CP-C] Length = 56 Score = 76.0 bits (187), Expect = 2e-12, Method: Composition-based stats. Identities = 19/55 (34%), Positives = 29/55 (52%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 + P+L +IL CP KG L E+ + LA+ I +P+ML+ EAR + Sbjct: 1 MALSPELKDILACPKCKGELEFREADHEIRCNRCRLAFRIEDDIPVMLLDEARPL 55 >gi|319948167|ref|ZP_08022327.1| hypothetical protein ES5_02439 [Dietzia cinnamea P4] gi|319438151|gb|EFV93111.1| hypothetical protein ES5_02439 [Dietzia cinnamea P4] Length = 73 Score = 76.0 bits (187), Expect = 2e-12, Method: Composition-based stats. Identities = 28/58 (48%), Positives = 38/58 (65%), Gaps = 1/58 (1%) Query: 5 IFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 + ID +LLEIL CP KG L L+ +G L + + AY I G+P++LV E+RQVDD Sbjct: 1 MSVIDARLLEILACPEDKGPLLLV-DGETLYNPRLRRAYRIDDGIPVLLVDESRQVDD 57 >gi|221632731|ref|YP_002521952.1| hypothetical protein trd_0719 [Thermomicrobium roseum DSM 5159] gi|221156858|gb|ACM05985.1| conserved domain protein [Thermomicrobium roseum DSM 5159] Length = 63 Score = 76.0 bits (187), Expect = 2e-12, Method: Composition-based stats. Identities = 27/57 (47%), Positives = 32/57 (56%), Gaps = 2/57 (3%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEA 57 M ET IDP+LLEIL CP G L L L+ + YPI G+PI+LV EA Sbjct: 1 MAETQPIIDPELLEILACPACHGELVL--ANDRLICRTCQRRYPIEDGIPILLVEEA 55 >gi|220917888|ref|YP_002493192.1| protein of unknown function DUF343 [Anaeromyxobacter dehalogenans 2CP-1] gi|219955742|gb|ACL66126.1| protein of unknown function DUF343 [Anaeromyxobacter dehalogenans 2CP-1] Length = 56 Score = 76.0 bits (187), Expect = 2e-12, Method: Composition-based stats. Identities = 19/55 (34%), Positives = 29/55 (52%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 + P+L +IL CP KG L E+ + LA+ I +P+ML+ EAR + Sbjct: 1 MALSPELKDILACPKCKGELEFREADHEIRCNRCRLAFRIEDDIPVMLLDEARPL 55 >gi|163781707|ref|ZP_02176707.1| hypothetical protein HG1285_02453 [Hydrogenivirga sp. 128-5-R1-1] gi|159882927|gb|EDP76431.1| hypothetical protein HG1285_02453 [Hydrogenivirga sp. 128-5-R1-1] Length = 59 Score = 76.0 bits (187), Expect = 2e-12, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 32/54 (59%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 +D +LLEIL CP+ KG+L E L+ ++ + Y ++ G+P++L + + Sbjct: 1 MLDRKLLEILACPVCKGDLLYEEEKDILVCERCGVYYEVKEGIPVLLPDSGKPL 54 >gi|238063002|ref|ZP_04607711.1| hypothetical protein MCAG_03968 [Micromonospora sp. ATCC 39149] gi|237884813|gb|EEP73641.1| hypothetical protein MCAG_03968 [Micromonospora sp. ATCC 39149] Length = 61 Score = 75.7 bits (186), Expect = 2e-12, Method: Composition-based stats. Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Query: 6 FNIDPQLLEILVCPLTK-GNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEAR 58 +DPQLLEIL CP T L + L + + +R VP++L+ EAR Sbjct: 1 MALDPQLLEILACPDTHHAPLDYDAGAQTLTCTECGRIFEVRDDVPVLLLDEAR 54 >gi|317484871|ref|ZP_07943762.1| Trm112p-like protein [Bilophila wadsworthia 3_1_6] gi|316923879|gb|EFV45074.1| Trm112p-like protein [Bilophila wadsworthia 3_1_6] Length = 68 Score = 75.7 bits (186), Expect = 2e-12, Method: Composition-based stats. Identities = 20/57 (35%), Positives = 32/57 (56%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 ++P+LL +L CP+ +G L + + L L +P+R +PIML EA + DD Sbjct: 1 MALNPELLALLACPVCRGELDPVDNESGLECPACGLVFPVRDNIPIMLQEEAIRKDD 57 >gi|254819730|ref|ZP_05224731.1| hypothetical protein MintA_07394 [Mycobacterium intracellulare ATCC 13950] Length = 75 Score = 75.7 bits (186), Expect = 2e-12, Method: Composition-based stats. Identities = 26/60 (43%), Positives = 35/60 (58%), Gaps = 3/60 (5%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTE---LLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 ID LL ILVCP +G L L+S+ L + + AY I G+P++L+ EAR VDD Sbjct: 1 MIDDALLNILVCPADRGPLVLVSQTGGGEVLYNPRLRRAYRIEDGIPVLLIDEARDVDDD 60 >gi|29831592|ref|NP_826226.1| hypothetical protein SAV_5049 [Streptomyces avermitilis MA-4680] gi|29608708|dbj|BAC72761.1| hypothetical protein [Streptomyces avermitilis MA-4680] Length = 56 Score = 75.3 bits (185), Expect = 2e-12, Method: Composition-based stats. Identities = 22/56 (39%), Positives = 31/56 (55%), Gaps = 4/56 (7%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSK--KASLAYPIRSGVPIMLVSEARQ 59 ++ LLEIL CP L +EL+ LAYP+R G+P++LV EAR+ Sbjct: 1 MPLEAGLLEILACPACHAPLK--EAESELICTGQDCGLAYPVRDGIPVLLVDEARR 54 >gi|85858708|ref|YP_460910.1| putative cytoplasmic protein [Syntrophus aciditrophicus SB] gi|85721799|gb|ABC76742.1| hypothetical cytosolic protein [Syntrophus aciditrophicus SB] Length = 67 Score = 75.3 bits (185), Expect = 2e-12, Method: Composition-based stats. Identities = 23/58 (39%), Positives = 32/58 (55%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 I +LL+ILVCP +G L LI + L L Y IR+G+P+ML +A D+ Sbjct: 1 MPIRKELLDILVCPQCRGKLDLIEKEKALTCTGCRLLYEIRNGIPVMLTDQAVTQDND 58 >gi|239930883|ref|ZP_04687836.1| hypothetical protein SghaA1_21866 [Streptomyces ghanaensis ATCC 14672] gi|291439257|ref|ZP_06578647.1| conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672] gi|291342152|gb|EFE69108.1| conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672] Length = 56 Score = 75.3 bits (185), Expect = 3e-12, Method: Composition-based stats. Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 4/56 (7%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSK--KASLAYPIRSGVPIMLVSEARQ 59 ++ LLEIL CP L + TEL+ LAYP+R G+P++LV EAR+ Sbjct: 1 MALEAGLLEILACPACHSPLE--EQDTELVCTGQDCGLAYPVRDGIPVLLVDEARR 54 >gi|95929385|ref|ZP_01312128.1| protein of unknown function DUF343 [Desulfuromonas acetoxidans DSM 684] gi|95134501|gb|EAT16157.1| protein of unknown function DUF343 [Desulfuromonas acetoxidans DSM 684] Length = 59 Score = 75.3 bits (185), Expect = 3e-12, Method: Composition-based stats. Identities = 24/56 (42%), Positives = 37/56 (66%), Gaps = 1/56 (1%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 ID +LL+ LVCP KG + L ++ L+ + SL YP+R G+P+ML+ EA +V+ Sbjct: 1 MGIDQELLQWLVCPKCKGAVQLDNDDK-LVCEACSLRYPVRDGLPVMLIDEAEEVE 55 >gi|149928094|ref|ZP_01916341.1| hypothetical protein LMED105_15134 [Limnobacter sp. MED105] gi|149823180|gb|EDM82417.1| hypothetical protein LMED105_15134 [Limnobacter sp. MED105] Length = 54 Score = 75.3 bits (185), Expect = 3e-12, Method: Composition-based stats. Identities = 22/50 (44%), Positives = 31/50 (62%) Query: 12 LLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 +++ILVCP+ KG L L+ K LA+P+R G+PIMLV +A V Sbjct: 1 MIDILVCPICKGPLEKRPSDGHLVCKADKLAFPVRDGIPIMLVEQAEPVS 50 >gi|197123097|ref|YP_002135048.1| hypothetical protein AnaeK_2694 [Anaeromyxobacter sp. K] gi|196172946|gb|ACG73919.1| protein of unknown function DUF343 [Anaeromyxobacter sp. K] Length = 56 Score = 75.3 bits (185), Expect = 3e-12, Method: Composition-based stats. Identities = 19/55 (34%), Positives = 29/55 (52%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 + P+L +IL CP KG L E+ + LA+ I +P+ML+ EAR + Sbjct: 1 MALSPELKDILACPRCKGELEFREADHEIRCNRCRLAFRIEDDIPVMLLDEARPL 55 >gi|159036554|ref|YP_001535807.1| hypothetical protein Sare_0899 [Salinispora arenicola CNS-205] gi|157915389|gb|ABV96816.1| protein of unknown function DUF343 [Salinispora arenicola CNS-205] Length = 61 Score = 75.3 bits (185), Expect = 3e-12, Method: Composition-based stats. Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Query: 6 FNIDPQLLEILVCPLTK-GNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEAR 58 +DPQLLEIL CP T L + L + + +R VP++L+ EAR Sbjct: 1 MALDPQLLEILACPDTHHAPLDYDAGAQTLTCTECGRIFEVRDDVPVLLLDEAR 54 >gi|302534800|ref|ZP_07287142.1| conserved hypothetical protein [Streptomyces sp. C] gi|302443695|gb|EFL15511.1| conserved hypothetical protein [Streptomyces sp. C] Length = 61 Score = 75.3 bits (185), Expect = 3e-12, Method: Composition-based stats. Identities = 22/59 (37%), Positives = 30/59 (50%), Gaps = 5/59 (8%) Query: 6 FNIDPQLLEILVCPLTKGNLT---LISEGTELLSK--KASLAYPIRSGVPIMLVSEARQ 59 ++ LLEIL CP L EL+ LAYP+R G+P++LV EAR+ Sbjct: 1 MPLEAGLLEILACPACHAPLRDESADETAPELICTGQDCGLAYPVRDGIPVLLVDEARR 59 >gi|32035051|ref|ZP_00135117.1| COG2835: Uncharacterized conserved protein [Actinobacillus pleuropneumoniae serovar 1 str. 4074] gi|126208743|ref|YP_001053968.1| hypothetical protein APL_1277 [Actinobacillus pleuropneumoniae L20] gi|165976696|ref|YP_001652289.1| hypothetical protein APJL_1289 [Actinobacillus pleuropneumoniae serovar 3 str. JL03] gi|126097535|gb|ABN74363.1| hypothetical protein APL_1277 [Actinobacillus pleuropneumoniae serovar 5b str. L20] gi|165876797|gb|ABY69845.1| hypothetical protein APJL_1289 [Actinobacillus pleuropneumoniae serovar 3 str. JL03] Length = 55 Score = 75.3 bits (185), Expect = 3e-12, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 33/55 (60%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 ++ +L+ L CP+T L L+S++A LAYPI +G+P++L +++D Sbjct: 1 MNEKLINHLACPVTNTGLEWDKANNRLISREAKLAYPIENGIPVLLPEAGEKLED 55 >gi|294012878|ref|YP_003546338.1| hypothetical protein SJA_C1-28920 [Sphingobium japonicum UT26S] gi|292676208|dbj|BAI97726.1| conserved hypothetical protein [Sphingobium japonicum UT26S] Length = 59 Score = 74.9 bits (184), Expect = 3e-12, Method: Composition-based stats. Identities = 27/56 (48%), Positives = 39/56 (69%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 +DP LL LVCP+T+ L +E +ELLS A LA+P+R GVP+++V EAR + + Sbjct: 4 TLDPALLAKLVCPVTRMPLRWDAERSELLSDAAGLAFPVRDGVPVLVVREARAMAE 59 >gi|206602481|gb|EDZ38962.1| Conserved protein of unknown function [Leptospirillum sp. Group II '5-way CG'] Length = 61 Score = 74.9 bits (184), Expect = 3e-12, Method: Composition-based stats. Identities = 26/52 (50%), Positives = 34/52 (65%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEA 57 +DP LL +LVCP KG+LT++SE L+ L YPIR +P+MLV EA Sbjct: 1 MPLDPFLLSVLVCPKCKGDLTMVSEPEGLVCPACELLYPIREEIPVMLVEEA 52 >gi|296393965|ref|YP_003658849.1| hypothetical protein Srot_1556 [Segniliparus rotundus DSM 44985] gi|296181112|gb|ADG98018.1| protein of unknown function DUF343 [Segniliparus rotundus DSM 44985] Length = 68 Score = 74.9 bits (184), Expect = 3e-12, Method: Composition-based stats. Identities = 23/56 (41%), Positives = 33/56 (58%), Gaps = 1/56 (1%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 ID +LLEIL CP G L + + L + + +AYPI +G+P++L AR VD Sbjct: 1 MAIDAKLLEILACPQDHGPLLYVPDEL-LYNPRLKVAYPIEAGLPVLLADHARPVD 55 >gi|241165421|ref|XP_002409676.1| protein preY, putative [Ixodes scapularis] gi|215494616|gb|EEC04257.1| protein preY, putative [Ixodes scapularis] Length = 75 Score = 74.9 bits (184), Expect = 4e-12, Method: Composition-based stats. Identities = 18/56 (32%), Positives = 30/56 (53%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 + +LL+I+ CP+TK L L+S + AYPI +G+P +L A + + Sbjct: 19 PFNEELLKIIACPVTKKPLRYDKATNALISDEIEKAYPIVNGIPNLLPENALPLKE 74 >gi|297798328|ref|XP_002867048.1| hypothetical protein ARALYDRAFT_491048 [Arabidopsis lyrata subsp. lyrata] gi|297312884|gb|EFH43307.1| hypothetical protein ARALYDRAFT_491048 [Arabidopsis lyrata subsp. lyrata] Length = 77 Score = 74.9 bits (184), Expect = 4e-12, Method: Composition-based stats. Identities = 19/64 (29%), Positives = 38/64 (59%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 +++ ID L EILVCPL+K L + L+S +++PI+ G+P ++ + + + Sbjct: 9 LKDAGNAIDKTLSEILVCPLSKQPLRFCEKTKSLVSDTIGVSFPIKDGIPCLVPKDGKIL 68 Query: 61 DDQG 64 +++G Sbjct: 69 EEEG 72 >gi|33151464|ref|NP_872817.1| hypothetical protein HD0216 [Haemophilus ducreyi 35000HP] gi|33147684|gb|AAP95206.1| conserved hypothetical protein [Haemophilus ducreyi 35000HP] Length = 55 Score = 74.9 bits (184), Expect = 4e-12, Method: Composition-based stats. Identities = 20/55 (36%), Positives = 34/55 (61%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 ++ LL+ + CPLT L + L+S+ A LAYPI++G+P++L A ++ D Sbjct: 1 MNEALLKTIACPLTHTALEWDKQHNRLISRVAQLAYPIQNGIPVLLPEAAEKIAD 55 >gi|118467750|ref|YP_888059.1| hypothetical protein MSMEG_3764 [Mycobacterium smegmatis str. MC2 155] gi|118169037|gb|ABK69933.1| conserved hypothetical protein [Mycobacterium smegmatis str. MC2 155] Length = 69 Score = 74.5 bits (183), Expect = 4e-12, Method: Composition-based stats. Identities = 23/57 (40%), Positives = 34/57 (59%), Gaps = 1/57 (1%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 ID +LL ILVCP +G L L+ + L + + AY I G+P++LV EA ++D Sbjct: 1 MIDEKLLSILVCPQDRGPLLLVGDE-WLYNPRLRRAYRIEDGIPVLLVDEAVAIEDD 56 >gi|288818489|ref|YP_003432837.1| hypothetical protein HTH_1182 [Hydrogenobacter thermophilus TK-6] gi|288787889|dbj|BAI69636.1| conserved hypothetical protein [Hydrogenobacter thermophilus TK-6] gi|308752079|gb|ADO45562.1| protein of unknown function DUF343 [Hydrogenobacter thermophilus TK-6] Length = 58 Score = 74.5 bits (183), Expect = 5e-12, Method: Composition-based stats. Identities = 18/56 (32%), Positives = 31/56 (55%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 +D +LL+IL CP K L E L+ + + YPI G+PI+L ++ +++ Sbjct: 1 MVDEELLKILACPKCKKELFYNRERDVLICENCQVFYPIEDGIPILLTDASKPLEE 56 >gi|330465907|ref|YP_004403650.1| hypothetical protein VAB18032_09660 [Verrucosispora maris AB-18-032] gi|328808878|gb|AEB43050.1| hypothetical protein VAB18032_09660 [Verrucosispora maris AB-18-032] Length = 60 Score = 74.5 bits (183), Expect = 5e-12, Method: Composition-based stats. Identities = 20/54 (37%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Query: 6 FNIDPQLLEILVCPLTK-GNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEAR 58 +DPQLLEIL CP T L ++ L + + +R VP++L+ EAR Sbjct: 1 MALDPQLLEILACPDTHHAPLDYDAQAQTLTCTECGRIFEVRDDVPVLLLDEAR 54 >gi|294629702|ref|ZP_06708262.1| conserved hypothetical protein [Streptomyces sp. e14] gi|292833035|gb|EFF91384.1| conserved hypothetical protein [Streptomyces sp. e14] Length = 56 Score = 74.5 bits (183), Expect = 5e-12, Method: Composition-based stats. Identities = 23/56 (41%), Positives = 31/56 (55%), Gaps = 4/56 (7%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSK--KASLAYPIRSGVPIMLVSEARQ 59 ++ LLEIL CP L E EL+ LAYP+R G+P++LV EAR+ Sbjct: 1 MPLEAGLLEILACPACHSPLK--EEDAELVCTGQDCGLAYPVRDGIPVLLVDEARR 54 >gi|303257721|ref|ZP_07343733.1| tetraacyldisaccharide 4'-kinase (Lipid A 4'-kinase) [Burkholderiales bacterium 1_1_47] gi|331000995|ref|ZP_08324631.1| hypothetical protein HMPREF9439_02285 [Parasutterella excrementihominis YIT 11859] gi|302859691|gb|EFL82770.1| tetraacyldisaccharide 4'-kinase (Lipid A 4'-kinase) [Burkholderiales bacterium 1_1_47] gi|329569770|gb|EGG51534.1| hypothetical protein HMPREF9439_02285 [Parasutterella excrementihominis YIT 11859] Length = 66 Score = 74.5 bits (183), Expect = 5e-12, Method: Composition-based stats. Identities = 20/53 (37%), Positives = 30/53 (56%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEAR 58 +D ++ EILVCPL KG L + E + A+P+ G+P M+ +EAR Sbjct: 1 MLMDAKITEILVCPLCKGPLLWNEKKKEFYCRSDMKAFPVIDGIPCMVPTEAR 53 >gi|118602815|ref|YP_904030.1| hypothetical protein Rmag_0842 [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] gi|118567754|gb|ABL02559.1| protein of unknown function DUF343 [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] Length = 59 Score = 74.5 bits (183), Expect = 5e-12, Method: Composition-based stats. Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 2/55 (3%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 ID LL++LVCP +K L + G EL+ + + LAYPI G+PI+LV EA Q++ Sbjct: 1 MIDEALLKLLVCPKSKAPLKQV--GNELICEVSGLAYPIEDGIPILLVEEACQLE 53 >gi|116621475|ref|YP_823631.1| hypothetical protein Acid_2357 [Candidatus Solibacter usitatus Ellin6076] gi|116224637|gb|ABJ83346.1| protein of unknown function DUF343 [Candidatus Solibacter usitatus Ellin6076] Length = 56 Score = 74.5 bits (183), Expect = 5e-12, Method: Composition-based stats. Identities = 22/53 (41%), Positives = 30/53 (56%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEAR 58 I LLEILVCP+ K + L + + L + YPIR +P+MLV EA+ Sbjct: 1 MAISKDLLEILVCPMCKATVELKPDNSGLKCVECHRVYPIRDDIPVMLVDEAK 53 >gi|328952664|ref|YP_004369998.1| protein of unknown function DUF343 [Desulfobacca acetoxidans DSM 11109] gi|328452988|gb|AEB08817.1| protein of unknown function DUF343 [Desulfobacca acetoxidans DSM 11109] Length = 56 Score = 74.1 bits (182), Expect = 6e-12, Method: Composition-based stats. Identities = 20/56 (35%), Positives = 35/56 (62%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 +I +LLEIL CP KG + L +G L+ + L Y I+ +PIM++ +A++++ Sbjct: 1 MSISKELLEILACPQCKGEVQLTPQGDGLICPRCKLLYEIKDDIPIMIIEKAKRLE 56 >gi|297200120|ref|ZP_06917517.1| conserved hypothetical protein [Streptomyces sviceus ATCC 29083] gi|197717492|gb|EDY61526.1| conserved hypothetical protein [Streptomyces sviceus ATCC 29083] Length = 56 Score = 74.1 bits (182), Expect = 6e-12, Method: Composition-based stats. Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 4/56 (7%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSK--KASLAYPIRSGVPIMLVSEARQ 59 ++ LLEIL CP L + TEL+ LAYP+R G+P++LV EAR+ Sbjct: 1 MPLEAGLLEILACPACHAPLK--EQDTELICTGQDCGLAYPVRDGIPVLLVDEARR 54 >gi|118617294|ref|YP_905626.1| hypothetical protein MUL_1661 [Mycobacterium ulcerans Agy99] gi|183982493|ref|YP_001850784.1| hypothetical protein MMAR_2479 [Mycobacterium marinum M] gi|118569404|gb|ABL04155.1| conserved protein [Mycobacterium ulcerans Agy99] gi|183175819|gb|ACC40929.1| conserved protein [Mycobacterium marinum M] Length = 77 Score = 74.1 bits (182), Expect = 6e-12, Method: Composition-based stats. Identities = 22/60 (36%), Positives = 35/60 (58%), Gaps = 3/60 (5%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTE---LLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +LL+ILVCP +G L L+ +G L + + AY I +P++L+ +AR V D Sbjct: 1 MLDEKLLKILVCPADRGPLLLVEDGERGRLLYNPRLRRAYRIDDDIPVLLIDQARDVTDD 60 >gi|15827701|ref|NP_301964.1| hypothetical protein ML1347 [Mycobacterium leprae TN] gi|221230178|ref|YP_002503594.1| hypothetical protein MLBr_01347 [Mycobacterium leprae Br4923] gi|13093252|emb|CAC31728.1| conserved hypothetical protein [Mycobacterium leprae] gi|219933285|emb|CAR71442.1| conserved hypothetical protein [Mycobacterium leprae Br4923] Length = 77 Score = 74.1 bits (182), Expect = 6e-12, Method: Composition-based stats. Identities = 24/62 (38%), Positives = 32/62 (51%), Gaps = 5/62 (8%) Query: 7 NIDPQLLEILVCPLTKGNLT-----LISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 +D LL ILVCP +G L + G + + AY I G+P++LV EAR VD Sbjct: 1 MLDDLLLSILVCPADRGPLVLVDQGYGAGGQSFYNPRLRRAYRIDDGIPVLLVDEARDVD 60 Query: 62 DQ 63 D Sbjct: 61 DD 62 >gi|322515317|ref|ZP_08068314.1| tetraacyldisaccharide 4'-kinase [Actinobacillus ureae ATCC 25976] gi|322118693|gb|EFX90905.1| tetraacyldisaccharide 4'-kinase [Actinobacillus ureae ATCC 25976] Length = 55 Score = 74.1 bits (182), Expect = 6e-12, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 33/54 (61%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 ++ +L+ L CP+T L L+S++A LAYPI++G+P++L +++ Sbjct: 1 MNEKLINNLACPVTNTKLEWDKTSNRLISREAKLAYPIQNGIPVLLPEAGEKLE 54 >gi|290959903|ref|YP_003491085.1| hypothetical protein SCAB_55141 [Streptomyces scabiei 87.22] gi|260649429|emb|CBG72544.1| conserved hypothetical protein [Streptomyces scabiei 87.22] Length = 56 Score = 74.1 bits (182), Expect = 6e-12, Method: Composition-based stats. Identities = 26/56 (46%), Positives = 32/56 (57%), Gaps = 4/56 (7%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSK--KASLAYPIRSGVPIMLVSEARQ 59 ++ LLEIL CP LT E TEL LAYPIR G+P++LV EAR+ Sbjct: 1 MPLEAGLLEILACPACHAPLT--EEDTELTCTSQDCGLAYPIRDGIPVLLVDEARR 54 >gi|255020539|ref|ZP_05292603.1| protein of unknown function DUF343 [Acidithiobacillus caldus ATCC 51756] gi|254970059|gb|EET27557.1| protein of unknown function DUF343 [Acidithiobacillus caldus ATCC 51756] Length = 61 Score = 74.1 bits (182), Expect = 7e-12, Method: Composition-based stats. Identities = 18/56 (32%), Positives = 31/56 (55%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 +ID +LL++L CP KG L + L ++ L +PI +P++L+ EA+ Sbjct: 1 MSIDRRLLDLLACPQCKGTLRPCRQREALCCERCQLLFPILDDIPVLLLDEAQPFS 56 >gi|302343519|ref|YP_003808048.1| hypothetical protein Deba_2089 [Desulfarculus baarsii DSM 2075] gi|301640132|gb|ADK85454.1| protein of unknown function DUF343 [Desulfarculus baarsii DSM 2075] Length = 58 Score = 73.7 bits (181), Expect = 7e-12, Method: Composition-based stats. Identities = 22/55 (40%), Positives = 31/55 (56%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 I+ +LLE+LVCP KG L + L +L Y +R +PIMLV EA+ + Sbjct: 1 MAINQELLELLVCPKCKGRLDADPQWRWLDCPACALRYEVRDNIPIMLVEEAKPL 55 >gi|254775540|ref|ZP_05217056.1| hypothetical protein MaviaA2_12848 [Mycobacterium avium subsp. avium ATCC 25291] Length = 71 Score = 73.7 bits (181), Expect = 7e-12, Method: Composition-based stats. Identities = 25/57 (43%), Positives = 35/57 (61%), Gaps = 1/57 (1%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 ID LL ILVCP +G L L+ + L + + AY I G+P++L+ EAR VDD+ Sbjct: 1 MIDEALLNILVCPADRGPLVLVGQEL-LYNPRLRRAYRIEDGIPVLLIDEARDVDDE 56 >gi|195952863|ref|YP_002121153.1| protein of unknown function DUF343 [Hydrogenobaculum sp. Y04AAS1] gi|195932475|gb|ACG57175.1| protein of unknown function DUF343 [Hydrogenobaculum sp. Y04AAS1] Length = 61 Score = 73.7 bits (181), Expect = 7e-12, Method: Composition-based stats. Identities = 19/56 (33%), Positives = 31/56 (55%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 I+ +LL+I+ CP KG L + L+ L Y I +PI+LV +A+ +D+ Sbjct: 1 MINKELLDIIACPKCKGGLLYNEKKDILICGNCKLVYEIEEDIPILLVEQAKPLDE 56 >gi|302560318|ref|ZP_07312660.1| conserved hypothetical protein [Streptomyces griseoflavus Tu4000] gi|302477936|gb|EFL41029.1| conserved hypothetical protein [Streptomyces griseoflavus Tu4000] Length = 56 Score = 73.7 bits (181), Expect = 8e-12, Method: Composition-based stats. Identities = 22/56 (39%), Positives = 32/56 (57%), Gaps = 4/56 (7%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSK--KASLAYPIRSGVPIMLVSEARQ 59 ++ LLEIL CP L + +EL+ LAYP+R G+P++LV EAR+ Sbjct: 1 MPLEAGLLEILACPACHSPLK--EQDSELICTGADCGLAYPVRDGIPVLLVDEARR 54 >gi|182438302|ref|YP_001826021.1| hypothetical protein SGR_4509 [Streptomyces griseus subsp. griseus NBRC 13350] gi|326778953|ref|ZP_08238218.1| protein of unknown function DUF343 [Streptomyces cf. griseus XylebKG-1] gi|178466818|dbj|BAG21338.1| conserved hypothetical protein [Streptomyces griseus subsp. griseus NBRC 13350] gi|326659286|gb|EGE44132.1| protein of unknown function DUF343 [Streptomyces cf. griseus XylebKG-1] Length = 60 Score = 73.7 bits (181), Expect = 8e-12, Method: Composition-based stats. Identities = 22/58 (37%), Positives = 32/58 (55%), Gaps = 4/58 (6%) Query: 6 FNIDPQLLEILVCPLTKGNL--TLISEGTELLS--KKASLAYPIRSGVPIMLVSEARQ 59 ++ LLEIL CP L ++ EL+ LAYP+R G+P++LV EAR+ Sbjct: 1 MALEAGLLEILACPACHSPLDDRSAADSPELVCTGDDCGLAYPVRDGIPVLLVDEARR 58 >gi|18419744|ref|NP_567992.1| unknown protein [Arabidopsis thaliana] gi|21536733|gb|AAM61065.1| unknown [Arabidopsis thaliana] gi|62319357|dbj|BAD94651.1| hypothetical protein [Arabidopsis thaliana] gi|88010908|gb|ABD38871.1| At4g35905 [Arabidopsis thaliana] gi|332661187|gb|AEE86587.1| uncharacterized protein [Arabidopsis thaliana] Length = 77 Score = 73.7 bits (181), Expect = 8e-12, Method: Composition-based stats. Identities = 19/64 (29%), Positives = 38/64 (59%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 +++ ID L EILVCPL+K L + L+S +++PI+ G+P ++ + + + Sbjct: 9 LKDAGNVIDKTLSEILVCPLSKQPLRFCEKTKSLVSDTIGVSFPIKDGIPCLVPKDGKIL 68 Query: 61 DDQG 64 +++G Sbjct: 69 EEEG 72 >gi|296140092|ref|YP_003647335.1| hypothetical protein Tpau_2390 [Tsukamurella paurometabola DSM 20162] gi|296028226|gb|ADG78996.1| protein of unknown function DUF343 [Tsukamurella paurometabola DSM 20162] Length = 71 Score = 73.7 bits (181), Expect = 8e-12, Method: Composition-based stats. Identities = 24/57 (42%), Positives = 34/57 (59%), Gaps = 1/57 (1%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 ID LL+IL CP KG L + + + + AYPI G+P++L++EAR VDD Sbjct: 4 MPIDATLLKILACPQDKGPLLYVPDEL-FYNPRLRRAYPIEDGLPVLLITEARDVDD 59 >gi|71892155|ref|YP_277887.1| hypothetical protein BPEN_388 [Candidatus Blochmannia pennsylvanicus str. BPEN] gi|123640959|sp|Q492T1|Y388_BLOPB RecName: Full=UPF0434 protein BPEN_388 gi|71796261|gb|AAZ41012.1| conserved hypothetical protein [Candidatus Blochmannia pennsylvanicus str. BPEN] Length = 55 Score = 73.7 bits (181), Expect = 9e-12, Method: Composition-based stats. Identities = 21/51 (41%), Positives = 33/51 (64%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEAR 58 + QLL+I+VCP+ L+ E EL+ +LA+PIR G+P++L +AR Sbjct: 1 MKYQLLKIIVCPVCHSKLSFDLEKKELICNVDNLAFPIRKGIPVLLKRDAR 51 >gi|325180655|emb|CCA15060.1| conserved hypothetical protein [Albugo laibachii Nc14] Length = 111 Score = 73.3 bits (180), Expect = 9e-12, Method: Composition-based stats. Identities = 19/56 (33%), Positives = 31/56 (55%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 D +L+ LVCP++K L L+ +AYPIR G+PI++ +E + + D Sbjct: 51 AFDEAVLKHLVCPVSKYPLHYDKLRGMLVCSDVQVAYPIRDGMPILIPAEGKFLSD 106 >gi|148886663|ref|NP_001092162.1| phosphatidylinositol glycan anchor biosynthesis, class Y [Xenopus laevis] gi|146327497|gb|AAI41741.1| LOC100049752 protein [Xenopus laevis] Length = 120 Score = 73.3 bits (180), Expect = 1e-11, Method: Composition-based stats. Identities = 20/56 (35%), Positives = 32/56 (57%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 D LL+ LVCPL++ +L EL++ + +AYPI G+P M+ +AR + Sbjct: 55 FDSSLLQYLVCPLSRKSLRYEESTNELMNDELGIAYPIVDGIPNMIPQDARMIQKD 110 >gi|124514724|gb|EAY56236.1| conserved protein of unknown function [Leptospirillum rubarum] Length = 61 Score = 73.3 bits (180), Expect = 1e-11, Method: Composition-based stats. Identities = 23/57 (40%), Positives = 31/57 (54%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 +DP L +LVCP KG+LT++ + L L YPIR +P+MLV EA Sbjct: 1 MPLDPFLQSVLVCPKCKGDLTMVDDPEGLACPACQLVYPIREEIPVMLVEEALPYSS 57 >gi|283850996|ref|ZP_06368281.1| protein of unknown function DUF343 [Desulfovibrio sp. FW1012B] gi|283573642|gb|EFC21617.1| protein of unknown function DUF343 [Desulfovibrio sp. FW1012B] Length = 67 Score = 73.3 bits (180), Expect = 1e-11, Method: Composition-based stats. Identities = 23/57 (40%), Positives = 29/57 (50%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 I P LL IL CP KG L + G L + + YP+R +PIML+ EA D Sbjct: 1 MTIHPDLLTILACPKCKGELMTLGNGEGLACQPCGVVYPVRDDIPIMLLEEAVPRAD 57 >gi|242277542|ref|YP_002989671.1| hypothetical protein Desal_0061 [Desulfovibrio salexigens DSM 2638] gi|242120436|gb|ACS78132.1| protein of unknown function DUF343 [Desulfovibrio salexigens DSM 2638] Length = 61 Score = 73.3 bits (180), Expect = 1e-11, Method: Composition-based stats. Identities = 21/56 (37%), Positives = 32/56 (57%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 ++ +L++ILVCP K L L+ T L ++ YP++ +PIMLV EA D Sbjct: 1 MTLNKELIDILVCPKCKSELELLPGETGLKCDACNVIYPVKDEIPIMLVDEAVPAD 56 >gi|239941720|ref|ZP_04693657.1| hypothetical protein SrosN15_12037 [Streptomyces roseosporus NRRL 15998] gi|239988180|ref|ZP_04708844.1| hypothetical protein SrosN1_12816 [Streptomyces roseosporus NRRL 11379] gi|291445163|ref|ZP_06584553.1| conserved hypothetical protein [Streptomyces roseosporus NRRL 15998] gi|291348110|gb|EFE75014.1| conserved hypothetical protein [Streptomyces roseosporus NRRL 15998] Length = 60 Score = 73.3 bits (180), Expect = 1e-11, Method: Composition-based stats. Identities = 22/58 (37%), Positives = 32/58 (55%), Gaps = 4/58 (6%) Query: 6 FNIDPQLLEILVCPLTKGNL--TLISEGTELLS--KKASLAYPIRSGVPIMLVSEARQ 59 ++ LLEIL CP L ++ EL+ LAYP+R G+P++LV EAR+ Sbjct: 1 MPLEAGLLEILACPACHSPLDDRSTADTPELVCTGDDCGLAYPVRDGIPVLLVDEARR 58 >gi|222474785|ref|YP_002563200.1| hypothetical protein AMF_1034 [Anaplasma marginale str. Florida] gi|222418921|gb|ACM48944.1| Conserved hypothetical protein [Anaplasma marginale str. Florida] Length = 50 Score = 73.0 bits (179), Expect = 1e-11, Method: Composition-based stats. Identities = 21/48 (43%), Positives = 33/48 (68%) Query: 16 LVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +VCPLT G L ++ EL+S+ A LA+P+ G+P+ML EAR+++ Sbjct: 1 MVCPLTGGELYYDADSCELVSENAGLAFPVHDGIPVMLADEARKLEPD 48 >gi|256396704|ref|YP_003118268.1| hypothetical protein Caci_7603 [Catenulispora acidiphila DSM 44928] gi|256362930|gb|ACU76427.1| protein of unknown function DUF343 [Catenulispora acidiphila DSM 44928] Length = 57 Score = 73.0 bits (179), Expect = 1e-11, Method: Composition-based stats. Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 2/55 (3%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSK--KASLAYPIRSGVPIMLVSEARQ 59 I+P LLEIL CP L L + +L YP+R G+P++L+ EA + Sbjct: 1 MIEPSLLEILACPKCHAPLREDEAAPALACTNSECALVYPVRDGIPVLLIDEATK 55 >gi|329941057|ref|ZP_08290336.1| hypothetical protein SGM_5828 [Streptomyces griseoaurantiacus M045] gi|329299588|gb|EGG43487.1| hypothetical protein SGM_5828 [Streptomyces griseoaurantiacus M045] Length = 56 Score = 73.0 bits (179), Expect = 1e-11, Method: Composition-based stats. Identities = 24/56 (42%), Positives = 32/56 (57%), Gaps = 4/56 (7%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLS--KKASLAYPIRSGVPIMLVSEARQ 59 ++ LLEIL CP L EL+ K +LAYPIR G+P++LV EAR+ Sbjct: 1 MPLEAGLLEILACPACHAPLK--EADDELVCTAKDCALAYPIRDGIPVLLVDEARR 54 >gi|15602724|ref|NP_245796.1| hypothetical protein PM0859 [Pasteurella multocida subsp. multocida str. Pm70] gi|81636948|sp|Q9CMG9|Y859_PASMU RecName: Full=UPF0434 protein PM0859 gi|12721169|gb|AAK02943.1| unknown [Pasteurella multocida subsp. multocida str. Pm70] Length = 60 Score = 73.0 bits (179), Expect = 1e-11, Method: Composition-based stats. Identities = 18/54 (33%), Positives = 29/54 (53%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 +D LLEI+ CP+ G L L +L+ +AY I G+P++L +A + Sbjct: 1 MDSTLLEIVACPICHGRLALDQTSQKLVCHFDKVAYDINQGIPVLLAEQAMPLS 54 >gi|117927675|ref|YP_872226.1| hypothetical protein Acel_0466 [Acidothermus cellulolyticus 11B] gi|117648138|gb|ABK52240.1| protein of unknown function DUF343 [Acidothermus cellulolyticus 11B] Length = 77 Score = 72.6 bits (178), Expect = 2e-11, Method: Composition-based stats. Identities = 23/72 (31%), Positives = 36/72 (50%), Gaps = 10/72 (13%) Query: 2 RETIFNIDPQLLEILVCPLTKGNLTLI--------SEGTELLSK--KASLAYPIRSGVPI 51 + + IDP LL+IL CP + L + + EL+ AYPIR G+PI Sbjct: 6 QSSAAAIDPALLDILACPACRSALQVRTGEKPAGGAASGELVCTNTDCRRAYPIREGIPI 65 Query: 52 MLVSEARQVDDQ 63 +L+ E+R + + Sbjct: 66 LLIDESRVLPAE 77 >gi|296164581|ref|ZP_06847149.1| conserved hypothetical protein [Mycobacterium parascrofulaceum ATCC BAA-614] gi|295900061|gb|EFG79499.1| conserved hypothetical protein [Mycobacterium parascrofulaceum ATCC BAA-614] Length = 71 Score = 72.6 bits (178), Expect = 2e-11, Method: Composition-based stats. Identities = 26/57 (45%), Positives = 34/57 (59%), Gaps = 1/57 (1%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 ID LL ILVCP +G L L+ + L + + AY I G+P++LV EAR VDD Sbjct: 1 MIDDALLSILVCPADRGPLLLVDDEL-LYNPRLRRAYRIEDGIPVLLVDEARDVDDD 56 >gi|332288739|ref|YP_004419591.1| Trm112p-like protein [Gallibacterium anatis UMN179] gi|330431635|gb|AEC16694.1| Trm112p-like protein [Gallibacterium anatis UMN179] Length = 65 Score = 72.6 bits (178), Expect = 2e-11, Method: Composition-based stats. Identities = 15/56 (26%), Positives = 28/56 (50%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 + +++ +L CP L+L + L+ + LAYPI +G+P +L A + Sbjct: 1 MKQKVINMLACPHCHQPLSLDEQQQRLICENEQLAYPIVNGIPALLPENAVALTQD 56 >gi|297625949|ref|YP_003687712.1| hypothetical protein PFREUD_07410 [Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1] gi|296921714|emb|CBL56272.1| Hypothetical protein PFREUD_07410 [Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1] Length = 66 Score = 72.6 bits (178), Expect = 2e-11, Method: Composition-based stats. Identities = 22/56 (39%), Positives = 28/56 (50%), Gaps = 2/56 (3%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKK--ASLAYPIRSGVPIMLVSEARQ 59 + LEI CP L + E +EL LAYP+R G+PI+LV EAR Sbjct: 7 LEMPTTFLEIAACPQCHSKLAVDYEHSELACTNSLCGLAYPVRDGIPILLVDEARS 62 >gi|21221470|ref|NP_627249.1| hypothetical protein SCO3027 [Streptomyces coelicolor A3(2)] gi|256787345|ref|ZP_05525776.1| hypothetical protein SlivT_22879 [Streptomyces lividans TK24] gi|289771239|ref|ZP_06530617.1| conserved hypothetical protein [Streptomyces lividans TK24] gi|285803116|pdb|2KPI|A Chain A, Solution Nmr Structure Of Streptomyces Coelicolor Sco3027 Modeled With Zn+2 Bound, Northeast Structural Genomics Consortium Target Rr58 gi|7649491|emb|CAB88911.1| hypothetical protein SCD84.08c [Streptomyces coelicolor A3(2)] gi|289701438|gb|EFD68867.1| conserved hypothetical protein [Streptomyces lividans TK24] Length = 56 Score = 72.2 bits (177), Expect = 2e-11, Method: Composition-based stats. Identities = 22/56 (39%), Positives = 30/56 (53%), Gaps = 4/56 (7%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSK--KASLAYPIRSGVPIMLVSEARQ 59 ++ LLEIL CP L EL+ LAYP+R G+P++LV EAR+ Sbjct: 1 MPLEAGLLEILACPACHAPLE--ERDAELICTGQDCGLAYPVRDGIPVLLVDEARR 54 >gi|41407488|ref|NP_960324.1| hypothetical protein MAP1390 [Mycobacterium avium subsp. paratuberculosis K-10] gi|41395840|gb|AAS03707.1| hypothetical protein MAP_1390 [Mycobacterium avium subsp. paratuberculosis K-10] Length = 71 Score = 72.2 bits (177), Expect = 2e-11, Method: Composition-based stats. Identities = 25/57 (43%), Positives = 35/57 (61%), Gaps = 1/57 (1%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 ID LL ILVCP +G L L+ + L + + AY I G+P++L+ EAR VDD+ Sbjct: 1 MIDEALLNILVCPADRGPLVLVGQEL-LYNPRLRRAYRIEDGIPVLLMDEARDVDDE 56 >gi|301155978|emb|CBW15448.1| conserved protein [Haemophilus parainfluenzae T3T1] Length = 59 Score = 72.2 bits (177), Expect = 2e-11, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 31/55 (56%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 ++P+LLE++ CP L E L+ +AYPI +GVP++L +A + + Sbjct: 5 LNPRLLEVIACPRCLARLKYDQENQRLICPFEQVAYPIENGVPVLLAEKAETLKE 59 >gi|307331845|ref|ZP_07610944.1| protein of unknown function DUF343 [Streptomyces violaceusniger Tu 4113] gi|306882504|gb|EFN13591.1| protein of unknown function DUF343 [Streptomyces violaceusniger Tu 4113] Length = 60 Score = 72.2 bits (177), Expect = 3e-11, Method: Composition-based stats. Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 4/58 (6%) Query: 6 FNIDPQLLEILVCPLTKGNL--TLISEGTELLS--KKASLAYPIRSGVPIMLVSEARQ 59 ++ LL+IL CP L E EL+ + SLAYP+R G+P++LV EAR+ Sbjct: 1 MPLEAGLLDILACPACHAPLREEQSPETPELVCTGEGCSLAYPVRDGIPVLLVDEARR 58 >gi|118463854|ref|YP_882272.1| hypothetical protein MAV_3087 [Mycobacterium avium 104] gi|118165141|gb|ABK66038.1| conserved hypothetical protein [Mycobacterium avium 104] Length = 71 Score = 71.8 bits (176), Expect = 3e-11, Method: Composition-based stats. Identities = 25/57 (43%), Positives = 35/57 (61%), Gaps = 1/57 (1%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 ID LL ILVCP +G L L+ + L + + AY I G+P++L+ EAR VDD+ Sbjct: 1 MIDEALLNILVCPADRGPLVLVGQEL-LYNPRLRRAYRIEDGIPVLLIGEARDVDDE 56 >gi|302551849|ref|ZP_07304191.1| conserved hypothetical protein [Streptomyces viridochromogenes DSM 40736] gi|302469467|gb|EFL32560.1| conserved hypothetical protein [Streptomyces viridochromogenes DSM 40736] Length = 56 Score = 71.8 bits (176), Expect = 3e-11, Method: Composition-based stats. Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 4/56 (7%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKK--ASLAYPIRSGVPIMLVSEARQ 59 ++ LL+IL CP L + TELL LAYP+R G+P++LV EAR+ Sbjct: 1 MPLEAGLLDILACPACHAPLE--EKDTELLCTAQNCGLAYPVRDGIPVLLVDEARR 54 >gi|281341660|gb|EFB17244.1| hypothetical protein PANDA_006641 [Ailuropoda melanoleuca] Length = 103 Score = 71.8 bits (176), Expect = 3e-11, Method: Composition-based stats. Identities = 21/52 (40%), Positives = 30/52 (57%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEAR 58 D LLE LVC L+K L + EL++++ +AYPI G+P M+ AR Sbjct: 39 AFDLALLEFLVCLLSKKPLRYEASTNELINEELGIAYPIIDGIPNMIPQAAR 90 >gi|190150596|ref|YP_001969121.1| hypothetical protein APP7_1327 [Actinobacillus pleuropneumoniae serovar 7 str. AP76] gi|303250642|ref|ZP_07336839.1| hypothetical protein APP6_0227 [Actinobacillus pleuropneumoniae serovar 6 str. Femo] gi|303252094|ref|ZP_07338263.1| hypothetical protein APP2_1065 [Actinobacillus pleuropneumoniae serovar 2 str. 4226] gi|307246194|ref|ZP_07528275.1| hypothetical protein appser1_13980 [Actinobacillus pleuropneumoniae serovar 1 str. 4074] gi|307248300|ref|ZP_07530325.1| hypothetical protein appser2_12780 [Actinobacillus pleuropneumoniae serovar 2 str. S1536] gi|307252910|ref|ZP_07534798.1| hypothetical protein appser6_14210 [Actinobacillus pleuropneumoniae serovar 6 str. Femo] gi|307255174|ref|ZP_07536992.1| hypothetical protein appser9_14100 [Actinobacillus pleuropneumoniae serovar 9 str. CVJ13261] gi|307257342|ref|ZP_07539112.1| hypothetical protein appser10_13400 [Actinobacillus pleuropneumoniae serovar 10 str. D13039] gi|307259612|ref|ZP_07541336.1| hypothetical protein appser11_14100 [Actinobacillus pleuropneumoniae serovar 11 str. 56153] gi|307261753|ref|ZP_07543419.1| hypothetical protein appser12_13120 [Actinobacillus pleuropneumoniae serovar 12 str. 1096] gi|307263940|ref|ZP_07545543.1| hypothetical protein appser13_13480 [Actinobacillus pleuropneumoniae serovar 13 str. N273] gi|189915727|gb|ACE61979.1| hypothetical protein APP7_1327 [Actinobacillus pleuropneumoniae serovar 7 str. AP76] gi|302649076|gb|EFL79263.1| hypothetical protein APP2_1065 [Actinobacillus pleuropneumoniae serovar 2 str. 4226] gi|302650630|gb|EFL80789.1| hypothetical protein APP6_0227 [Actinobacillus pleuropneumoniae serovar 6 str. Femo] gi|306852803|gb|EFM85027.1| hypothetical protein appser1_13980 [Actinobacillus pleuropneumoniae serovar 1 str. 4074] gi|306855170|gb|EFM87348.1| hypothetical protein appser2_12780 [Actinobacillus pleuropneumoniae serovar 2 str. S1536] gi|306859548|gb|EFM91573.1| hypothetical protein appser6_14210 [Actinobacillus pleuropneumoniae serovar 6 str. Femo] gi|306862047|gb|EFM94023.1| hypothetical protein appser9_14100 [Actinobacillus pleuropneumoniae serovar 9 str. CVJ13261] gi|306864192|gb|EFM96105.1| hypothetical protein appser10_13400 [Actinobacillus pleuropneumoniae serovar 10 str. D13039] gi|306866257|gb|EFM98121.1| hypothetical protein appser11_14100 [Actinobacillus pleuropneumoniae serovar 11 str. 56153] gi|306868571|gb|EFN00382.1| hypothetical protein appser12_13120 [Actinobacillus pleuropneumoniae serovar 12 str. 1096] gi|306870702|gb|EFN02443.1| hypothetical protein appser13_13480 [Actinobacillus pleuropneumoniae serovar 13 str. N273] Length = 55 Score = 71.8 bits (176), Expect = 3e-11, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 32/55 (58%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 ++ +L+ L CP+T L L+S++A LAYPI + +P++L +++D Sbjct: 1 MNEKLINHLACPVTNTGLEWDKANNRLISREAKLAYPIENSIPVLLPEAGEKLED 55 >gi|255580651|ref|XP_002531148.1| Protein preY, mitochondrial precursor, putative [Ricinus communis] gi|223529261|gb|EEF31233.1| Protein preY, mitochondrial precursor, putative [Ricinus communis] Length = 88 Score = 71.8 bits (176), Expect = 3e-11, Method: Composition-based stats. Identities = 19/63 (30%), Positives = 35/63 (55%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 ++E I+ L EILVCPL+K L + L+S ++YPI+ G+P ++ + + + Sbjct: 9 LKEAGNGINKTLSEILVCPLSKQPLRICEATNSLISDAIGVSYPIKDGIPCLVPLDGKIL 68 Query: 61 DDQ 63 + Sbjct: 69 ETD 71 >gi|255630315|gb|ACU15514.1| unknown [Glycine max] Length = 90 Score = 71.8 bits (176), Expect = 3e-11, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 33/54 (61%) Query: 10 PQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 L +ILVCPL+K L E L+S +A+PI++G+P ++ + + ++++ Sbjct: 14 KTLSDILVCPLSKQPLRYCQESNSLISDAIGVAFPIKNGIPCLVPRDGKVLEEE 67 >gi|325578729|ref|ZP_08148776.1| tetraacyldisaccharide 4'-kinase [Haemophilus parainfluenzae ATCC 33392] gi|325159553|gb|EGC71685.1| tetraacyldisaccharide 4'-kinase [Haemophilus parainfluenzae ATCC 33392] Length = 59 Score = 71.8 bits (176), Expect = 3e-11, Method: Composition-based stats. Identities = 21/62 (33%), Positives = 34/62 (54%), Gaps = 3/62 (4%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 MRE ++P+LLE++ CP L E L+ +AYPI +GVP++L +A + Sbjct: 1 MREK---LNPRLLEVIACPRCLARLKYDQENQRLICPFEQVAYPIENGVPVLLAEKAETL 57 Query: 61 DD 62 + Sbjct: 58 KE 59 >gi|301122901|ref|XP_002909177.1| conserved hypothetical protein [Phytophthora infestans T30-4] gi|262099939|gb|EEY57991.1| conserved hypothetical protein [Phytophthora infestans T30-4] Length = 102 Score = 71.8 bits (176), Expect = 3e-11, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 34/55 (61%) Query: 9 DPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 D ++E LVCP++K L +E L+ + ++ YPI G+P+++ SE R +++ Sbjct: 46 DESIMEHLVCPISKHPLRYDAERGSLVCDEINVEYPIWQGIPMLVPSEGRIINND 100 >gi|328882817|emb|CCA56056.1| protein YcaR [Streptomyces venezuelae ATCC 10712] Length = 59 Score = 71.8 bits (176), Expect = 3e-11, Method: Composition-based stats. Identities = 21/58 (36%), Positives = 30/58 (51%), Gaps = 4/58 (6%) Query: 6 FNIDPQLLEILVCPLTKGNL--TLISEGTELLS--KKASLAYPIRSGVPIMLVSEARQ 59 ++ LLEIL CP L +E EL+ LAYP+R +P++L EAR+ Sbjct: 1 MPLEAGLLEILACPACHAPLNDRTTAETPELICTSPDCGLAYPVRDDIPVLLTDEARR 58 >gi|320010447|gb|ADW05297.1| protein of unknown function DUF343 [Streptomyces flavogriseus ATCC 33331] Length = 67 Score = 71.8 bits (176), Expect = 3e-11, Method: Composition-based stats. Identities = 23/58 (39%), Positives = 32/58 (55%), Gaps = 4/58 (6%) Query: 6 FNIDPQLLEILVCPLTKGNL--TLISEGTELLSK--KASLAYPIRSGVPIMLVSEARQ 59 ++ LLEIL CP L +E EL+ LAYP+R G+P++LV EAR+ Sbjct: 8 MPLEAGLLEILACPACHAGLDDRSAAESPELVCTGTDCGLAYPVRDGIPVLLVDEARR 65 >gi|300933444|ref|ZP_07148700.1| hypothetical protein CresD4_05195 [Corynebacterium resistens DSM 45100] Length = 57 Score = 71.8 bits (176), Expect = 3e-11, Method: Composition-based stats. Identities = 22/51 (43%), Positives = 32/51 (62%), Gaps = 2/51 (3%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEA 57 IDP+LLEIL CP K L G L++ + +AYP++ +P++LV EA Sbjct: 1 MIDPKLLEILACPQDKQPLE--DHGDYLVNPRLGVAYPVQDDIPVLLVDEA 49 >gi|239939460|ref|ZP_04691397.1| hypothetical protein SrosN15_00565 [Streptomyces roseosporus NRRL 15998] gi|239985948|ref|ZP_04706612.1| hypothetical protein SrosN1_01442 [Streptomyces roseosporus NRRL 11379] gi|291442890|ref|ZP_06582280.1| conserved hypothetical protein [Streptomyces roseosporus NRRL 15998] gi|291345837|gb|EFE72741.1| conserved hypothetical protein [Streptomyces roseosporus NRRL 15998] Length = 72 Score = 71.8 bits (176), Expect = 3e-11, Method: Composition-based stats. Identities = 24/58 (41%), Positives = 34/58 (58%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 D LL IL CPL KG L+L+ E L + + L+YPI G+P +L S R+V+ + Sbjct: 1 MRTDDPLLTILACPLDKGPLSLLPEEEALYNPRLRLSYPIVDGIPQLLPSSGRKVEAE 58 >gi|172040782|ref|YP_001800496.1| hypothetical protein cur_1102 [Corynebacterium urealyticum DSM 7109] gi|171852086|emb|CAQ05062.1| hypothetical protein cu1102 [Corynebacterium urealyticum DSM 7109] Length = 60 Score = 71.4 bits (175), Expect = 4e-11, Method: Composition-based stats. Identities = 22/51 (43%), Positives = 30/51 (58%), Gaps = 2/51 (3%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEA 57 IDP+LLEIL CP K L G L++ + AYP+ G+P++L EA Sbjct: 4 MIDPKLLEILACPQDKQPLE--DHGDYLVNPRLGRAYPVSDGIPVLLTDEA 52 >gi|302530042|ref|ZP_07282384.1| predicted protein [Streptomyces sp. AA4] gi|302438937|gb|EFL10753.1| predicted protein [Streptomyces sp. AA4] Length = 92 Score = 71.4 bits (175), Expect = 4e-11, Method: Composition-based stats. Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 5/56 (8%) Query: 7 NIDPQLLEILVCPL-TKGNLTL----ISEGTELLSKKASLAYPIRSGVPIMLVSEA 57 +D QLLEIL CP L +E L + YP+R G+P++L+ EA Sbjct: 21 TLDAQLLEILACPSPDHAPLRPGTPDDAEADALTCTECGRVYPVRDGIPVLLLDEA 76 >gi|262202731|ref|YP_003273939.1| hypothetical protein Gbro_2832 [Gordonia bronchialis DSM 43247] gi|262086078|gb|ACY22046.1| protein of unknown function DUF343 [Gordonia bronchialis DSM 43247] Length = 71 Score = 71.4 bits (175), Expect = 4e-11, Method: Composition-based stats. Identities = 27/63 (42%), Positives = 34/63 (53%), Gaps = 3/63 (4%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIR-SGVPIMLVSEARQ 59 M +IDP E LVCP G L + G EL + + +AY I G+P+ML EAR Sbjct: 1 MSSRAESIDPITRERLVCPQDHGPL--LDAGDELYNPRLRVAYRIDADGIPVMLADEART 58 Query: 60 VDD 62 VDD Sbjct: 59 VDD 61 >gi|254247407|ref|ZP_04940728.1| conserved hypothetical protein [Burkholderia cenocepacia PC184] gi|124872183|gb|EAY63899.1| conserved hypothetical protein [Burkholderia cenocepacia PC184] Length = 50 Score = 71.0 bits (174), Expect = 4e-11, Method: Composition-based stats. Identities = 19/37 (51%), Positives = 22/37 (59%) Query: 23 GNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 G L EL+ LAYPIR G+P+MLV EARQ Sbjct: 2 GPLHYDRAAQELICNADKLAYPIRDGIPVMLVDEARQ 38 >gi|291303450|ref|YP_003514728.1| hypothetical protein Snas_6009 [Stackebrandtia nassauensis DSM 44728] gi|290572670|gb|ADD45635.1| protein of unknown function DUF343 [Stackebrandtia nassauensis DSM 44728] Length = 73 Score = 71.0 bits (174), Expect = 5e-11, Method: Composition-based stats. Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Query: 5 IFNIDPQLLEILVCPLTK-GNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 + +DP LLE+L CP T LT S L + + I G+P++L+ EA + Sbjct: 1 MPTLDPALLEVLACPDTHHAPLTYDSAAQTLTCTECRRIFRIDDGIPVLLLDEATE 56 >gi|39997355|ref|NP_953306.1| hypothetical protein GSU2257 [Geobacter sulfurreducens PCA] gi|39984246|gb|AAR35633.1| conserved hypothetical protein [Geobacter sulfurreducens PCA] gi|298506292|gb|ADI85015.1| protein of unknown function DUF343 [Geobacter sulfurreducens KN400] Length = 58 Score = 71.0 bits (174), Expect = 5e-11, Method: Composition-based stats. Identities = 18/57 (31%), Positives = 33/57 (57%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 + +L EIL CP G + ++ G+ L+ + L +P+R +P+ML+ EA ++ D Sbjct: 1 MALSIELFEILACPRCTGEVKPVNNGSALVCEACRLRFPVRDDIPVMLLDEAERIGD 57 >gi|120404274|ref|YP_954103.1| hypothetical protein Mvan_3299 [Mycobacterium vanbaalenii PYR-1] gi|119957092|gb|ABM14097.1| protein of unknown function DUF343 [Mycobacterium vanbaalenii PYR-1] Length = 71 Score = 71.0 bits (174), Expect = 5e-11, Method: Composition-based stats. Identities = 21/58 (36%), Positives = 30/58 (51%), Gaps = 2/58 (3%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D L ILVCP +G L + E L + + Y I G+P++L+ EA VDD Sbjct: 1 MALDETLRTILVCPQDRGPLLYVGES--LYNPRLRRKYRIDDGIPVLLIDEAVAVDDD 56 >gi|294812942|ref|ZP_06771585.1| Trm112p domain-containing protein [Streptomyces clavuligerus ATCC 27064] gi|326441505|ref|ZP_08216239.1| hypothetical protein SclaA2_10588 [Streptomyces clavuligerus ATCC 27064] gi|294325541|gb|EFG07184.1| Trm112p domain-containing protein [Streptomyces clavuligerus ATCC 27064] Length = 60 Score = 71.0 bits (174), Expect = 5e-11, Method: Composition-based stats. Identities = 22/58 (37%), Positives = 32/58 (55%), Gaps = 4/58 (6%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGT--ELLSK--KASLAYPIRSGVPIMLVSEARQ 59 I+ LL+IL CP L +E EL+ + LAYP+R +P++LV EAR+ Sbjct: 1 MAIEAGLLDILACPACHAPLDDRTESETPELICTGTECGLAYPVRDEIPVLLVDEARR 58 >gi|239981871|ref|ZP_04704395.1| hypothetical protein SalbJ_20716 [Streptomyces albus J1074] gi|291453726|ref|ZP_06593116.1| conserved hypothetical protein [Streptomyces albus J1074] gi|291356675|gb|EFE83577.1| conserved hypothetical protein [Streptomyces albus J1074] Length = 60 Score = 71.0 bits (174), Expect = 6e-11, Method: Composition-based stats. Identities = 24/58 (41%), Positives = 32/58 (55%), Gaps = 4/58 (6%) Query: 6 FNIDPQLLEILVCPLTKGNLTLIS--EGTELLS--KKASLAYPIRSGVPIMLVSEARQ 59 ++ LLEIL CP L ELL + +LAYPIR G+P++LV EAR+ Sbjct: 1 MALEAGLLEILACPACHAPLEESKTDSTPELLCTGEGCALAYPIRDGIPVLLVDEARR 58 >gi|319440354|ref|ZP_07989510.1| hypothetical protein CvarD4_01171 [Corynebacterium variabile DSM 44702] Length = 55 Score = 70.7 bits (173), Expect = 6e-11, Method: Composition-based stats. Identities = 24/51 (47%), Positives = 33/51 (64%), Gaps = 2/51 (3%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEA 57 IDP LLEILVCP K L G L++ + S+AYP++ G+P++L EA Sbjct: 1 MIDPSLLEILVCPQDKQPLE--EHGDYLVNPRLSVAYPVQDGIPVLLADEA 49 >gi|333024945|ref|ZP_08453009.1| hypothetical protein STTU_2449 [Streptomyces sp. Tu6071] gi|332744797|gb|EGJ75238.1| hypothetical protein STTU_2449 [Streptomyces sp. Tu6071] Length = 60 Score = 70.7 bits (173), Expect = 7e-11, Method: Composition-based stats. Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 4/58 (6%) Query: 6 FNIDPQLLEILVCPLTKGNL--TLISEGTELLSK--KASLAYPIRSGVPIMLVSEARQ 59 ++ LLEIL CP L + EL+ L YP+R +P++LV EAR+ Sbjct: 1 MPLESGLLEILACPACHSPLKERTTEDAEELVCTGADCGLIYPVRDNIPVLLVDEARK 58 >gi|302521402|ref|ZP_07273744.1| conserved hypothetical protein [Streptomyces sp. SPB78] gi|318060802|ref|ZP_07979525.1| hypothetical protein SSA3_22868 [Streptomyces sp. SA3_actG] gi|318081171|ref|ZP_07988503.1| hypothetical protein SSA3_31835 [Streptomyces sp. SA3_actF] gi|302430297|gb|EFL02113.1| conserved hypothetical protein [Streptomyces sp. SPB78] Length = 60 Score = 70.3 bits (172), Expect = 8e-11, Method: Composition-based stats. Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 4/58 (6%) Query: 6 FNIDPQLLEILVCPLTKGNLT--LISEGTELLSK--KASLAYPIRSGVPIMLVSEARQ 59 ++ LLEIL CP L + EL+ L YP+R +P++LV EAR+ Sbjct: 1 MPLESGLLEILACPACHSPLEERTTEDAEELVCTGADCGLIYPVRDNIPVLLVDEARK 58 >gi|295836953|ref|ZP_06823886.1| conserved hypothetical protein [Streptomyces sp. SPB74] gi|197697415|gb|EDY44348.1| conserved hypothetical protein [Streptomyces sp. SPB74] Length = 60 Score = 70.3 bits (172), Expect = 8e-11, Method: Composition-based stats. Identities = 20/58 (34%), Positives = 28/58 (48%), Gaps = 4/58 (6%) Query: 6 FNIDPQLLEILVCPLTKGNLT--LISEGTELLSK--KASLAYPIRSGVPIMLVSEARQ 59 ++ LLEIL CP L + EL L YP+R +P++LV EAR+ Sbjct: 1 MPLESGLLEILACPACHSPLEERATEDAEELACTGTDCGLVYPVRDNIPVLLVDEARK 58 >gi|86739465|ref|YP_479865.1| hypothetical protein Francci3_0752 [Frankia sp. CcI3] gi|86566327|gb|ABD10136.1| protein of unknown function DUF343 [Frankia sp. CcI3] Length = 65 Score = 70.3 bits (172), Expect = 8e-11, Method: Composition-based stats. Identities = 23/59 (38%), Positives = 32/59 (54%), Gaps = 3/59 (5%) Query: 6 FNIDPQLLEILVCPLTK-GNLTLIS--EGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 ++DP LLEILVCP +K G L L+ LA+P+R +P+ML+ EA Sbjct: 1 MSLDPLLLEILVCPCSKHGELRPDELSGAPVLVCLACDLAFPVRDDIPVMLLDEAIPFS 59 >gi|68535934|ref|YP_250639.1| hypothetical protein jk0859 [Corynebacterium jeikeium K411] gi|260577968|ref|ZP_05845893.1| conserved hypothetical protein [Corynebacterium jeikeium ATCC 43734] gi|68263533|emb|CAI37021.1| hypothetical protein jk0859 [Corynebacterium jeikeium K411] gi|258603894|gb|EEW17146.1| conserved hypothetical protein [Corynebacterium jeikeium ATCC 43734] Length = 55 Score = 70.3 bits (172), Expect = 9e-11, Method: Composition-based stats. Identities = 22/53 (41%), Positives = 34/53 (64%), Gaps = 2/53 (3%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 ID +LLEIL CP+ K L G L++ + + AYP++ G+P++LV EA+ Sbjct: 1 MIDQKLLEILACPIDKQPLE--DHGDYLVNPRLNKAYPVQDGIPVLLVEEAKD 51 >gi|282866243|ref|ZP_06275289.1| protein of unknown function DUF343 [Streptomyces sp. ACTE] gi|282558829|gb|EFB64385.1| protein of unknown function DUF343 [Streptomyces sp. ACTE] Length = 67 Score = 70.3 bits (172), Expect = 9e-11, Method: Composition-based stats. Identities = 21/56 (37%), Positives = 32/56 (57%), Gaps = 4/56 (7%) Query: 6 FNIDPQLLEILVCPLTKGNLTLI--SEGTELLSK--KASLAYPIRSGVPIMLVSEA 57 ++ LL+IL CP L +E EL+ + +LAYP+R G+P++LV EA Sbjct: 8 MPLEAGLLDILACPACHAPLEDRSAAETPELVCTSTECALAYPVRDGIPVLLVDEA 63 >gi|256833074|ref|YP_003161801.1| hypothetical protein Jden_1855 [Jonesia denitrificans DSM 20603] gi|256686605|gb|ACV09498.1| protein of unknown function DUF343 [Jonesia denitrificans DSM 20603] Length = 63 Score = 70.3 bits (172), Expect = 9e-11, Method: Composition-based stats. Identities = 22/60 (36%), Positives = 34/60 (56%), Gaps = 5/60 (8%) Query: 6 FNIDPQLLEILVCPLTKGNLTL---ISEGTELLSKKA--SLAYPIRSGVPIMLVSEARQV 60 ++P ++EI+ CP+T L EL S + LAYP+R G+P++L SEAR + Sbjct: 1 MAVEPWVMEIVRCPVTHAPLVGGVNSDGEPELHSTDSLNPLAYPVRDGIPVLLESEARSL 60 >gi|297157865|gb|ADI07577.1| hypothetical protein SBI_04457 [Streptomyces bingchenggensis BCW-1] Length = 60 Score = 70.3 bits (172), Expect = 1e-10, Method: Composition-based stats. Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 4/58 (6%) Query: 6 FNIDPQLLEILVCPLTKGNLTLIS--EGTELLS--KKASLAYPIRSGVPIMLVSEARQ 59 ++ LL+IL CP L E EL+ + LAYP+R +P++LV EAR+ Sbjct: 1 MPLEAGLLDILACPACHAPLREEEGPETPELVCTGEGCGLAYPVRDDIPVLLVDEARR 58 >gi|111220730|ref|YP_711524.1| hypothetical protein FRAAL1272 [Frankia alni ACN14a] gi|111148262|emb|CAJ59933.1| conserved hypothetical protein [Frankia alni ACN14a] Length = 67 Score = 70.3 bits (172), Expect = 1e-10, Method: Composition-based stats. Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 3/59 (5%) Query: 6 FNIDPQLLEILVCPLTK-GNLTLIS--EGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 ++DP LLEIL CP +K G L L+ LA+P+R +P+ML+ EA Sbjct: 1 MSLDPLLLEILACPCSKHGELRQDELDGAPVLVCLACDLAFPVRDDIPVMLLDEAVPFS 59 >gi|297195807|ref|ZP_06913205.1| conserved hypothetical protein [Streptomyces pristinaespiralis ATCC 25486] gi|197720745|gb|EDY64653.1| conserved hypothetical protein [Streptomyces pristinaespiralis ATCC 25486] Length = 69 Score = 69.9 bits (171), Expect = 1e-10, Method: Composition-based stats. Identities = 25/58 (43%), Positives = 34/58 (58%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 + D LL IL CPL KG LTL+SE L + + L+YPI G+P +L S +V + Sbjct: 1 MDADDPLLRILACPLDKGPLTLLSEQNILYNPRLQLSYPIVDGIPQLLPSSGSRVTED 58 >gi|311896339|dbj|BAJ28747.1| hypothetical protein KSE_29350 [Kitasatospora setae KM-6054] Length = 60 Score = 69.9 bits (171), Expect = 1e-10, Method: Composition-based stats. Identities = 23/58 (39%), Positives = 32/58 (55%), Gaps = 4/58 (6%) Query: 6 FNIDPQLLEILVCPLTKGNL--TLISEGTELLS--KKASLAYPIRSGVPIMLVSEARQ 59 ++ LLEILVCP + L E EL + L YP+R G+P++LV EAR+ Sbjct: 1 MSLPSFLLEILVCPECRSPLDEETEGEAHELRCTGEGCGLVYPVRDGIPVLLVDEARR 58 >gi|117923889|ref|YP_864506.1| methyltransferase type 11 [Magnetococcus sp. MC-1] gi|117607645|gb|ABK43100.1| Methyltransferase type 11 [Magnetococcus sp. MC-1] Length = 339 Score = 69.9 bits (171), Expect = 1e-10, Method: Composition-based stats. Identities = 20/63 (31%), Positives = 29/63 (46%), Gaps = 6/63 (9%) Query: 2 RETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVS------ 55 ++ + PQ L +L CP +G LT E L + YPI G+P++L Sbjct: 4 KDESHTLSPQRLAMLCCPDCRGELTHQPEVPRLWCPACNHRYPIVEGIPVLLPGDVEATI 63 Query: 56 EAR 58 EAR Sbjct: 64 EAR 66 >gi|51246084|ref|YP_065968.1| hypothetical protein DP2232 [Desulfotalea psychrophila LSv54] gi|50877121|emb|CAG36961.1| conserved hypothetical protein [Desulfotalea psychrophila LSv54] Length = 54 Score = 69.9 bits (171), Expect = 1e-10, Method: Composition-based stats. Identities = 25/56 (44%), Positives = 40/56 (71%), Gaps = 2/56 (3%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 ++ +L++IL CP KG + L+ EG L+ +K L YP+R G+PIML+SEA ++D+ Sbjct: 1 MLEQELIDILACPECKGPVQLVGEG--LVCEKCKLLYPVRDGIPIMLLSEAIKIDE 54 >gi|145224099|ref|YP_001134777.1| hypothetical protein Mflv_3515 [Mycobacterium gilvum PYR-GCK] gi|315444436|ref|YP_004077315.1| hypothetical protein Mspyr1_28570 [Mycobacterium sp. Spyr1] gi|145216585|gb|ABP45989.1| protein of unknown function DUF343 [Mycobacterium gilvum PYR-GCK] gi|315262739|gb|ADT99480.1| uncharacterized conserved protein [Mycobacterium sp. Spyr1] Length = 68 Score = 69.9 bits (171), Expect = 1e-10, Method: Composition-based stats. Identities = 23/58 (39%), Positives = 31/58 (53%), Gaps = 2/58 (3%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D LL ILVCP +G L L+ L + + Y I G+P++LV EA VDD Sbjct: 1 MALDDTLLAILVCPQDRGPLLLVD--GCLYNPRLKRKYRIDDGIPVLLVDEAVPVDDD 56 >gi|225468551|ref|XP_002274633.1| PREDICTED: hypothetical protein [Vitis vinifera] Length = 94 Score = 69.9 bits (171), Expect = 1e-10, Method: Composition-based stats. Identities = 19/63 (30%), Positives = 34/63 (53%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 +R+ I+ L EILVCPL+K L + E L+S ++YP+ G+P ++ + + + Sbjct: 9 LRDARVGINKTLSEILVCPLSKQPLRVCEESGSLISDAIGVSYPVVDGIPSLVPKDGKIL 68 Query: 61 DDQ 63 Sbjct: 69 AAD 71 >gi|312199853|ref|YP_004019914.1| hypothetical protein FraEuI1c_6060 [Frankia sp. EuI1c] gi|311231189|gb|ADP84044.1| protein of unknown function DUF343 [Frankia sp. EuI1c] Length = 67 Score = 69.9 bits (171), Expect = 1e-10, Method: Composition-based stats. Identities = 20/60 (33%), Positives = 31/60 (51%), Gaps = 3/60 (5%) Query: 6 FNIDPQLLEILVCPL-TKGNLTLI--SEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 ++DP LLEIL CP L + L+ +LA+P+R +P+ML+ EA + Sbjct: 1 MSLDPLLLEILACPCPQHAPLRQDTLAGAPVLVCTACNLAFPVRDDIPVMLLDEASPFPE 60 >gi|291287641|ref|YP_003504457.1| hypothetical protein Dacet_1737 [Denitrovibrio acetiphilus DSM 12809] gi|290884801|gb|ADD68501.1| protein of unknown function DUF343 [Denitrovibrio acetiphilus DSM 12809] Length = 60 Score = 69.5 bits (170), Expect = 2e-10, Method: Composition-based stats. Identities = 18/56 (32%), Positives = 31/56 (55%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 I +LL++L CP K + + ++ L Y I+ +P+MLV EA+QV++ Sbjct: 1 MIKQELLDVLACPKCKKAVRASKDEKFIICDPCGLLYEIKEDIPVMLVDEAKQVEN 56 >gi|242039581|ref|XP_002467185.1| hypothetical protein SORBIDRAFT_01g021120 [Sorghum bicolor] gi|241921039|gb|EER94183.1| hypothetical protein SORBIDRAFT_01g021120 [Sorghum bicolor] Length = 86 Score = 69.5 bits (170), Expect = 2e-10, Method: Composition-based stats. Identities = 18/57 (31%), Positives = 33/57 (57%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +I L ++LVCPL+K L L+S A +++P+ G+P ++ + + +DDQ Sbjct: 15 SIPRALADVLVCPLSKQPLRYCEATGSLVSDAAGVSFPVLDGIPSLVPKDGKLLDDQ 71 >gi|306836019|ref|ZP_07469010.1| conserved hypothetical protein [Corynebacterium accolens ATCC 49726] gi|304568108|gb|EFM43682.1| conserved hypothetical protein [Corynebacterium accolens ATCC 49726] Length = 55 Score = 69.1 bits (169), Expect = 2e-10, Method: Composition-based stats. Identities = 23/53 (43%), Positives = 34/53 (64%), Gaps = 2/53 (3%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 ID +LLEILVCP+ K L G L++ + + AYP++ +P+MLV EA+ Sbjct: 1 MIDQKLLEILVCPIDKQPLE--DHGDYLVNPRLNKAYPVQDDIPVMLVDEAKD 51 >gi|289641033|ref|ZP_06473202.1| protein of unknown function DUF343 [Frankia symbiont of Datisca glomerata] gi|289509153|gb|EFD30083.1| protein of unknown function DUF343 [Frankia symbiont of Datisca glomerata] Length = 70 Score = 69.1 bits (169), Expect = 2e-10, Method: Composition-based stats. Identities = 22/57 (38%), Positives = 31/57 (54%), Gaps = 3/57 (5%) Query: 6 FNIDPQLLEILVCPL-TKGNLTLISEGTE--LLSKKASLAYPIRSGVPIMLVSEARQ 59 ++DP LLEIL CP L + G E L+ LA+P+R +P+ML+ EA Sbjct: 1 MSLDPLLLEILACPCPAHAPLRQDTLGGEPVLVCTSCDLAFPVRDEIPVMLLDEAVP 57 >gi|319779516|ref|YP_004130429.1| UPF0434 protein YcaR [Taylorella equigenitalis MCE9] gi|317109540|gb|ADU92286.1| UPF0434 protein YcaR [Taylorella equigenitalis MCE9] Length = 56 Score = 68.7 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 23/47 (48%), Positives = 32/47 (68%) Query: 16 LVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 LVCPLTK L ++ L+S+KA L +PIR G+PI+L SEA + + Sbjct: 6 LVCPLTKTPLKHDAKRGVLISEKAKLEFPIRDGIPILLESEATPLKE 52 >gi|95929394|ref|ZP_01312137.1| protein of unknown function DUF343 [Desulfuromonas acetoxidans DSM 684] gi|95134510|gb|EAT16166.1| protein of unknown function DUF343 [Desulfuromonas acetoxidans DSM 684] Length = 367 Score = 68.7 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLV 54 ++ P+LLE+L CP K + + + + +P+R G+P MLV Sbjct: 1 MSLQPELLELLACPQCKQPVEMSGDE-AVHCCSCHSRFPVRDGIPAMLV 48 >gi|32491001|ref|NP_871255.1| hypothetical protein WGLp252 [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] gi|81741757|sp|Q8D2V0|Y252_WIGBR RecName: Full=UPF0434 protein WIGBR2520 gi|25166207|dbj|BAC24398.1| ycaR [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] Length = 56 Score = 68.7 bits (168), Expect = 3e-10, Method: Composition-based stats. Identities = 17/48 (35%), Positives = 28/48 (58%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVS 55 +D +LL I+ CP+ L EL+ + S+A+PI+ G+PI+L Sbjct: 1 MDKKLLNIIACPICNKKLNFDLIRKELICEFDSVAFPIKDGIPILLRD 48 >gi|300789829|ref|YP_003770120.1| hypothetical protein AMED_8014 [Amycolatopsis mediterranei U32] gi|299799343|gb|ADJ49718.1| conserved hypothetical protein [Amycolatopsis mediterranei U32] Length = 73 Score = 68.3 bits (167), Expect = 3e-10, Method: Composition-based stats. Identities = 22/63 (34%), Positives = 29/63 (46%), Gaps = 5/63 (7%) Query: 7 NIDPQLLEILVCPL-TKGNLTL----ISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 +D QLLEIL CP L E L + YP+R G+P++L+ EA Sbjct: 4 TLDAQLLEILACPSPDHAPLRPGAPDDPEADALTCTECGRVYPVRDGIPVLLLDEATVPG 63 Query: 62 DQG 64 D G Sbjct: 64 DNG 66 >gi|225848393|ref|YP_002728556.1| hypothetical protein SULAZ_0566 [Sulfurihydrogenibium azorense Az-Fu1] gi|225643624|gb|ACN98674.1| conserved hypothetical protein [Sulfurihydrogenibium azorense Az-Fu1] Length = 62 Score = 68.3 bits (167), Expect = 4e-10, Method: Composition-based stats. Identities = 23/58 (39%), Positives = 32/58 (55%), Gaps = 2/58 (3%) Query: 7 NIDPQLLEILVCPLTKGNLTLIS--EGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 I+ LL IL CP+ K +L I E L K +L YPI+ +PI+L EA + +D Sbjct: 1 MINKDLLTILACPVCKSDLEFIEIKENQYLKCLKCNLYYPIKEDIPILLEDEALKEED 58 >gi|158317601|ref|YP_001510109.1| hypothetical protein Franean1_5857 [Frankia sp. EAN1pec] gi|158113006|gb|ABW15203.1| protein of unknown function DUF343 [Frankia sp. EAN1pec] Length = 66 Score = 68.0 bits (166), Expect = 4e-10, Method: Composition-based stats. Identities = 20/57 (35%), Positives = 30/57 (52%), Gaps = 3/57 (5%) Query: 6 FNIDPQLLEILVCPL-TKGNLTLI--SEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 ++DP LLEIL CP L L+ + LA+P+R +P+ML+ EA+ Sbjct: 1 MSLDPLLLEILACPCPEHAPLRQETLDGAPVLVCESCGLAFPVRDDIPVMLLDEAKP 57 >gi|237785436|ref|YP_002906141.1| hypothetical protein ckrop_0844 [Corynebacterium kroppenstedtii DSM 44385] gi|237758348|gb|ACR17598.1| hypothetical protein ckrop_0844 [Corynebacterium kroppenstedtii DSM 44385] Length = 58 Score = 68.0 bits (166), Expect = 4e-10, Method: Composition-based stats. Identities = 16/41 (39%), Positives = 24/41 (58%) Query: 17 VCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEA 57 VCP KG L + L++ + +AYPI G+P++L EA Sbjct: 12 VCPQDKGPLEYHEDEQLLVNPRLHIAYPIDDGIPVLLEDEA 52 >gi|221134265|ref|ZP_03560570.1| hypothetical protein GHTCC_05000 [Glaciecola sp. HTCC2999] Length = 68 Score = 68.0 bits (166), Expect = 5e-10, Method: Composition-based stats. Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 4/59 (6%) Query: 6 FNIDPQLLEILVCPLTKGNLTL----ISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 D LL +L CP+ KG+L ++ EL+ K LA+P+ PI++ +AR + Sbjct: 1 MAFDSLLLSVLACPICKGSLVWHTHPDTKAPELVCKFDRLAFPVLGDAPILIEQKARSL 59 >gi|297199453|ref|ZP_06916850.1| conserved hypothetical protein [Streptomyces sviceus ATCC 29083] gi|197713007|gb|EDY57041.1| conserved hypothetical protein [Streptomyces sviceus ATCC 29083] Length = 69 Score = 68.0 bits (166), Expect = 5e-10, Method: Composition-based stats. Identities = 24/58 (41%), Positives = 30/58 (51%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 N D LL+IL CPL KG L L+ L + + YPI G+P +L S QV D Sbjct: 1 MNPDDPLLQILACPLDKGPLHLVPPDEALYNPRLHRRYPIVDGIPQLLPSSGEQVTDD 58 >gi|225850676|ref|YP_002730910.1| tetraacyldisaccharide 4'-kinase (Lipid A 4'-kinase) [Persephonella marina EX-H1] gi|225645106|gb|ACO03292.1| tetraacyldisaccharide 4'-kinase (Lipid A 4'-kinase) [Persephonella marina EX-H1] Length = 65 Score = 67.6 bits (165), Expect = 5e-10, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 2/57 (3%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 I +L+IL CP+ K +L + + L YPI +P+ L+ EA+++ D+ Sbjct: 1 MIPEDILQILACPVCKKDLIYTE--NSFVCTECKLEYPIIDDIPVFLIEEAKKLTDE 55 >gi|224132956|ref|XP_002321451.1| predicted protein [Populus trichocarpa] gi|222868447|gb|EEF05578.1| predicted protein [Populus trichocarpa] Length = 76 Score = 67.2 bits (164), Expect = 6e-10, Method: Composition-based stats. Identities = 17/61 (27%), Positives = 33/61 (54%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 ++ I L EILVCP++K L E L S ++++PI+ G+P ++ + + + Sbjct: 9 LKRAGEGISKTLSEILVCPISKQPLRYCKETNSLFSDSIAVSFPIKDGIPCLVPRDGKVI 68 Query: 61 D 61 + Sbjct: 69 E 69 >gi|302544897|ref|ZP_07297239.1| conserved hypothetical protein [Streptomyces hygroscopicus ATCC 53653] gi|302462515|gb|EFL25608.1| conserved hypothetical protein [Streptomyces himastatinicus ATCC 53653] Length = 61 Score = 67.2 bits (164), Expect = 7e-10, Method: Composition-based stats. Identities = 22/59 (37%), Positives = 30/59 (50%), Gaps = 5/59 (8%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTE--LLS---KKASLAYPIRSGVPIMLVSEARQ 59 ++ LLEIL CP L L+ K LAYP+R G+P++LV EAR+ Sbjct: 1 MPLEAGLLEILACPACHAPLREEEAEETPELVCTDGKGCGLAYPVREGIPVLLVDEARR 59 >gi|227501839|ref|ZP_03931888.1| conserved hypothetical protein [Corynebacterium accolens ATCC 49725] gi|227077864|gb|EEI15827.1| conserved hypothetical protein [Corynebacterium accolens ATCC 49725] Length = 55 Score = 67.2 bits (164), Expect = 7e-10, Method: Composition-based stats. Identities = 23/53 (43%), Positives = 34/53 (64%), Gaps = 2/53 (3%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 ID +LLEILVCP+ K L G L++ + + AYP++ +P+MLV EA+ Sbjct: 1 MIDQKLLEILVCPIDKQALE--DHGDYLVNPRLNKAYPVQDDIPVMLVDEAKD 51 >gi|91202841|emb|CAJ72480.1| conserved hypothetical protein [Candidatus Kuenenia stuttgartiensis] Length = 59 Score = 66.8 bits (163), Expect = 1e-09, Method: Composition-based stats. Identities = 19/51 (37%), Positives = 31/51 (60%), Gaps = 2/51 (3%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEA 57 + +LLEIL CPL K ++ L EG ++ + YP++ +P+ML+ EA Sbjct: 1 MVSKELLEILACPLCKTDVRL--EGDRIICVQCGRRYPVKDDIPVMLIDEA 49 >gi|330813364|ref|YP_004357603.1| UPF0434 protein YcaR [Candidatus Pelagibacter sp. IMCC9063] gi|327486459|gb|AEA80864.1| UPF0434 protein YcaR [Candidatus Pelagibacter sp. IMCC9063] Length = 43 Score = 66.8 bits (163), Expect = 1e-09, Method: Composition-based stats. Identities = 19/42 (45%), Positives = 29/42 (69%) Query: 21 TKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 +K L + EL++K++ LAYPI+ G+PIML EAR++ D Sbjct: 2 SKEKLIYDKDNQELIAKRSGLAYPIKEGIPIMLPDEARKLKD 43 >gi|317125634|ref|YP_004099746.1| hypothetical protein Intca_2513 [Intrasporangium calvum DSM 43043] gi|315589722|gb|ADU49019.1| protein of unknown function DUF343 [Intrasporangium calvum DSM 43043] Length = 63 Score = 66.8 bits (163), Expect = 1e-09, Method: Composition-based stats. Identities = 26/58 (44%), Positives = 29/58 (50%), Gaps = 2/58 (3%) Query: 7 NIDPQLLEILVCPLTKGNLTLI--SEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 I+P L EIL CP KG L G EL L YPI GVP++LV AR D Sbjct: 6 TIEPWLREILRCPRCKGVLADATGPTGPELQCGSCHLGYPIEDGVPVLLVDLARPTSD 63 >gi|118581434|ref|YP_902684.1| hypothetical protein Ppro_3029 [Pelobacter propionicus DSM 2379] gi|118504144|gb|ABL00627.1| protein of unknown function DUF343 [Pelobacter propionicus DSM 2379] Length = 58 Score = 66.8 bits (163), Expect = 1e-09, Method: Composition-based stats. Identities = 20/42 (47%), Positives = 27/42 (64%) Query: 16 LVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEA 57 L CP+ KG LTLI L + L YP+R+G+P++LV EA Sbjct: 10 LACPVCKGTLTLIVANEVLRCETCKLDYPVRNGIPVLLVDEA 51 >gi|163848256|ref|YP_001636300.1| hypothetical protein Caur_2706 [Chloroflexus aurantiacus J-10-fl] gi|222526167|ref|YP_002570638.1| hypothetical protein Chy400_2925 [Chloroflexus sp. Y-400-fl] gi|163669545|gb|ABY35911.1| protein of unknown function DUF343 [Chloroflexus aurantiacus J-10-fl] gi|222450046|gb|ACM54312.1| protein of unknown function DUF343 [Chloroflexus sp. Y-400-fl] Length = 115 Score = 66.4 bits (162), Expect = 1e-09, Method: Composition-based stats. Identities = 20/60 (33%), Positives = 34/60 (56%), Gaps = 3/60 (5%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGT---ELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +I P+LL +L P KG + L+ + L++++ YPI G+PIML+ E + D+ Sbjct: 51 SISPELLSMLADPGDKGPVELMVDANGKEWLVNRRNGYRYPIEDGIPIMLLEEGEKNKDE 110 >gi|167042690|gb|ABZ07411.1| putative protein of unknown function (DUF343) [uncultured marine crenarchaeote HF4000_ANIW133M9] Length = 89 Score = 66.4 bits (162), Expect = 1e-09, Method: Composition-based stats. Identities = 20/65 (30%), Positives = 27/65 (41%), Gaps = 9/65 (13%) Query: 8 IDPQLLEILVCPLTK-GNLTLISE--------GTELLSKKASLAYPIRSGVPIMLVSEAR 58 + +LLEIL CP+ K L L L ++ S +PI +PIML E R Sbjct: 1 MKRKLLEILACPIDKFHPLELFENKSDDEKITEGALYCQQCSRFFPIIDEIPIMLPDELR 60 Query: 59 QVDDQ 63 Sbjct: 61 DKKQD 65 >gi|209809507|ref|YP_002265045.1| hypothetical protein VSAL_II0733 [Aliivibrio salmonicida LFI1238] gi|208011069|emb|CAQ81487.1| conserved hypothetical protein [Aliivibrio salmonicida LFI1238] Length = 53 Score = 66.4 bits (162), Expect = 1e-09, Method: Composition-based stats. Identities = 17/43 (39%), Positives = 26/43 (60%) Query: 21 TKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 KG L + EL+ K LAYPI+ G+P+M+ EAR++ + Sbjct: 2 CKGKLNYDKDKQELICKIDRLAYPIKEGIPVMIEPEARRMTME 44 >gi|256372530|ref|YP_003110354.1| protein of unknown function DUF343 [Acidimicrobium ferrooxidans DSM 10331] gi|256009114|gb|ACU54681.1| protein of unknown function DUF343 [Acidimicrobium ferrooxidans DSM 10331] Length = 89 Score = 66.4 bits (162), Expect = 1e-09, Method: Composition-based stats. Identities = 20/59 (33%), Positives = 31/59 (52%) Query: 5 IFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 + + P LL I+ CPL G L I + L + + AY + G+ +LV +A VDD+ Sbjct: 1 MSALSPDLLAIVACPLDHGPLLWIESESVLYNPRLHRAYAVTDGIADLLVEDAEVVDDE 59 >gi|254361743|ref|ZP_04977878.1| hypothetical protein MHA_1350 [Mannheimia haemolytica PHL213] gi|261494055|ref|ZP_05990558.1| hypothetical protein COK_2453 [Mannheimia haemolytica serotype A2 str. BOVINE] gi|261496184|ref|ZP_05992590.1| hypothetical protein COI_1925 [Mannheimia haemolytica serotype A2 str. OVINE] gi|153093278|gb|EDN74274.1| hypothetical protein MHA_1350 [Mannheimia haemolytica PHL213] gi|261308136|gb|EEY09433.1| hypothetical protein COI_1925 [Mannheimia haemolytica serotype A2 str. OVINE] gi|261310221|gb|EEY11421.1| hypothetical protein COK_2453 [Mannheimia haemolytica serotype A2 str. BOVINE] Length = 53 Score = 66.4 bits (162), Expect = 1e-09, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 30/53 (56%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 ++ LL LVCP++ L E L++ K ++AYPI++G+P +L + Sbjct: 1 MNETLLNNLVCPVSNEKLEWDKENNRLINPKLNIAYPIKNGIPELLPEAGVAL 53 >gi|269837351|ref|YP_003319579.1| hypothetical protein Sthe_1322 [Sphaerobacter thermophilus DSM 20745] gi|269786614|gb|ACZ38757.1| protein of unknown function DUF343 [Sphaerobacter thermophilus DSM 20745] Length = 65 Score = 66.0 bits (161), Expect = 2e-09, Method: Composition-based stats. Identities = 23/51 (45%), Positives = 27/51 (52%), Gaps = 2/51 (3%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEA 57 I LLEIL CPL K + L EG L+ Y I G+PIML+ EA Sbjct: 8 PISDDLLEILACPLCKTAVRL--EGDRLVCDTCGRRYRIEDGIPIMLIDEA 56 >gi|219850541|ref|YP_002464974.1| hypothetical protein Cagg_3702 [Chloroflexus aggregans DSM 9485] gi|219544800|gb|ACL26538.1| protein of unknown function DUF343 [Chloroflexus aggregans DSM 9485] Length = 115 Score = 66.0 bits (161), Expect = 2e-09, Method: Composition-based stats. Identities = 20/60 (33%), Positives = 34/60 (56%), Gaps = 3/60 (5%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGT---ELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +I P+LL +L P KG + L+ + L++++ YPI G+PIML+ E + D+ Sbjct: 51 SISPELLSMLADPGDKGPVELMVDANGKEWLVNRRNGYRYPIEDGIPIMLLEEGEKNKDE 110 >gi|167044566|gb|ABZ09239.1| putative protein of unknown function (DUF343) [uncultured marine crenarchaeote HF4000_APKG7F11] Length = 89 Score = 66.0 bits (161), Expect = 2e-09, Method: Composition-based stats. Identities = 20/65 (30%), Positives = 27/65 (41%), Gaps = 9/65 (13%) Query: 8 IDPQLLEILVCPLTK-GNLTLISE--------GTELLSKKASLAYPIRSGVPIMLVSEAR 58 + +LLEIL CP+ K L L L ++ S +PI +PIML E R Sbjct: 1 MKRKLLEILACPIDKFHPLELFENKSDDEKITEGALYCQQCSRFFPIIDEIPIMLPDELR 60 Query: 59 QVDDQ 63 Sbjct: 61 DKKQD 65 >gi|195658393|gb|ACG48664.1| hypothetical protein [Zea mays] Length = 86 Score = 66.0 bits (161), Expect = 2e-09, Method: Composition-based stats. Identities = 18/52 (34%), Positives = 31/52 (59%) Query: 12 LLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 L ++LVCPL+K L L+S A +A+P+ G+P ++ + + +DDQ Sbjct: 20 LADVLVCPLSKQPLRYCEVNGSLVSDSAGVAFPVLDGIPSLVPKDGKLLDDQ 71 >gi|309789834|ref|ZP_07684413.1| hypothetical protein OSCT_0364 [Oscillochloris trichoides DG6] gi|308228138|gb|EFO81787.1| hypothetical protein OSCT_0364 [Oscillochloris trichoides DG6] Length = 116 Score = 65.6 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 20/60 (33%), Positives = 35/60 (58%), Gaps = 3/60 (5%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGT---ELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +I P+LL IL P KG + L+++ L++++ YP+ G+PIML+ E + D+ Sbjct: 52 SISPELLSILADPADKGPIELLTDAQGKEWLVNRRNGYRYPVEDGIPIMLLEEGEKNKDE 111 >gi|290960729|ref|YP_003491911.1| hypothetical protein SCAB_63621 [Streptomyces scabiei 87.22] gi|260650255|emb|CBG73371.1| conserved hypothetical protein [Streptomyces scabiei 87.22] Length = 85 Score = 65.6 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 24/70 (34%), Positives = 31/70 (44%), Gaps = 12/70 (17%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTE------------LLSKKASLAYPIRSGVPIML 53 N D LL+IL CPL KG L L+ E L + + YPI G+P +L Sbjct: 1 MNPDDPLLQILACPLDKGPLHLVVHEEEGEPTGATGAPESLYNPRLHRRYPIVDGIPQLL 60 Query: 54 VSEARQVDDQ 63 S QV + Sbjct: 61 PSSGEQVTED 70 >gi|108799926|ref|YP_640123.1| hypothetical protein Mmcs_2960 [Mycobacterium sp. MCS] gi|119869036|ref|YP_938988.1| hypothetical protein Mkms_3004 [Mycobacterium sp. KMS] gi|126435554|ref|YP_001071245.1| hypothetical protein Mjls_2975 [Mycobacterium sp. JLS] gi|108770345|gb|ABG09067.1| protein of unknown function DUF343 [Mycobacterium sp. MCS] gi|119695125|gb|ABL92198.1| protein of unknown function DUF343 [Mycobacterium sp. KMS] gi|126235354|gb|ABN98754.1| protein of unknown function DUF343 [Mycobacterium sp. JLS] Length = 68 Score = 65.6 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D +L ILVCP +G L L+ + L + + Y I G+P++LV EA V D Sbjct: 1 MLDEKLRAILVCPQDRGPLLLVGDE-MLYNPRLRQGYRIDDGIPVLLVDEAVAVTDD 56 >gi|288916514|ref|ZP_06410891.1| protein of unknown function DUF343 [Frankia sp. EUN1f] gi|288352114|gb|EFC86314.1| protein of unknown function DUF343 [Frankia sp. EUN1f] Length = 66 Score = 65.6 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 20/57 (35%), Positives = 30/57 (52%), Gaps = 3/57 (5%) Query: 6 FNIDPQLLEILVCPL-TKGNL--TLISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 ++DP LLEIL CP L + L+ LA+P+R +P+ML+ EA+ Sbjct: 1 MSLDPLLLEILACPCPEHAALREETLDGAPVLVCASCGLAFPVRDDIPVMLLDEAKP 57 >gi|331698951|ref|YP_004335190.1| hypothetical protein Psed_5200 [Pseudonocardia dioxanivorans CB1190] gi|326953640|gb|AEA27337.1| protein of unknown function DUF343 [Pseudonocardia dioxanivorans CB1190] Length = 71 Score = 65.6 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 3/60 (5%) Query: 8 IDPQLLEILVCP-LTKGNLTL--ISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQG 64 +DPQLLEIL CP L ++ L + +P+ G+P++L+ EA D G Sbjct: 5 LDPQLLEILACPSDDHAPLRPGSVAGKDVLTCTECGRRFPVVDGIPVLLLDEALPGDTTG 64 >gi|325289453|ref|YP_004265634.1| protein of unknown function DUF343 [Syntrophobotulus glycolicus DSM 8271] gi|324964854|gb|ADY55633.1| protein of unknown function DUF343 [Syntrophobotulus glycolicus DSM 8271] Length = 57 Score = 65.3 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 19/56 (33%), Positives = 32/56 (57%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 ++ LL ILV P+ KG L L + + AYPI++G+P +L +A+++D Sbjct: 1 MAVNALLLNILVDPVDKGELLWKEGQDYLYNPRTRQAYPIQNGIPELLADKAKKLD 56 >gi|84498160|ref|ZP_00996957.1| hypothetical protein JNB_18773 [Janibacter sp. HTCC2649] gi|84381660|gb|EAP97543.1| hypothetical protein JNB_18773 [Janibacter sp. HTCC2649] Length = 61 Score = 65.3 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 22/59 (37%), Positives = 30/59 (50%), Gaps = 4/59 (6%) Query: 5 IFNIDPQLLEILVCPLTKGNLTLI--SEGTELLS--KKASLAYPIRSGVPIMLVSEARQ 59 + ++P L EIL CP + L G EL+ L Y I GVP++LV EAR+ Sbjct: 1 MSTMEPWLREILRCPNCRAELRDETGEAGPELVCTSDTCGLTYRIDDGVPVLLVDEARK 59 >gi|257057071|ref|YP_003134903.1| hypothetical protein Svir_31010 [Saccharomonospora viridis DSM 43017] gi|256586943|gb|ACU98076.1| uncharacterized conserved protein [Saccharomonospora viridis DSM 43017] Length = 76 Score = 65.3 bits (159), Expect = 3e-09, Method: Composition-based stats. Identities = 19/58 (32%), Positives = 26/58 (44%), Gaps = 5/58 (8%) Query: 7 NIDPQLLEILVCPL-TKGNLTL----ISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 +D QLLEIL CP LT + L Y +R G+P++L+ EA Sbjct: 4 TLDAQLLEILACPAPDHAPLTPGTPDDPDADALTCTSCGRVYEVRDGIPVLLLDEAIP 61 >gi|167043921|gb|ABZ08609.1| putative protein of unknown function (DUF343) [uncultured marine crenarchaeote HF4000_APKG3H9] Length = 89 Score = 65.3 bits (159), Expect = 3e-09, Method: Composition-based stats. Identities = 19/65 (29%), Positives = 27/65 (41%), Gaps = 9/65 (13%) Query: 8 IDPQLLEILVCPLTK-GNLTLISE--------GTELLSKKASLAYPIRSGVPIMLVSEAR 58 + +LL+IL CP+ K L L L ++ S +PI +PIML E R Sbjct: 1 MKRKLLDILACPIDKFHPLELFENKSDDEKITEGALYCQQCSRFFPIIDEIPIMLPDELR 60 Query: 59 QVDDQ 63 Sbjct: 61 DKKQD 65 >gi|94676608|ref|YP_588706.1| hypothetical protein BCI_0256 [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)] gi|148841356|sp|Q1LTK8|Y256_BAUCH RecName: Full=UPF0434 protein BCI_0256 gi|94219758|gb|ABF13917.1| conserved hypothetical protein [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)] Length = 54 Score = 65.3 bits (159), Expect = 3e-09, Method: Composition-based stats. Identities = 23/53 (43%), Positives = 37/53 (69%), Gaps = 2/53 (3%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 ++ LL I+ CPL +G L L + EL+ + +LAYP+R+ +P++LVSEAR + Sbjct: 1 MEISLLNIIACPLCQGQLLL--QEQELVCQIDALAYPVRTNIPVLLVSEARNI 51 >gi|325000741|ref|ZP_08121853.1| hypothetical protein PseP1_18327 [Pseudonocardia sp. P1] Length = 70 Score = 65.3 bits (159), Expect = 3e-09, Method: Composition-based stats. Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 5/55 (9%) Query: 8 IDPQLLEILVCPLT-KGNLT----LISEGTELLSKKASLAYPIRSGVPIMLVSEA 57 +DPQLLEIL CP L L + +YP+ G+P++L+ EA Sbjct: 5 LDPQLLEILACPCDAHAPLRSGTSAEPGADALTCEACGRSYPVTDGIPVLLLDEA 59 >gi|188996751|ref|YP_001931002.1| protein of unknown function DUF343 [Sulfurihydrogenibium sp. YO3AOP1] gi|188931818|gb|ACD66448.1| protein of unknown function DUF343 [Sulfurihydrogenibium sp. YO3AOP1] Length = 58 Score = 64.9 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 22/55 (40%), Positives = 34/55 (61%), Gaps = 2/55 (3%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTE--LLSKKASLAYPIRSGVPIMLVSEARQ 59 ++ +LL+IL CP+ KG+L LI + E L + L YPI+ +PI+L EA + Sbjct: 1 MLNKELLDILACPVCKGDLILIQKDKEEFLKCENCKLLYPIKEDIPIILEDEAIK 55 >gi|269794242|ref|YP_003313697.1| hypothetical protein Sked_09130 [Sanguibacter keddieii DSM 10542] gi|269096427|gb|ACZ20863.1| hypothetical protein Sked_09130 [Sanguibacter keddieii DSM 10542] Length = 76 Score = 64.9 bits (158), Expect = 4e-09, Method: Composition-based stats. Identities = 24/62 (38%), Positives = 35/62 (56%), Gaps = 5/62 (8%) Query: 4 TIFNIDPQLLEILVCPLTKGNLTLI---SEGTELLSKKAS--LAYPIRSGVPIMLVSEAR 58 + F IDP + EIL CP++ L EL S LAYP+R G+P++LV +AR Sbjct: 15 SPFPIDPWVREILRCPVSGATLVDGVGPDGSPELHSTAEHQPLAYPVREGIPVLLVDDAR 74 Query: 59 QV 60 ++ Sbjct: 75 RL 76 >gi|289192200|ref|YP_003458141.1| protein of unknown function DUF343 [Methanocaldococcus sp. FS406-22] gi|288938650|gb|ADC69405.1| protein of unknown function DUF343 [Methanocaldococcus sp. FS406-22] Length = 55 Score = 64.5 bits (157), Expect = 5e-09, Method: Composition-based stats. Identities = 18/53 (33%), Positives = 29/53 (54%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIML 53 M I N + L+IL CP +G+L L + +L+ K+ + Y I +PI+L Sbjct: 1 MECDIMNWIEKYLKILQCPYCRGDLHLDKDKNKLVCKRCNRVYDIVEDIPILL 53 >gi|269219053|ref|ZP_06162907.1| tetraacyldisaccharide 4'-kinase [Actinomyces sp. oral taxon 848 str. F0332] gi|269212164|gb|EEZ78504.1| tetraacyldisaccharide 4'-kinase [Actinomyces sp. oral taxon 848 str. F0332] Length = 77 Score = 64.5 bits (157), Expect = 5e-09, Method: Composition-based stats. Identities = 21/65 (32%), Positives = 35/65 (53%), Gaps = 5/65 (7%) Query: 2 RETIFNIDPQLLEILVCPLTKGNLTLISEGT--ELLSKKA---SLAYPIRSGVPIMLVSE 56 + +L++L CP++ L L EL++ + LAYP+R G+P++L E Sbjct: 13 PAEQLGLPEWVLDVLRCPVSGAELELSDGPQGVELVAAEGVDPRLAYPVRDGIPVLLEHE 72 Query: 57 ARQVD 61 ARQ+D Sbjct: 73 ARQID 77 >gi|326499444|dbj|BAJ86033.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 87 Score = 64.5 bits (157), Expect = 5e-09, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 30/55 (54%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 I L ++LVCPL+K L L+S +++PI G+P +L + + ++D Sbjct: 17 IPQALADVLVCPLSKKPLRYCEVSGSLVSDAGRMSFPIADGIPCLLPKDGKLLED 71 >gi|148908165|gb|ABR17198.1| unknown [Picea sitchensis] Length = 80 Score = 64.5 bits (157), Expect = 5e-09, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 32/55 (58%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 ++ +LL+ LVCPL+K L + L++ ++YP+ G+P ++ + + ++ Sbjct: 4 SVSTKLLDFLVCPLSKEPLRFCPKSKNLINDSLGISYPVIDGIPCLVPVDGQLLN 58 >gi|295698420|ref|YP_003603075.1| hypothetical protein RIEPE_0197 [Candidatus Riesia pediculicola USDA] gi|291157503|gb|ADD79948.1| conserved domain protein [Candidatus Riesia pediculicola USDA] Length = 54 Score = 64.1 bits (156), Expect = 6e-09, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 33/53 (62%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 +D L+ I+ CP+ G L + +EL+ +K +A+PI+ + +++ ++R+V Sbjct: 1 MDKFLINIIACPICTGRLVHSKKNSELICQKDRVAFPIKKNILVLMEEKSRKV 53 >gi|115482180|ref|NP_001064683.1| Os10g0438700 [Oryza sativa Japonica Group] gi|78708718|gb|ABB47693.1| expressed protein [Oryza sativa Japonica Group] gi|110289140|gb|ABG66096.1| expressed protein [Oryza sativa Japonica Group] gi|113639292|dbj|BAF26597.1| Os10g0438700 [Oryza sativa Japonica Group] gi|215741294|dbj|BAG97789.1| unnamed protein product [Oryza sativa Japonica Group] gi|218184604|gb|EEC67031.1| hypothetical protein OsI_33757 [Oryza sativa Indica Group] gi|222612887|gb|EEE51019.1| hypothetical protein OsJ_31653 [Oryza sativa Japonica Group] Length = 96 Score = 64.1 bits (156), Expect = 6e-09, Method: Composition-based stats. Identities = 15/52 (28%), Positives = 28/52 (53%) Query: 12 LLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 L + LVCPL+K L + L+S +++PI G+P ++ + + +D Sbjct: 29 LADALVCPLSKKPLRYCEDSGSLVSDAVGVSFPIVDGIPYLVPKDGKLLDHD 80 >gi|147919961|ref|YP_686285.1| hypothetical protein RCIX1750 [uncultured methanogenic archaeon RC-I] gi|110621681|emb|CAJ36959.1| conserved hypothetical protein [uncultured methanogenic archaeon RC-I] Length = 59 Score = 64.1 bits (156), Expect = 7e-09, Method: Composition-based stats. Identities = 20/59 (33%), Positives = 30/59 (50%), Gaps = 8/59 (13%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTE--------LLSKKASLAYPIRSGVPIMLVSEAR 58 + L+ IL CP+ KG+L L E L K+ + +YPI+ G+P +L E R Sbjct: 1 MKKDLMNILCCPVCKGDLELQVTREEGAEVIEGTLYCKQCNESYPIQDGIPNLLPPELR 59 >gi|258654289|ref|YP_003203445.1| hypothetical protein Namu_4167 [Nakamurella multipartita DSM 44233] gi|258557514|gb|ACV80456.1| protein of unknown function DUF343 [Nakamurella multipartita DSM 44233] Length = 78 Score = 64.1 bits (156), Expect = 7e-09, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 26/55 (47%), Gaps = 5/55 (9%) Query: 8 IDPQLLEILVCPLTK-GNLTL----ISEGTELLSKKASLAYPIRSGVPIMLVSEA 57 +DP LL++L CP L L + +P+R G+P++L+ EA Sbjct: 11 LDPVLLDVLACPAEHHAPLHPGAPGDPGAPALTCTECGRVFPVRDGIPVLLLDEA 65 >gi|284161884|ref|YP_003400507.1| hypothetical protein Arcpr_0771 [Archaeoglobus profundus DSM 5631] gi|284011881|gb|ADB57834.1| protein of unknown function DUF343 [Archaeoglobus profundus DSM 5631] Length = 59 Score = 63.7 bits (155), Expect = 8e-09, Method: Composition-based stats. Identities = 21/59 (35%), Positives = 29/59 (49%), Gaps = 8/59 (13%) Query: 8 IDPQLLEILVCPLTKGNLTL---ISEGTE-----LLSKKASLAYPIRSGVPIMLVSEAR 58 + +LL+IL CP+ KG+L L E L+ K YPI G+P ML + R Sbjct: 1 MRKKLLDILACPICKGDLKLEVFDENEEEVISGKLICTKCGTEYPIEEGIPNMLPPDLR 59 >gi|327402005|ref|YP_004342844.1| hypothetical protein Arcve_2140 [Archaeoglobus veneficus SNP6] gi|327317513|gb|AEA48129.1| protein of unknown function DUF343 [Archaeoglobus veneficus SNP6] Length = 59 Score = 63.7 bits (155), Expect = 8e-09, Method: Composition-based stats. Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 8/59 (13%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTE--------LLSKKASLAYPIRSGVPIMLVSEAR 58 + LL+IL CP+ KG+L L E L+ K+ ++ YPI G+P ML E R Sbjct: 1 MKRSLLDILACPICKGDLDLFVEKENEEEILQGKLICKQCNIEYPIEDGIPNMLPPELR 59 >gi|256810497|ref|YP_003127866.1| protein of unknown function DUF343 [Methanocaldococcus fervens AG86] gi|256793697|gb|ACV24366.1| protein of unknown function DUF343 [Methanocaldococcus fervens AG86] Length = 50 Score = 63.7 bits (155), Expect = 8e-09, Method: Composition-based stats. Identities = 18/48 (37%), Positives = 27/48 (56%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIML 53 N + +EIL CP +G+L L + +L+ KK Y I G+PI+L Sbjct: 1 MNWIEKYIEILQCPYCRGDLYLDKDKNKLICKKCGKVYDIIDGIPILL 48 >gi|303328153|ref|ZP_07358592.1| putative glycine cleavage system H protein [Desulfovibrio sp. 3_1_syn3] gi|302861979|gb|EFL84914.1| putative glycine cleavage system H protein [Desulfovibrio sp. 3_1_syn3] Length = 81 Score = 63.7 bits (155), Expect = 8e-09, Method: Composition-based stats. Identities = 16/53 (30%), Positives = 23/53 (43%), Gaps = 3/53 (5%) Query: 10 PQLLEILVCPLTKGNLTL---ISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 +LL+IL CP G L + YP+R +P+ML+ EA Sbjct: 4 EELLQILACPRCLGTLEALTRDGRTQGFACQACQTVYPVRDDIPVMLIEEAVP 56 >gi|309811182|ref|ZP_07704977.1| conserved hypothetical protein [Dermacoccus sp. Ellin185] gi|308434868|gb|EFP58705.1| conserved hypothetical protein [Dermacoccus sp. Ellin185] Length = 75 Score = 63.3 bits (154), Expect = 1e-08, Method: Composition-based stats. Identities = 23/68 (33%), Positives = 33/68 (48%), Gaps = 9/68 (13%) Query: 2 RETIFNIDPQLLEILVCPLTKGNLTLISEGTE---LLS------KKASLAYPIRSGVPIM 52 IDP L EIL CP+T L S+ + L+S + L YPIR G+P++ Sbjct: 6 SRRPLTIDPWLREILRCPVTGTELEDASDASGAPVLVSTGVDAERGGRLQYPIRDGIPVL 65 Query: 53 LVSEARQV 60 L +A + Sbjct: 66 LADDASVL 73 >gi|33519836|ref|NP_878668.1| hypothetical protein Bfl377 [Candidatus Blochmannia floridanus] gi|81666776|sp|Q7VR46|Y377_BLOFL RecName: Full=UPF0434 protein Bfl377 gi|33504181|emb|CAD83443.1| Trm112p-like protein; tRNA methylation [Candidatus Blochmannia floridanus] Length = 61 Score = 62.9 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 34/54 (62%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 + +LLEI+VCP L + TEL+ ++++P++ G+P++L ++ R ++ Sbjct: 1 MQKKLLEIIVCPFCYTRLFMNDTETELICNIENISFPLKQGIPVLLKNQIRYLN 54 >gi|86739769|ref|YP_480169.1| hypothetical protein Francci3_1058 [Frankia sp. CcI3] gi|86566631|gb|ABD10440.1| protein of unknown function DUF343 [Frankia sp. CcI3] Length = 60 Score = 62.9 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 20/48 (41%), Positives = 29/48 (60%), Gaps = 2/48 (4%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIML 53 I+P+LL+IL CP+ KG L L+ L++ + Y IR VPI+L Sbjct: 1 MTIEPELLKILACPVDKGPLELVD--GWLVNPRLGHRYEIRDDVPILL 46 >gi|149175507|ref|ZP_01854128.1| hypothetical protein PM8797T_18624 [Planctomyces maris DSM 8797] gi|148845775|gb|EDL60117.1| hypothetical protein PM8797T_18624 [Planctomyces maris DSM 8797] Length = 79 Score = 62.9 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 26/58 (44%), Positives = 34/58 (58%), Gaps = 5/58 (8%) Query: 6 FNIDPQ-LLEILVCPLTKGNLTLISEGTELLS--KKASLAYPIRSGVPIMLVSEARQV 60 DPQ L +I+ CP TK L EG L+S + L YPI+ G+P+MLV EA +V Sbjct: 1 MLFDPQHLQDIIACPKTKAKLI--CEGEFLISVDPETRLKYPIKDGIPVMLVDEAVEV 56 >gi|289164571|ref|YP_003454709.1| hypothetical protein LLO_1229 [Legionella longbeachae NSW150] gi|288857744|emb|CBJ11588.1| putative hypothetical protein [Legionella longbeachae NSW150] Length = 63 Score = 62.9 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 2/53 (3%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 +D +LLE+LVCPL L+ + EL+ K LA+PI +P+ML EAR + Sbjct: 1 MDKKLLELLVCPL--CKGKLLLKKQELICKFDRLAFPIHDDIPVMLEHEARVI 51 >gi|29832274|ref|NP_826908.1| hypothetical protein SAV_5731 [Streptomyces avermitilis MA-4680] gi|29609393|dbj|BAC73443.1| hypothetical protein [Streptomyces avermitilis MA-4680] Length = 73 Score = 62.9 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 23/62 (37%), Positives = 30/62 (48%), Gaps = 4/62 (6%) Query: 6 FNIDPQLLEILVCPLTKGNLTL----ISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 N D LL+IL CPL KG L L + L + + YPI G+P +L S QV Sbjct: 1 MNPDDPLLKILACPLDKGPLHLLVPDSEKDGVLYNPRLHRRYPIVDGIPQLLPSSGEQVT 60 Query: 62 DQ 63 + Sbjct: 61 ED 62 >gi|134102892|ref|YP_001108553.1| hypothetical protein SACE_6459 [Saccharopolyspora erythraea NRRL 2338] gi|291008023|ref|ZP_06565996.1| hypothetical protein SeryN2_26171 [Saccharopolyspora erythraea NRRL 2338] gi|133915515|emb|CAM05628.1| hypothetical protein SACE_6459 [Saccharopolyspora erythraea NRRL 2338] Length = 62 Score = 62.9 bits (153), Expect = 2e-08, Method: Composition-based stats. Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 2/51 (3%) Query: 8 IDPQLLEILVCPL-TKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEA 57 ++PQLLEIL CP L +G L +P+R G+P++L+ EA Sbjct: 1 MEPQLLEILACPCPAHAPLRQSDDGL-LTCTSCGRGFPVRDGIPVLLLEEA 50 >gi|322369384|ref|ZP_08043949.1| hypothetical protein ZOD2009_07844 [Haladaptatus paucihalophilus DX253] gi|320551116|gb|EFW92765.1| hypothetical protein ZOD2009_07844 [Haladaptatus paucihalophilus DX253] Length = 100 Score = 62.6 bits (152), Expect = 2e-08, Method: Composition-based stats. Identities = 17/60 (28%), Positives = 27/60 (45%), Gaps = 8/60 (13%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTE--------LLSKKASLAYPIRSGVPIMLVSEARQ 59 + L++I+ CPL K L L + E L + YPI G+P +L + R+ Sbjct: 40 MKKSLMDIICCPLDKQELELDARQEEDEEVIFGTLTCTECGEEYPIEDGIPNLLPPDMRE 99 >gi|262197676|ref|YP_003268885.1| hypothetical protein Hoch_4499 [Haliangium ochraceum DSM 14365] gi|262081023|gb|ACY16992.1| protein of unknown function DUF343 [Haliangium ochraceum DSM 14365] Length = 86 Score = 62.6 bits (152), Expect = 2e-08, Method: Composition-based stats. Identities = 17/51 (33%), Positives = 28/51 (54%), Gaps = 2/51 (3%) Query: 14 EILV-CPLTKGNLTLISEGTELLSKKASLAYPI-RSGVPIMLVSEARQVDD 62 E+LV CP G L + + L+ + L +PI +P+MLV EA ++ + Sbjct: 14 ELLVRCPACGGALLYLEDAAALVCPTSKLRFPITEDDIPVMLVDEADELSE 64 >gi|319941961|ref|ZP_08016282.1| hypothetical protein HMPREF9464_01501 [Sutterella wadsworthensis 3_1_45B] gi|319804614|gb|EFW01484.1| hypothetical protein HMPREF9464_01501 [Sutterella wadsworthensis 3_1_45B] Length = 91 Score = 62.2 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 15/58 (25%), Positives = 27/58 (46%), Gaps = 9/58 (15%) Query: 14 EILVCPLTKGNLTLI---------SEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 E LVCP +G L EL+ LA+ ++ +P+M+ +AR++ + Sbjct: 7 EFLVCPNCRGRLFASVPEEQANDAEGDKELICPHCGLAFAVKDHIPMMVPHDARKLSE 64 >gi|302551178|ref|ZP_07303520.1| conserved hypothetical protein [Streptomyces viridochromogenes DSM 40736] gi|302468796|gb|EFL31889.1| conserved hypothetical protein [Streptomyces viridochromogenes DSM 40736] Length = 73 Score = 62.2 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 23/62 (37%), Positives = 31/62 (50%), Gaps = 4/62 (6%) Query: 6 FNIDPQLLEILVCPLTKGNLTLI----SEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 D LL+IL CPL KG L L+ + L + + YPI G+P +L S QV Sbjct: 1 MKPDDPLLKILACPLDKGPLRLLAQTTEQEEALYNPRLQRRYPIVDGIPQLLPSSGEQVP 60 Query: 62 DQ 63 D+ Sbjct: 61 DE 62 >gi|114319435|ref|YP_741118.1| hypothetical protein Mlg_0273 [Alkalilimnicola ehrlichii MLHE-1] gi|114225829|gb|ABI55628.1| protein of unknown function DUF343 [Alkalilimnicola ehrlichii MLHE-1] Length = 91 Score = 62.2 bits (151), Expect = 3e-08, Method: Composition-based stats. Identities = 19/83 (22%), Positives = 31/83 (37%), Gaps = 27/83 (32%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISE---------------------------GTELLSKK 38 ++D +LL+IL CP+TK + L+ L+++ Sbjct: 1 MSLDKKLLDILCCPVTKQPVRLLEADALKRLNQRIEQGEVRHMDDSPVETPLREALITEN 60 Query: 39 ASLAYPIRSGVPIMLVSEARQVD 61 YP+ G+PIML A Sbjct: 61 DQRIYPVEDGIPIMLEERAIPAS 83 >gi|118576892|ref|YP_876635.1| hypothetical protein CENSYa_1719 [Cenarchaeum symbiosum A] gi|118195413|gb|ABK78331.1| conserved hypothetical protein [Cenarchaeum symbiosum A] Length = 89 Score = 61.8 bits (150), Expect = 3e-08, Method: Composition-based stats. Identities = 18/65 (27%), Positives = 28/65 (43%), Gaps = 9/65 (13%) Query: 8 IDPQLLEILVCPLTKG-NLTLIS--------EGTELLSKKASLAYPIRSGVPIMLVSEAR 58 + ++EIL CP+ K L L L + S YPI +P+ML E R Sbjct: 1 MKRNMVEILACPMDKHHPLELFECGSDGDKVLEGALYCTECSRFYPIIDEIPVMLPDELR 60 Query: 59 QVDDQ 63 +++ Sbjct: 61 DKEEE 65 >gi|329944306|ref|ZP_08292565.1| hypothetical protein HMPREF9056_00442 [Actinomyces sp. oral taxon 170 str. F0386] gi|328531036|gb|EGF57892.1| hypothetical protein HMPREF9056_00442 [Actinomyces sp. oral taxon 170 str. F0386] Length = 80 Score = 61.8 bits (150), Expect = 3e-08, Method: Composition-based stats. Identities = 24/59 (40%), Positives = 32/59 (54%), Gaps = 3/59 (5%) Query: 2 RETIFNIDPQLLEILVCPLTKGNLTL---ISEGTELLSKKASLAYPIRSGVPIMLVSEA 57 E + + P L IL CPL+ L + L+S+ LAYP+R GVPI+LV EA Sbjct: 10 PEQVPALSPALRSILRCPLSGNELVDGVDDAGRPALISQTVGLAYPVRDGVPILLVHEA 68 >gi|212703382|ref|ZP_03311510.1| hypothetical protein DESPIG_01425 [Desulfovibrio piger ATCC 29098] gi|212673228|gb|EEB33711.1| hypothetical protein DESPIG_01425 [Desulfovibrio piger ATCC 29098] Length = 67 Score = 61.8 bits (150), Expect = 3e-08, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 3/55 (5%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGT---ELLSKKASLAYPIRSGVPIMLVSEA 57 +LL+IL CP G+L + L ++ YP+R +PIMLV A Sbjct: 1 MMNTQELLQILACPRCMGSLEPLPSAEHPEGLACPACNVVYPVRDDIPIMLVDAA 55 >gi|34499407|ref|NP_903622.1| hypothetical protein CV_3952 [Chromobacterium violaceum ATCC 12472] gi|34105259|gb|AAQ61614.1| conserved hypothetical protein [Chromobacterium violaceum ATCC 12472] Length = 340 Score = 61.8 bits (150), Expect = 3e-08, Method: Composition-based stats. Identities = 18/63 (28%), Positives = 27/63 (42%), Gaps = 11/63 (17%) Query: 8 IDPQLLEILVCPLTKGNLTLIS--------EGTELLSKKASLAYPIRSGVPIMLVSE--- 56 + +LL IL CP +G L + + EL YP+ GVP +L+ + Sbjct: 1 MKRELLAILRCPHCRGELHVAGSGENEGEIDDGELHCAGCRRHYPVVQGVPRLLLQDGLV 60 Query: 57 ARQ 59 AR Sbjct: 61 ART 63 >gi|302545681|ref|ZP_07298023.1| conserved hypothetical protein [Streptomyces hygroscopicus ATCC 53653] gi|302463299|gb|EFL26392.1| conserved hypothetical protein [Streptomyces himastatinicus ATCC 53653] Length = 69 Score = 61.4 bits (149), Expect = 4e-08, Method: Composition-based stats. Identities = 23/58 (39%), Positives = 31/58 (53%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 D +L+IL CPL KG LTL+ L + + YPI GVP +L S +V D+ Sbjct: 1 MTPDDPILKILACPLDKGPLTLLLPEDALYNPRLRRRYPIVDGVPQLLPSSGERVPDE 58 >gi|156744320|ref|YP_001434449.1| hypothetical protein Rcas_4415 [Roseiflexus castenholzii DSM 13941] gi|156235648|gb|ABU60431.1| protein of unknown function DUF343 [Roseiflexus castenholzii DSM 13941] Length = 121 Score = 61.4 bits (149), Expect = 4e-08, Method: Composition-based stats. Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 3/57 (5%) Query: 10 PQLLEILVCPLTKGNLTLISE---GTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 P+LL IL P KG + L+ + L++++ YP+ G+PIML+ E + D+ Sbjct: 58 PELLAILADPGDKGPVELMRDSEGKEWLVNRRNGYRYPVEDGIPIMLLEEGEKNRDE 114 >gi|282162948|ref|YP_003355333.1| hypothetical protein MCP_0278 [Methanocella paludicola SANAE] gi|282155262|dbj|BAI60350.1| conserved hypothetical protein [Methanocella paludicola SANAE] Length = 59 Score = 61.4 bits (149), Expect = 4e-08, Method: Composition-based stats. Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 8/59 (13%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTE--------LLSKKASLAYPIRSGVPIMLVSEAR 58 + L++IL CP+ KG+L L + L KK + YPI G+P +L E R Sbjct: 1 MKKDLMDILCCPVCKGDLELTVKKESGPEVIEGTLHCKKCNENYPIEDGIPNLLPPELR 59 >gi|268323311|emb|CBH36899.1| conserved hypothetical protein, DUF343 family [uncultured archaeon] Length = 64 Score = 61.0 bits (148), Expect = 5e-08, Method: Composition-based stats. Identities = 21/64 (32%), Positives = 30/64 (46%), Gaps = 9/64 (14%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGT---------ELLSKKASLAYPIRSGVPIMLVSEAR 58 + ++++IL CP+ KG+L L E L K YPI G+P +L E R Sbjct: 1 MKKEMMDILACPMCKGDLDLSIEEEDEKGEIVVGSLYCGKCDQRYPIEDGIPNLLPPELR 60 Query: 59 QVDD 62 Q D Sbjct: 61 QSSD 64 >gi|111221226|ref|YP_712020.1| hypothetical protein FRAAL1782 [Frankia alni ACN14a] gi|111148758|emb|CAJ60434.1| hypothetical protein FRAAL1782 [Frankia alni ACN14a] Length = 60 Score = 61.0 bits (148), Expect = 5e-08, Method: Composition-based stats. Identities = 20/48 (41%), Positives = 29/48 (60%), Gaps = 2/48 (4%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIML 53 +I+P LL+IL CP+ KG L L+ L++ + Y IR VPI+L Sbjct: 1 MSIEPDLLKILACPVDKGPLELVD--GWLVNPRLGHRYEIRDEVPILL 46 >gi|332670988|ref|YP_004453996.1| hypothetical protein Celf_2483 [Cellulomonas fimi ATCC 484] gi|332340026|gb|AEE46609.1| hypothetical protein Celf_2483 [Cellulomonas fimi ATCC 484] Length = 67 Score = 61.0 bits (148), Expect = 6e-08, Method: Composition-based stats. Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 4/63 (6%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLI---SEGTELLSKKA-SLAYPIRSGVPIMLVSE 56 M T ++P + ++L CP++ L L+S LAYP+R G+P++L E Sbjct: 1 MTGTAHPLEPWVRDLLRCPVSGATLVDAVGPDGEPLLVSTADEPLAYPVRDGIPVLLADE 60 Query: 57 ARQ 59 AR Sbjct: 61 ARP 63 >gi|148657545|ref|YP_001277750.1| hypothetical protein RoseRS_3442 [Roseiflexus sp. RS-1] gi|148569655|gb|ABQ91800.1| protein of unknown function DUF343 [Roseiflexus sp. RS-1] Length = 119 Score = 61.0 bits (148), Expect = 6e-08, Method: Composition-based stats. Identities = 19/56 (33%), Positives = 31/56 (55%), Gaps = 3/56 (5%) Query: 11 QLLEILVCPLTKGNLTLISE---GTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +LL IL P KG + L+ + L++++ YPI G+PIML+ E + D+ Sbjct: 57 ELLAILADPGDKGPVELMKDSEGKEWLVNRRNGYRYPIEDGIPIMLLEEGEKNRDE 112 >gi|91773261|ref|YP_565953.1| hypothetical protein Mbur_1284 [Methanococcoides burtonii DSM 6242] gi|91712276|gb|ABE52203.1| Protein of unknown function DUF343 [Methanococcoides burtonii DSM 6242] Length = 60 Score = 60.6 bits (147), Expect = 6e-08, Method: Composition-based stats. Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 8/60 (13%) Query: 8 IDPQLLEILVCPLTKGNLTLI---SEGTE-----LLSKKASLAYPIRSGVPIMLVSEARQ 59 + L++IL CP+ KG+L L + E L K + +PI G+P ML E R+ Sbjct: 1 MKKDLMDILACPICKGDLVLNITKEDEKEIISGTLYCSKCNEYFPITDGIPNMLPPELRE 60 >gi|161527754|ref|YP_001581580.1| hypothetical protein Nmar_0246 [Nitrosopumilus maritimus SCM1] gi|160339055|gb|ABX12142.1| protein of unknown function DUF343 [Nitrosopumilus maritimus SCM1] Length = 89 Score = 60.6 bits (147), Expect = 6e-08, Method: Composition-based stats. Identities = 18/65 (27%), Positives = 26/65 (40%), Gaps = 9/65 (13%) Query: 8 IDPQLLEILVCPLTK-GNLTLIS--------EGTELLSKKASLAYPIRSGVPIMLVSEAR 58 ++ + +IL CP+ K L L L K + YPI +PIML E R Sbjct: 1 MNKTMTDILACPIDKNHPLELFEINEKSDIVSEGVLFCPKCTRFYPIIEEIPIMLPDELR 60 Query: 59 QVDDQ 63 + Sbjct: 61 DKKQE 65 >gi|239931447|ref|ZP_04688400.1| hypothetical protein SghaA1_24730 [Streptomyces ghanaensis ATCC 14672] gi|291439822|ref|ZP_06579212.1| conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672] gi|291342717|gb|EFE69673.1| conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672] Length = 101 Score = 60.6 bits (147), Expect = 8e-08, Method: Composition-based stats. Identities = 25/74 (33%), Positives = 30/74 (40%), Gaps = 16/74 (21%) Query: 6 FNIDPQLLEILVCPLTKGNLTL-------ISEGT---------ELLSKKASLAYPIRSGV 49 N D LL IL CPL KG L L E L + + YPI G+ Sbjct: 1 MNPDDPLLRILACPLDKGPLHLLPPAPGADREEGTGGRAAREASLYNPRLRRRYPIVDGI 60 Query: 50 PIMLVSEARQVDDQ 63 P +L S QV D+ Sbjct: 61 PQLLPSSGEQVPDE 74 >gi|296109157|ref|YP_003616106.1| protein of unknown function DUF343 [Methanocaldococcus infernus ME] gi|295433971|gb|ADG13142.1| protein of unknown function DUF343 [Methanocaldococcus infernus ME] Length = 48 Score = 60.3 bits (146), Expect = 8e-08, Method: Composition-based stats. Identities = 15/43 (34%), Positives = 21/43 (48%) Query: 10 PQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIM 52 + L IL CP KG L E +L+ K+ Y I +PI+ Sbjct: 4 EKYLNILCCPKCKGELEYKKERNKLVCKRCKKEYEIIDNIPIL 46 >gi|262194607|ref|YP_003265816.1| methyltransferase type 11 [Haliangium ochraceum DSM 14365] gi|262077954|gb|ACY13923.1| Methyltransferase type 11 [Haliangium ochraceum DSM 14365] Length = 370 Score = 60.3 bits (146), Expect = 9e-08, Method: Composition-based stats. Identities = 16/47 (34%), Positives = 28/47 (59%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLV 54 ++P+LLE + CP K L S L+S ++ +YP+ GVP+++ Sbjct: 1 MNPELLERMFCPAKKTPLAYSSADEALVSAESGSSYPVIGGVPVLVP 47 >gi|238763347|ref|ZP_04624311.1| hypothetical protein ykris0001_3030 [Yersinia kristensenii ATCC 33638] gi|238698446|gb|EEP91199.1| hypothetical protein ykris0001_3030 [Yersinia kristensenii ATCC 33638] Length = 43 Score = 59.9 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 15/37 (40%), Positives = 23/37 (62%) Query: 27 LISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 E EL+ K +LAYP+R G+P++L +EAR + Sbjct: 3 FNKENLELVCKADNLAYPVRDGIPVLLENEARPLSID 39 >gi|116754174|ref|YP_843292.1| hypothetical protein Mthe_0864 [Methanosaeta thermophila PT] gi|116665625|gb|ABK14652.1| protein of unknown function DUF343 [Methanosaeta thermophila PT] Length = 62 Score = 59.9 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 22/60 (36%), Positives = 30/60 (50%), Gaps = 8/60 (13%) Query: 8 IDPQLLEILVCPLTKGNLTLIS-EGTE-------LLSKKASLAYPIRSGVPIMLVSEARQ 59 + L+EILVCP+ +G+L L E E L + YPI G+P ML E R+ Sbjct: 1 MRRDLMEILVCPVCRGDLELEVFEENEREILTGRLTCRSCGEVYPIEEGIPNMLPPELRE 60 >gi|256380314|ref|YP_003103974.1| hypothetical protein Amir_6326 [Actinosynnema mirum DSM 43827] gi|255924617|gb|ACU40128.1| protein of unknown function DUF343 [Actinosynnema mirum DSM 43827] Length = 63 Score = 59.9 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 16/57 (28%), Positives = 24/57 (42%), Gaps = 5/57 (8%) Query: 6 FNIDPQLLEILVCPL-TKGNLT----LISEGTELLSKKASLAYPIRSGVPIMLVSEA 57 +DP+LLE+L CP L L Y + G+P++L+ EA Sbjct: 1 MQLDPRLLEVLACPCPEHAPLRQGTGPDPALEYLTCTACGRTYRVEDGIPVLLLGEA 57 >gi|88603566|ref|YP_503744.1| hypothetical protein Mhun_2320 [Methanospirillum hungatei JF-1] gi|88189028|gb|ABD42025.1| protein of unknown function DUF343 [Methanospirillum hungatei JF-1] Length = 58 Score = 59.5 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 17/56 (30%), Positives = 26/56 (46%), Gaps = 8/56 (14%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGT--------ELLSKKASLAYPIRSGVPIMLVS 55 + +L +IL CP+ KG+L L L+ S+ YPI G+P +L Sbjct: 1 MKRELYDILCCPVCKGDLELKVTEENDIEIITGSLICHACSVTYPIEDGIPNLLPQ 56 >gi|229819714|ref|YP_002881240.1| hypothetical protein Bcav_1218 [Beutenbergia cavernae DSM 12333] gi|229565627|gb|ACQ79478.1| conserved hypothetical protein [Beutenbergia cavernae DSM 12333] Length = 62 Score = 59.5 bits (144), Expect = 2e-07, Method: Composition-based stats. Identities = 21/61 (34%), Positives = 29/61 (47%), Gaps = 5/61 (8%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTEL-----LSKKASLAYPIRSGVPIMLVSEARQV 60 I+ + IL CP+T L L + LAYP+R GVP++L EAR+V Sbjct: 1 MEIEEWVRGILRCPVTGTELVDDVGPDGLPELRNTAPDRPLAYPVRDGVPVLLADEAREV 60 Query: 61 D 61 Sbjct: 61 S 61 >gi|268326443|emb|CBH40031.1| hypothetical protein, SAM-dependent methyltransferase type 11 family [uncultured archaeon] Length = 311 Score = 59.5 bits (144), Expect = 2e-07, Method: Composition-based stats. Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Query: 11 QLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 LL+I+VCP+ ++ ISE EL+ + + YPI +P +L E Sbjct: 263 DLLKIIVCPVCHSSIKRISET-ELICEGCNRTYPIIQSIPNLLPPE 307 >gi|288930776|ref|YP_003434836.1| hypothetical protein Ferp_0384 [Ferroglobus placidus DSM 10642] gi|288893024|gb|ADC64561.1| protein of unknown function DUF343 [Ferroglobus placidus DSM 10642] Length = 62 Score = 59.1 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 8/60 (13%) Query: 8 IDPQLLEILVCPLTKGNLTLISEG--------TELLSKKASLAYPIRSGVPIMLVSEARQ 59 + +LL+IL CP+ KG+L L + L+ + YPI G+P +L E R Sbjct: 1 MRKKLLDILACPVCKGDLRLEVKEENEEEVLEGFLICDNCNERYPIEEGIPNLLPPELRD 60 >gi|15790184|ref|NP_280008.1| hypothetical protein VNG1090H [Halobacterium sp. NRC-1] gi|169235912|ref|YP_001689112.1| hypothetical protein OE2580F [Halobacterium salinarum R1] gi|10580638|gb|AAG19488.1| hypothetical protein VNG_1090H [Halobacterium sp. NRC-1] gi|167726978|emb|CAP13764.1| conserved hypothetical protein [Halobacterium salinarum R1] Length = 67 Score = 59.1 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 8/60 (13%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTE--------LLSKKASLAYPIRSGVPIMLVSEARQ 59 + LL+I+ CPL K +LTL ++ TE L YPI G+P +L + R Sbjct: 1 MKEDLLDIVCCPLDKHDLTLDADATEDGEVMAGTLTCTDCGETYPIEDGIPNLLPPDMRD 60 >gi|294496235|ref|YP_003542728.1| hypothetical protein Mmah_1587 [Methanohalophilus mahii DSM 5219] gi|292667234|gb|ADE37083.1| protein of unknown function DUF343 [Methanohalophilus mahii DSM 5219] Length = 60 Score = 59.1 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 20/60 (33%), Positives = 25/60 (41%), Gaps = 8/60 (13%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTE--------LLSKKASLAYPIRSGVPIMLVSEARQ 59 + +++ IL CPL KG L L E L YPI G+P ML E R Sbjct: 1 MKKEMMNILACPLCKGELVLNISSDEGEEVISGTLYCAACDEYYPIEKGIPNMLPPEMRD 60 >gi|152967783|ref|YP_001363567.1| hypothetical protein Krad_3840 [Kineococcus radiotolerans SRS30216] gi|151362300|gb|ABS05303.1| hypothetical protein Krad_3840 [Kineococcus radiotolerans SRS30216] Length = 60 Score = 59.1 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 31/53 (58%), Gaps = 1/53 (1%) Query: 6 FNIDPQLLEILVCPLTKGNLTLIS-EGTELLSKKASLAYPIRSGVPIMLVSEA 57 +D +LE+L CP++ L ++ +G E L+ + + YP+ GVP++L A Sbjct: 1 MALDAWVLELLRCPVSGEPLEPVTVDGAEFLTTPSGIRYPVLDGVPVLLADAA 53 >gi|116669758|ref|YP_830691.1| hypothetical protein Arth_1197 [Arthrobacter sp. FB24] gi|116609867|gb|ABK02591.1| protein of unknown function DUF343 [Arthrobacter sp. FB24] Length = 88 Score = 59.1 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 22/57 (38%), Positives = 29/57 (50%), Gaps = 7/57 (12%) Query: 5 IFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKAS-----LAYPIRSGVPIMLVSE 56 + I P LL +L CP+T L EG EL+S A L Y I G+P++L E Sbjct: 1 MPKISPDLLSVLRCPVTGSTLV--QEGEELVSTAAGQSGEKLRYAIEDGIPLLLPPE 55 >gi|330507579|ref|YP_004384007.1| hypothetical protein MCON_1545 [Methanosaeta concilii GP-6] gi|328928387|gb|AEB68189.1| Protein of unknown function (DUF343) [Methanosaeta concilii GP-6] Length = 60 Score = 59.1 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 22/60 (36%), Positives = 30/60 (50%), Gaps = 8/60 (13%) Query: 8 IDPQLLEILVCPLTKGNLTLIS-EGTE-------LLSKKASLAYPIRSGVPIMLVSEARQ 59 + LL+IL CP+ KG+L L E E L + + YPI G+P ML E R+ Sbjct: 1 MKRDLLDILACPMCKGDLILEVFEENESEILAGKLCCRACNEIYPIEDGIPNMLPPELRE 60 >gi|298674260|ref|YP_003726010.1| hypothetical protein Metev_0286 [Methanohalobium evestigatum Z-7303] gi|298287248|gb|ADI73214.1| protein of unknown function DUF343 [Methanohalobium evestigatum Z-7303] Length = 60 Score = 58.7 bits (142), Expect = 3e-07, Method: Composition-based stats. Identities = 17/60 (28%), Positives = 30/60 (50%), Gaps = 8/60 (13%) Query: 8 IDPQLLEILVCPLTKGNLTLI---SEGTE-----LLSKKASLAYPIRSGVPIMLVSEARQ 59 + +L++IL CP+ KG+L L + E L + YP+ G+P +L + R+ Sbjct: 1 MKKELMDILACPICKGDLVLNIIEEDEVEIKSGTLYCSQCREYYPVEDGIPNLLPPDIRE 60 >gi|289427811|ref|ZP_06429520.1| conserved hypothetical protein [Propionibacterium acnes J165] gi|295131211|ref|YP_003581874.1| hypothetical protein HMPREF0675_4739 [Propionibacterium acnes SK137] gi|289158993|gb|EFD07188.1| conserved hypothetical protein [Propionibacterium acnes J165] gi|291375345|gb|ADD99199.1| conserved hypothetical protein [Propionibacterium acnes SK137] gi|313773276|gb|EFS39242.1| like protein [Propionibacterium acnes HL074PA1] gi|313793440|gb|EFS41491.1| like protein [Propionibacterium acnes HL110PA1] gi|313801161|gb|EFS42424.1| like protein [Propionibacterium acnes HL110PA2] gi|313808510|gb|EFS46975.1| like protein [Propionibacterium acnes HL087PA2] gi|313812082|gb|EFS49796.1| like protein [Propionibacterium acnes HL083PA1] gi|313812352|gb|EFS50066.1| like protein [Propionibacterium acnes HL025PA1] gi|313819244|gb|EFS56958.1| like protein [Propionibacterium acnes HL046PA2] gi|313821084|gb|EFS58798.1| like protein [Propionibacterium acnes HL036PA1] gi|313823490|gb|EFS61204.1| like protein [Propionibacterium acnes HL036PA2] gi|313827006|gb|EFS64720.1| like protein [Propionibacterium acnes HL063PA1] gi|313829879|gb|EFS67593.1| like protein [Propionibacterium acnes HL007PA1] gi|313834721|gb|EFS72435.1| like protein [Propionibacterium acnes HL056PA1] gi|313837909|gb|EFS75623.1| like protein [Propionibacterium acnes HL086PA1] gi|314925931|gb|EFS89762.1| like protein [Propionibacterium acnes HL036PA3] gi|314960907|gb|EFT05008.1| like protein [Propionibacterium acnes HL002PA2] gi|314963329|gb|EFT07429.1| like protein [Propionibacterium acnes HL082PA1] gi|314974007|gb|EFT18103.1| like protein [Propionibacterium acnes HL053PA1] gi|314975432|gb|EFT19527.1| like protein [Propionibacterium acnes HL045PA1] gi|314979468|gb|EFT23562.1| like protein [Propionibacterium acnes HL072PA2] gi|314984193|gb|EFT28285.1| like protein [Propionibacterium acnes HL005PA1] gi|314988453|gb|EFT32544.1| like protein [Propionibacterium acnes HL005PA2] gi|314988629|gb|EFT32720.1| like protein [Propionibacterium acnes HL005PA3] gi|315079391|gb|EFT51389.1| conserved hypothetical protein [Propionibacterium acnes HL053PA2] gi|315080032|gb|EFT52008.1| conserved hypothetical protein [Propionibacterium acnes HL078PA1] gi|315086789|gb|EFT58765.1| conserved hypothetical protein [Propionibacterium acnes HL002PA3] gi|315089436|gb|EFT61412.1| conserved hypothetical protein [Propionibacterium acnes HL072PA1] gi|315097793|gb|EFT69769.1| conserved hypothetical protein [Propionibacterium acnes HL038PA1] gi|327325382|gb|EGE67187.1| hypothetical protein HMPREF9338_02612 [Propionibacterium acnes HL096PA2] gi|327328280|gb|EGE70044.1| hypothetical protein HMPREF9337_01944 [Propionibacterium acnes HL096PA3] gi|327443674|gb|EGE90328.1| hypothetical protein HMPREF9570_02349 [Propionibacterium acnes HL043PA1] gi|327449212|gb|EGE95866.1| hypothetical protein HMPREF9571_00755 [Propionibacterium acnes HL043PA2] gi|327450195|gb|EGE96849.1| hypothetical protein HMPREF9568_00135 [Propionibacterium acnes HL013PA2] gi|327451259|gb|EGE97913.1| hypothetical protein HMPREF9584_02559 [Propionibacterium acnes HL092PA1] gi|328756749|gb|EGF70365.1| hypothetical protein HMPREF9563_01075 [Propionibacterium acnes HL020PA1] gi|328761024|gb|EGF74576.1| hypothetical protein HMPREF9343_01263 [Propionibacterium acnes HL099PA1] gi|332676088|gb|AEE72904.1| hypothetical protein PAZ_c17590 [Propionibacterium acnes 266] Length = 92 Score = 58.7 bits (142), Expect = 3e-07, Method: Composition-based stats. Identities = 16/58 (27%), Positives = 26/58 (44%), Gaps = 2/58 (3%) Query: 4 TIFNIDPQLLEILVCPLTKGNLTLISEGTELLS--KKASLAYPIRSGVPIMLVSEARQ 59 ++ P LE+ CP L + EL+ LA+ +R GVP + + AR+ Sbjct: 9 EALDLSPAFLEVAACPACHSRFALDFDSGELVCSSPSCGLAFLVRDGVPDLRLDAARK 66 >gi|329765872|ref|ZP_08257438.1| hypothetical protein Nlim_1219 [Candidatus Nitrosoarchaeum limnia SFB1] gi|329137715|gb|EGG41985.1| hypothetical protein Nlim_1219 [Candidatus Nitrosoarchaeum limnia SFB1] Length = 85 Score = 58.3 bits (141), Expect = 3e-07, Method: Composition-based stats. Identities = 19/61 (31%), Positives = 26/61 (42%), Gaps = 9/61 (14%) Query: 12 LLEILVCPLTK-GNLTLIS--------EGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 +++IL CP+ K L L L K S YPI +PIML E R + Sbjct: 1 MIDILACPIDKNHPLELYEIKEKDNVVSEGALFCPKCSRFYPIIEEIPIMLPDELRNKEQ 60 Query: 63 Q 63 + Sbjct: 61 E 61 >gi|50843151|ref|YP_056378.1| hypothetical protein PPA1689 [Propionibacterium acnes KPA171202] gi|282855027|ref|ZP_06264359.1| conserved hypothetical protein [Propionibacterium acnes J139] gi|289424905|ref|ZP_06426684.1| conserved hypothetical protein [Propionibacterium acnes SK187] gi|50840753|gb|AAT83420.1| conserved protein [Propionibacterium acnes KPA171202] gi|282581615|gb|EFB87000.1| conserved hypothetical protein [Propionibacterium acnes J139] gi|289154604|gb|EFD03290.1| conserved hypothetical protein [Propionibacterium acnes SK187] gi|313763400|gb|EFS34764.1| like protein [Propionibacterium acnes HL013PA1] gi|313814677|gb|EFS52391.1| like protein [Propionibacterium acnes HL059PA1] gi|313828223|gb|EFS65937.1| like protein [Propionibacterium acnes HL063PA2] gi|314914523|gb|EFS78354.1| like protein [Propionibacterium acnes HL005PA4] gi|314917590|gb|EFS81421.1| like protein [Propionibacterium acnes HL050PA1] gi|314919653|gb|EFS83484.1| like protein [Propionibacterium acnes HL050PA3] gi|314924283|gb|EFS88114.1| like protein [Propionibacterium acnes HL001PA1] gi|314930273|gb|EFS94104.1| like protein [Propionibacterium acnes HL067PA1] gi|314956868|gb|EFT01022.1| like protein [Propionibacterium acnes HL027PA1] gi|314957630|gb|EFT01733.1| like protein [Propionibacterium acnes HL002PA1] gi|314967379|gb|EFT11478.1| like protein [Propionibacterium acnes HL082PA2] gi|314968988|gb|EFT13086.1| like protein [Propionibacterium acnes HL037PA1] gi|314982098|gb|EFT26191.1| like protein [Propionibacterium acnes HL110PA3] gi|315090337|gb|EFT62313.1| conserved hypothetical protein [Propionibacterium acnes HL110PA4] gi|315093620|gb|EFT65596.1| conserved hypothetical protein [Propionibacterium acnes HL060PA1] gi|315098025|gb|EFT70001.1| conserved hypothetical protein [Propionibacterium acnes HL059PA2] gi|315102629|gb|EFT74605.1| conserved hypothetical protein [Propionibacterium acnes HL046PA1] gi|315104480|gb|EFT76456.1| conserved hypothetical protein [Propionibacterium acnes HL050PA2] gi|315106222|gb|EFT78198.1| conserved hypothetical protein [Propionibacterium acnes HL030PA1] gi|315110444|gb|EFT82420.1| conserved hypothetical protein [Propionibacterium acnes HL030PA2] gi|327325460|gb|EGE67264.1| hypothetical protein HMPREF9341_02494 [Propionibacterium acnes HL103PA1] gi|327451209|gb|EGE97863.1| hypothetical protein HMPREF9581_01791 [Propionibacterium acnes HL087PA3] gi|328754794|gb|EGF68410.1| hypothetical protein HMPREF9579_01404 [Propionibacterium acnes HL087PA1] Length = 92 Score = 58.3 bits (141), Expect = 4e-07, Method: Composition-based stats. Identities = 16/58 (27%), Positives = 26/58 (44%), Gaps = 2/58 (3%) Query: 4 TIFNIDPQLLEILVCPLTKGNLTLISEGTELLS--KKASLAYPIRSGVPIMLVSEARQ 59 ++ P LE+ CP L + EL+ LA+ +R GVP + + AR+ Sbjct: 9 EALDLSPAFLEVAACPACHSRFALDFDSGELVCSSPSCGLAFLVRDGVPDLRLDAARK 66 >gi|327332401|gb|EGE74137.1| hypothetical protein HMPREF9344_01675 [Propionibacterium acnes HL097PA1] Length = 92 Score = 58.3 bits (141), Expect = 4e-07, Method: Composition-based stats. Identities = 16/58 (27%), Positives = 26/58 (44%), Gaps = 2/58 (3%) Query: 4 TIFNIDPQLLEILVCPLTKGNLTLISEGTELLS--KKASLAYPIRSGVPIMLVSEARQ 59 ++ P LE+ CP L + EL+ LA+ +R GVP + + AR+ Sbjct: 9 EALDLSPAFLEVAACPACHSRFALDFDSGELVCSSPSCGLAFLVRDGVPDLRLDAARK 66 >gi|326382715|ref|ZP_08204406.1| hypothetical protein SCNU_07245 [Gordonia neofelifaecis NRRL B-59395] gi|326198834|gb|EGD56017.1| hypothetical protein SCNU_07245 [Gordonia neofelifaecis NRRL B-59395] Length = 72 Score = 58.3 bits (141), Expect = 4e-07, Method: Composition-based stats. Identities = 24/64 (37%), Positives = 34/64 (53%), Gaps = 3/64 (4%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPI-RSGVPIMLVSEARQ 59 M IDP + + LVCP G L + G EL + + +AY I G+P ML+ +AR Sbjct: 1 MATRAEGIDPVVRDRLVCPQDLGELI--NAGDELYNPRLRVAYAIDEHGIPNMLIDDARA 58 Query: 60 VDDQ 63 V D+ Sbjct: 59 VSDE 62 >gi|313835855|gb|EFS73569.1| like protein [Propionibacterium acnes HL037PA2] gi|314927145|gb|EFS90976.1| like protein [Propionibacterium acnes HL044PA1] gi|314970676|gb|EFT14774.1| like protein [Propionibacterium acnes HL037PA3] Length = 95 Score = 58.3 bits (141), Expect = 4e-07, Method: Composition-based stats. Identities = 16/58 (27%), Positives = 26/58 (44%), Gaps = 2/58 (3%) Query: 4 TIFNIDPQLLEILVCPLTKGNLTLISEGTELLS--KKASLAYPIRSGVPIMLVSEARQ 59 ++ P LE+ CP L + EL+ LA+ +R GVP + + AR+ Sbjct: 12 EALDLSPAFLEVAACPACHSRFALDFDSGELVCSSPSCGLAFLVRDGVPDLRLDAARK 69 >gi|328906050|gb|EGG25825.1| hypothetical protein PA08_1782 [Propionibacterium sp. P08] Length = 92 Score = 58.3 bits (141), Expect = 4e-07, Method: Composition-based stats. Identities = 16/58 (27%), Positives = 26/58 (44%), Gaps = 2/58 (3%) Query: 4 TIFNIDPQLLEILVCPLTKGNLTLISEGTELLS--KKASLAYPIRSGVPIMLVSEARQ 59 ++ P LE+ CP L + EL+ LA+ +R GVP + + AR+ Sbjct: 9 EALDLSPAFLEVAACPACHSRFALDFDSGELVCSSPSCGLAFLVRDGVPDLRLDAARK 66 >gi|320160029|ref|YP_004173253.1| hypothetical protein ANT_06190 [Anaerolinea thermophila UNI-1] gi|319993882|dbj|BAJ62653.1| hypothetical protein ANT_06190 [Anaerolinea thermophila UNI-1] Length = 75 Score = 58.3 bits (141), Expect = 4e-07, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 5/55 (9%) Query: 7 NIDPQLLEILVCPLT-----KGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 + P L+EIL CP+ K L +S L+ + YPI +P+ML+ E Sbjct: 1 MVHPDLMEILRCPVCVREEGKTGLLTLSRDYWLVCQDCQRKYPIVDEIPVMLIDE 55 >gi|223940754|ref|ZP_03632590.1| hypothetical protein Cflav_PD6510 [bacterium Ellin514] gi|223890573|gb|EEF57098.1| hypothetical protein Cflav_PD6510 [bacterium Ellin514] Length = 212 Score = 57.9 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 21/80 (26%), Positives = 29/80 (36%), Gaps = 27/80 (33%) Query: 8 IDPQLLEILVCPLTKGNLTLISE---------------------------GTELLSKKAS 40 +DP+LL IL CP T ++ + L+ Sbjct: 131 VDPELLRILCCPETYQDIKVAEAAVIEKINQQIFTGALRNRRGQVIREVIEGGLVRADGR 190 Query: 41 LAYPIRSGVPIMLVSEARQV 60 YPIR +PIMLV EA + Sbjct: 191 YLYPIRHNIPIMLVDEAIPL 210 >gi|66095497|gb|AAY42821.1| spherules-specific protein [Physarum polycephalum] Length = 172 Score = 57.6 bits (139), Expect = 5e-07, Method: Composition-based stats. Identities = 19/56 (33%), Positives = 32/56 (57%), Gaps = 4/56 (7%) Query: 10 PQLLEILVCPLTKGNLTLISEGT----ELLSKKASLAYPIRSGVPIMLVSEARQVD 61 +L+ LVCPL K L + + EL++ + +AYPI GVP + ++AR ++ Sbjct: 32 EHILDRLVCPLDKAALRAHRDDSGKLIELVNDRIGVAYPIIRGVPHLTPADARALN 87 >gi|303245051|ref|ZP_07331371.1| protein of unknown function DUF343 [Methanothermococcus okinawensis IH1] gi|302484570|gb|EFL47514.1| protein of unknown function DUF343 [Methanothermococcus okinawensis IH1] Length = 55 Score = 57.2 bits (138), Expect = 7e-07, Method: Composition-based stats. Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 2/53 (3%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTE--LLSKKASLAYPIRSGVPIMLVSE 56 + L IL CP +G+L LI E L+ ++ + I +PI+L E Sbjct: 1 MGWIKRYLHILQCPFCRGDLELIEENGNKKLICRRCKKTFKIVDNIPILLKDE 53 >gi|161528874|ref|YP_001582700.1| methyltransferase type 11 [Nitrosopumilus maritimus SCM1] gi|160340175|gb|ABX13262.1| Methyltransferase type 11 [Nitrosopumilus maritimus SCM1] Length = 288 Score = 56.8 bits (137), Expect = 9e-07, Method: Composition-based stats. Identities = 16/57 (28%), Positives = 22/57 (38%), Gaps = 7/57 (12%) Query: 13 LEILVCPLTKGNLTLIS-------EGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 LE L C L L E L KK +L +PI +PIM ++ + Sbjct: 6 LEFLRCMKCGAKLELDVFESKKEIEEGILQCKKCNLEFPIIQKIPIMWNDFSKYLSS 62 >gi|315083358|gb|EFT55334.1| conserved hypothetical protein [Propionibacterium acnes HL027PA2] Length = 92 Score = 56.8 bits (137), Expect = 9e-07, Method: Composition-based stats. Identities = 15/58 (25%), Positives = 25/58 (43%), Gaps = 2/58 (3%) Query: 4 TIFNIDPQLLEILVCPLTKGNLTLISEGTELLS--KKASLAYPIRSGVPIMLVSEARQ 59 ++ P LE+ CP L + L+ LA+ +R GVP + + AR+ Sbjct: 9 EALDLSPAFLEVAACPACHSRFALDFDRGGLVCSSPSCGLAFLVRDGVPDLRLDAARK 66 >gi|149179290|ref|ZP_01857852.1| hypothetical protein PM8797T_00477 [Planctomyces maris DSM 8797] gi|148841864|gb|EDL56265.1| hypothetical protein PM8797T_00477 [Planctomyces maris DSM 8797] Length = 328 Score = 56.8 bits (137), Expect = 1e-06, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 23/59 (38%), Gaps = 3/59 (5%) Query: 1 MRETIFN---IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 M + + LLE L P T L EL+ + S YP+ G+P + E Sbjct: 1 MTKETSTSTFLSQDLLEALRTPETCHPLEWSESQQELVDPQTSQTYPVIKGIPRFVEQE 59 >gi|227497990|ref|ZP_03928168.1| hypothetical protein HMPREF0058_2160 [Actinomyces urogenitalis DSM 15434] gi|226832597|gb|EEH64980.1| hypothetical protein HMPREF0058_2160 [Actinomyces urogenitalis DSM 15434] Length = 73 Score = 56.4 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 20/57 (35%), Positives = 30/57 (52%), Gaps = 3/57 (5%) Query: 9 DPQLLEILVCPLTKGNLTLISE---GTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 D Q+ +L CP+T L + L S+ L YP+R GVPI+L EA +++ Sbjct: 17 DAQIRALLRCPVTGEELVDVRGPSGEVGLASRGGGLVYPVRDGVPILLAHEASPLEN 73 >gi|225873582|ref|YP_002755041.1| hypothetical protein ACP_1977 [Acidobacterium capsulatum ATCC 51196] gi|225794130|gb|ACO34220.1| conserved hypothetical protein [Acidobacterium capsulatum ATCC 51196] Length = 55 Score = 56.4 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 14/52 (26%), Positives = 26/52 (50%), Gaps = 3/52 (5%) Query: 11 QLLEILVCPLTKGNLTLI---SEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 QLL+++VCP G L ++ L+ Y + G+P+++ A+Q Sbjct: 4 QLLDLIVCPACHGPLAECTGQADAPALVCTFCGREYSLLDGIPVLIPDRAKQ 55 >gi|289582861|ref|YP_003481327.1| hypothetical protein Nmag_3215 [Natrialba magadii ATCC 43099] gi|289532414|gb|ADD06765.1| protein of unknown function DUF343 [Natrialba magadii ATCC 43099] Length = 71 Score = 56.4 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 17/67 (25%), Positives = 25/67 (37%), Gaps = 15/67 (22%) Query: 8 IDPQLLEILVCPLTKGNLT-----LISEGTE----------LLSKKASLAYPIRSGVPIM 52 + LL+IL CPL K L L+ + YPI G+P + Sbjct: 1 MKESLLDILRCPLDKHELELEDATYDESADGDAAAEVVDGTLVCAECGERYPIEDGIPNL 60 Query: 53 LVSEARQ 59 L + R+ Sbjct: 61 LPPDMRE 67 >gi|257051138|ref|YP_003128971.1| protein of unknown function DUF343 [Halorhabdus utahensis DSM 12940] gi|256689901|gb|ACV10238.1| protein of unknown function DUF343 [Halorhabdus utahensis DSM 12940] Length = 64 Score = 56.0 bits (135), Expect = 2e-06, Method: Composition-based stats. Identities = 18/60 (30%), Positives = 28/60 (46%), Gaps = 8/60 (13%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTE--------LLSKKASLAYPIRSGVPIMLVSEARQ 59 + L++I+ CPL K +L L E E L + YPI G+P +L + R+ Sbjct: 1 MQEDLMDIICCPLDKHDLELDVEEREDGEIVAGTLTCTECGETYPIEDGIPNLLPPDMRE 60 >gi|126177958|ref|YP_001045923.1| hypothetical protein Memar_0006 [Methanoculleus marisnigri JR1] gi|125860752|gb|ABN55941.1| protein of unknown function DUF343 [Methanoculleus marisnigri JR1] Length = 61 Score = 56.0 bits (135), Expect = 2e-06, Method: Composition-based stats. Identities = 21/58 (36%), Positives = 27/58 (46%), Gaps = 8/58 (13%) Query: 8 IDPQLLEILVCPLTKGNLTL--ISEGTE------LLSKKASLAYPIRSGVPIMLVSEA 57 + L+EIL CP+ KG L L E E L S+ YPI G+P +L A Sbjct: 1 MRKNLMEILCCPVCKGELELTVTEESGEEVLEGTLRCAACSVDYPISEGIPNLLPQTA 58 >gi|269957325|ref|YP_003327114.1| hypothetical protein Xcel_2541 [Xylanimonas cellulosilytica DSM 15894] gi|269306006|gb|ACZ31556.1| conserved hypothetical protein [Xylanimonas cellulosilytica DSM 15894] Length = 63 Score = 56.0 bits (135), Expect = 2e-06, Method: Composition-based stats. Identities = 24/65 (36%), Positives = 35/65 (53%), Gaps = 7/65 (10%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLI---SEGTELLS--KKASLAYPIRSGVPIMLVS 55 M E + P + EIL CP+T L + EL S + LAYP+R G+P++L S Sbjct: 1 MSEPLIA--PWVREILRCPVTGAELVDGVGPTGEPELRSTDPERPLAYPVREGIPVLLES 58 Query: 56 EARQV 60 +AR + Sbjct: 59 DARPL 63 >gi|302326455|gb|ADL25656.1| conserved hypothetical protein [Fibrobacter succinogenes subsp. succinogenes S85] Length = 99 Score = 56.0 bits (135), Expect = 2e-06, Method: Composition-based stats. Identities = 21/82 (25%), Positives = 31/82 (37%), Gaps = 27/82 (32%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISE---------------------------GTELLSKK 38 F +D +LL IL CP T+ L+ E L + Sbjct: 14 FMLDSKLLSILCCPETRQPLSQAGEDCIALLNNAIKAGTLKNVAGEAITEPLAEALTTPD 73 Query: 39 ASLAYPIRSGVPIMLVSEARQV 60 S YP+R G+P++L EA + Sbjct: 74 GSRVYPVREGIPVLLADEAILL 95 >gi|146329141|ref|YP_001209223.1| hypothetical protein DNO_0303 [Dichelobacter nodosus VCS1703A] gi|146232611|gb|ABQ13589.1| hypothetical protein DNO_0303 [Dichelobacter nodosus VCS1703A] Length = 64 Score = 55.6 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 22/54 (40%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60 D + +L CP+T L L + S YPI G+ ++L + + Sbjct: 1 MFDEATVSLLRCPVTGQALRFERAENCLYTLDHSRRYPIVDGIALLLPEHSEAI 54 >gi|296130179|ref|YP_003637429.1| hypothetical protein Cfla_2340 [Cellulomonas flavigena DSM 20109] gi|296021994|gb|ADG75230.1| hypothetical protein Cfla_2340 [Cellulomonas flavigena DSM 20109] Length = 76 Score = 55.6 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 18/63 (28%), Positives = 29/63 (46%), Gaps = 5/63 (7%) Query: 2 RETIFNIDPQLLEILVCPLTKGNLTLISEGTE---LLS--KKASLAYPIRSGVPIMLVSE 56 +++P +L CP+T L + L+S LAYP+ G+P++L E Sbjct: 13 PRPATDLEPWARALLRCPVTGAELVDGVDEAGAPVLVSTDPARPLAYPVVDGIPVLLTDE 72 Query: 57 ARQ 59 AR Sbjct: 73 ARP 75 >gi|302035714|ref|YP_003796036.1| hypothetical protein NIDE0331 [Candidatus Nitrospira defluvii] gi|300603778|emb|CBK40110.1| conserved protein of unknown function, DUF343 (modular protein) [Candidatus Nitrospira defluvii] Length = 132 Score = 55.6 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 21/82 (25%), Positives = 31/82 (37%), Gaps = 27/82 (32%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEG---------------------------TELLSKKA 39 N+D LL IL CP TK + L E L+ + Sbjct: 48 NLDKDLLTILCCPETKQAVALADEQLIQKVNGAIERGVLKNKAQKPVTEKLDGGLIRSDS 107 Query: 40 SLAYPIRSGVPIMLVSEARQVD 61 + YP+R +P+ML+ E +D Sbjct: 108 KILYPVREDIPVMLIDEGIPLD 129 >gi|332814764|ref|XP_003309363.1| PREDICTED: protein preY, mitochondrial-like [Pan troglodytes] Length = 102 Score = 55.6 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 16/38 (42%), Positives = 23/38 (60%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYP 44 DP LLE LVCPL+K L + EL++++ + YP Sbjct: 52 AFDPALLEFLVCPLSKKPLRYEASTNELINEELRIPYP 89 >gi|21226222|ref|NP_632144.1| hypothetical protein MM_0120 [Methanosarcina mazei Go1] gi|20904456|gb|AAM29816.1| conserved protein [Methanosarcina mazei Go1] Length = 55 Score = 55.2 bits (133), Expect = 3e-06, Method: Composition-based stats. Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 8/54 (14%) Query: 13 LEILVCPLTKGNLTLI--SEGTE------LLSKKASLAYPIRSGVPIMLVSEAR 58 ++IL CP+ KG+LTL E E L YPI G+P +L ++ R Sbjct: 1 MDILACPVCKGDLTLNVVEENKEEVISGTLYCPVCKEHYPIDEGIPNLLPADLR 54 >gi|20092096|ref|NP_618171.1| hypothetical protein MA3281 [Methanosarcina acetivorans C2A] gi|19917314|gb|AAM06651.1| conserved hypothetical protein [Methanosarcina acetivorans C2A] Length = 60 Score = 55.2 bits (133), Expect = 3e-06, Method: Composition-based stats. Identities = 18/59 (30%), Positives = 25/59 (42%), Gaps = 8/59 (13%) Query: 8 IDPQLLEILVCPLTKGNLTLISE--------GTELLSKKASLAYPIRSGVPIMLVSEAR 58 + L++IL CP+ KGNL L L YPI G+P +L + R Sbjct: 1 MKKDLMDILACPVCKGNLILNVVEENEEEVISGTLYCPVCKEHYPIDEGIPNLLPPDLR 59 >gi|284164342|ref|YP_003402621.1| hypothetical protein Htur_1056 [Haloterrigena turkmenica DSM 5511] gi|284013997|gb|ADB59948.1| protein of unknown function DUF343 [Haloterrigena turkmenica DSM 5511] Length = 66 Score = 55.2 bits (133), Expect = 3e-06, Method: Composition-based stats. Identities = 20/62 (32%), Positives = 28/62 (45%), Gaps = 10/62 (16%) Query: 8 IDPQLLEILVCPLTKGNLTLISE----------GTELLSKKASLAYPIRSGVPIMLVSEA 57 + LLEIL CPL K L L G +L+ + YPI G+P +L + Sbjct: 1 MQESLLEILCCPLDKHELELEDADRDDDDNEIIGGDLVCTECGERYPIEDGIPNLLPPDM 60 Query: 58 RQ 59 R+ Sbjct: 61 RE 62 >gi|313676421|ref|YP_004054417.1| hypothetical protein Ftrac_2331 [Marivirga tractuosa DSM 4126] gi|312943119|gb|ADR22309.1| protein of unknown function DUF343 [Marivirga tractuosa DSM 4126] Length = 99 Score = 54.9 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 20/64 (31%), Positives = 27/64 (42%), Gaps = 8/64 (12%) Query: 8 IDPQLLEILVCPLTKGNL---TLISEGTE-----LLSKKASLAYPIRSGVPIMLVSEARQ 59 + +LLE + CP KG+L E E L +PI G+PIM E RQ Sbjct: 1 MQSRLLEKMCCPFDKGDLNISIFKQEENEIIEGLLTCSDCQRYFPIIYGIPIMTPDEYRQ 60 Query: 60 VDDQ 63 + Sbjct: 61 KSLE 64 >gi|296088253|emb|CBI35762.3| unnamed protein product [Vitis vinifera] Length = 57 Score = 54.9 bits (132), Expect = 4e-06, Method: Composition-based stats. Identities = 17/45 (37%), Positives = 26/45 (57%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPI 45 +R+ I+ L EILVCPL+K L + E L+S ++YP+ Sbjct: 9 LRDARVGINKTLSEILVCPLSKQPLRVCEESGSLISDAIGVSYPV 53 >gi|315022295|gb|EFT35323.1| hypothetical protein RAYM_05820 [Riemerella anatipestifer RA-YM] Length = 86 Score = 54.5 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 21/62 (33%), Positives = 28/62 (45%), Gaps = 9/62 (14%) Query: 11 QLLEILVCPLTKGNLTLISEGTE---------LLSKKASLAYPIRSGVPIMLVSEARQVD 61 +++E L CP K L L E LL K YPI SG+PIM E R+ + Sbjct: 4 KMIEKLCCPFDKQELELTIVKQETEERVEEGYLLCNKCRRVYPIISGIPIMSPDEYREFE 63 Query: 62 DQ 63 + Sbjct: 64 LE 65 >gi|219852815|ref|YP_002467247.1| protein of unknown function DUF343 [Methanosphaerula palustris E1-9c] gi|219547074|gb|ACL17524.1| protein of unknown function DUF343 [Methanosphaerula palustris E1-9c] Length = 55 Score = 54.5 bits (131), Expect = 5e-06, Method: Composition-based stats. Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 8/53 (15%) Query: 12 LLEILVCPLTKGNLTL---ISEGTE-----LLSKKASLAYPIRSGVPIMLVSE 56 ++EIL CP+ KG+LTL + +E L YPI G+P +L + Sbjct: 1 MMEILCCPICKGDLTLQAVEEDESEVREGTLFCAACRAGYPIHDGIPDLLPQK 53 >gi|108762739|ref|YP_632870.1| hypothetical protein MXAN_4708 [Myxococcus xanthus DK 1622] gi|108466619|gb|ABF91804.1| conserved hypothetical protein [Myxococcus xanthus DK 1622] Length = 55 Score = 54.5 bits (131), Expect = 5e-06, Method: Composition-based stats. Identities = 11/46 (23%), Positives = 19/46 (41%) Query: 12 LLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEA 57 + +L CP K L T + L++P+ G+P + A Sbjct: 1 MWAVLGCPHCKAPLQAQEAQTRVTCAPCRLSWPVEEGIPRLAPEHA 46 >gi|261417125|ref|YP_003250808.1| protein of unknown function DUF343 [Fibrobacter succinogenes subsp. succinogenes S85] gi|261373581|gb|ACX76326.1| protein of unknown function DUF343 [Fibrobacter succinogenes subsp. succinogenes S85] Length = 85 Score = 54.5 bits (131), Expect = 6e-06, Method: Composition-based stats. Identities = 20/81 (24%), Positives = 30/81 (37%), Gaps = 27/81 (33%) Query: 7 NIDPQLLEILVCPLTKGNLTLISE---------------------------GTELLSKKA 39 +D +LL IL CP T+ L+ E L + Sbjct: 1 MLDSKLLSILCCPETRQPLSQAGEDCIALLNNAIKAGTLKNVAGEAITEPLAEALTTPDG 60 Query: 40 SLAYPIRSGVPIMLVSEARQV 60 S YP+R G+P++L EA + Sbjct: 61 SRVYPVREGIPVLLADEAILL 81 >gi|73670955|ref|YP_306970.1| hypothetical protein Mbar_A3520 [Methanosarcina barkeri str. Fusaro] gi|72398117|gb|AAZ72390.1| conserved hypothetical protein [Methanosarcina barkeri str. Fusaro] Length = 55 Score = 54.5 bits (131), Expect = 6e-06, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 25/54 (46%), Gaps = 8/54 (14%) Query: 13 LEILVCPLTKGNLTLI--SEGTE------LLSKKASLAYPIRSGVPIMLVSEAR 58 ++IL CP+ KG+L L E E L YP+ G+P +L + R Sbjct: 1 MDILACPVCKGDLVLNVVEENKEEVISGTLYCPICKEHYPVDEGIPNLLPPDLR 54 >gi|326780917|ref|ZP_08240182.1| protein of unknown function DUF343 [Streptomyces cf. griseus XylebKG-1] gi|326661250|gb|EGE46096.1| protein of unknown function DUF343 [Streptomyces cf. griseus XylebKG-1] Length = 72 Score = 54.1 bits (130), Expect = 6e-06, Method: Composition-based stats. Identities = 16/43 (37%), Positives = 25/43 (58%) Query: 21 TKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 KG L+L++E L + + L+YPI G+P +L S R+V Sbjct: 16 DKGPLSLLAEEEALYNPRLRLSYPIVDGIPQLLPSSGRKVGSD 58 >gi|320104037|ref|YP_004179628.1| hypothetical protein Isop_2507 [Isosphaera pallida ATCC 43644] gi|319751319|gb|ADV63079.1| protein of unknown function DUF343 [Isosphaera pallida ATCC 43644] Length = 79 Score = 53.7 bits (129), Expect = 8e-06, Method: Composition-based stats. Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEAR 58 +D LL +L CP+ G L+ EG EL+ + + I +P ML+ EA+ Sbjct: 1 MVDEFLLSVLRCPMNPGGPALVKEGNELIC-GCGVRFAIVDDIPNMLIEEAK 51 >gi|182440255|ref|YP_001827974.1| hypothetical protein SGR_6462 [Streptomyces griseus subsp. griseus NBRC 13350] gi|178468771|dbj|BAG23291.1| conserved hypothetical protein [Streptomyces griseus subsp. griseus NBRC 13350] Length = 72 Score = 53.7 bits (129), Expect = 9e-06, Method: Composition-based stats. Identities = 16/43 (37%), Positives = 25/43 (58%) Query: 21 TKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 KG L+L++E L + + L+YPI G+P +L S R+V Sbjct: 16 DKGPLSLLTEEEALYNPRLRLSYPIVDGIPQLLPSSGRKVGSD 58 >gi|320532501|ref|ZP_08033320.1| hypothetical protein HMPREF9057_01192 [Actinomyces sp. oral taxon 171 str. F0337] gi|320135285|gb|EFW27414.1| hypothetical protein HMPREF9057_01192 [Actinomyces sp. oral taxon 171 str. F0337] Length = 79 Score = 53.3 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 25/68 (36%), Positives = 37/68 (54%), Gaps = 8/68 (11%) Query: 1 MRETIFNIDPQLL-----EILVCPLTKGNLTL---ISEGTELLSKKASLAYPIRSGVPIM 52 + + +P+LL +L CPL+ L + L+S+ LAYP+R GVPI+ Sbjct: 3 LPDNASVPEPRLLPSGLRAVLRCPLSGDELVDGIDDAGHPTLVSQNTGLAYPVRDGVPIL 62 Query: 53 LVSEARQV 60 LV EAR+V Sbjct: 63 LVHEARRV 70 >gi|78223769|ref|YP_385516.1| hypothetical protein Gmet_2572 [Geobacter metallireducens GS-15] gi|78195024|gb|ABB32791.1| protein of unknown function DUF343 [Geobacter metallireducens GS-15] Length = 313 Score = 53.3 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 13/59 (22%), Positives = 21/59 (35%), Gaps = 11/59 (18%) Query: 8 IDPQLLEILVCPLT---KGNLTL--------ISEGTELLSKKASLAYPIRSGVPIMLVS 55 + + +LVCP + L L L K +PIR G+ ++L Sbjct: 1 MKRSIAPLLVCPACLPKERPLELTATAEADGDITAGHLSCKGCRRRFPIRDGIAVLLPD 59 >gi|154149554|ref|YP_001403172.1| hypothetical protein Mboo_0005 [Candidatus Methanoregula boonei 6A8] gi|153998106|gb|ABS54529.1| protein of unknown function DUF343 [Methanoregula boonei 6A8] Length = 59 Score = 53.3 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 8/59 (13%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTE--------LLSKKASLAYPIRSGVPIMLVSEAR 58 + L++IL CP+ KG+L L + + L S YPI G+P +L R Sbjct: 1 MKRSLMDILCCPVCKGDLALRVDKEDPQEILEGNLHCAACSADYPITGGIPDLLPPSTR 59 >gi|261403007|ref|YP_003247231.1| protein of unknown function DUF343 [Methanocaldococcus vulcanius M7] gi|261370000|gb|ACX72749.1| protein of unknown function DUF343 [Methanocaldococcus vulcanius M7] Length = 51 Score = 53.3 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 15/49 (30%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Query: 6 FNIDPQLLEILVCPLTKGNLTL-ISEGTELLSKKASLAYPIRSGVPIML 53 ++IL CP G+L L ++ KK +Y I G+PI+L Sbjct: 1 MCWIKNYIDILQCPYCGGDLLLEDKTNKAIICKKCKRSYEIVDGIPILL 49 >gi|326772062|ref|ZP_08231347.1| tetraacyldisaccharide 4'-kinase (Lipid A 4'-kinase) [Actinomyces viscosus C505] gi|326638195|gb|EGE39096.1| tetraacyldisaccharide 4'-kinase (Lipid A 4'-kinase) [Actinomyces viscosus C505] Length = 79 Score = 52.9 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 25/56 (44%), Positives = 31/56 (55%), Gaps = 3/56 (5%) Query: 12 LLEILVCPLTKGNLT--LISEG-TELLSKKASLAYPIRSGVPIMLVSEARQVDDQG 64 L L CPL+ L L G L+S+ LAYP+R GVPI+LV EA +V G Sbjct: 19 LRSALRCPLSGEELVDGLDEAGRPALVSRGTGLAYPVRDGVPILLVHEASRVPAPG 74 >gi|121601774|ref|YP_989362.1| hypothetical protein BARBAKC583_1100 [Bartonella bacilliformis KC583] gi|120613951|gb|ABM44552.1| conserved hypothetical protein [Bartonella bacilliformis KC583] Length = 57 Score = 52.9 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 18/40 (45%), Positives = 27/40 (67%) Query: 4 TIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAY 43 DP++LE+LVCP+T GNL+ + EL+S KA+ +Y Sbjct: 2 KKMTTDPKMLELLVCPITGGNLSFNRKTQELISLKANFSY 41 >gi|313205982|ref|YP_004045159.1| hypothetical protein Riean_0485 [Riemerella anatipestifer DSM 15868] gi|312445298|gb|ADQ81653.1| protein of unknown function DUF343 [Riemerella anatipestifer DSM 15868] gi|325336578|gb|ADZ12852.1| hypothetical protein RIA_1784 [Riemerella anatipestifer RA-GD] Length = 86 Score = 52.9 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 20/62 (32%), Positives = 26/62 (41%), Gaps = 9/62 (14%) Query: 11 QLLEILVCPLTKGNLTLISEGTE---------LLSKKASLAYPIRSGVPIMLVSEARQVD 61 + +E L CP K L L E LL YPI SG+PIM E R+ + Sbjct: 4 KTIEKLCCPFDKQELELTIVKQETEESVEEGYLLCNNCRRVYPIVSGIPIMSPDEYREFE 63 Query: 62 DQ 63 + Sbjct: 64 LE 65 >gi|224417972|ref|ZP_03655978.1| 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Helicobacter canadensis MIT 98-5491] gi|253827309|ref|ZP_04870194.1| 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- benzoquinol methylase [Helicobacter canadensis MIT 98-5491] gi|253510715|gb|EES89374.1| 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- benzoquinol methylase [Helicobacter canadensis MIT 98-5491] Length = 337 Score = 52.9 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 8/51 (15%) Query: 13 LEILVCPLTKGNLTL-ISEGTE-------LLSKKASLAYPIRSGVPIMLVS 55 LE LVCP KG L + ++G E LL +K Y I G+P + Sbjct: 6 LEFLVCPKCKGQLEVENAKGNEEFIYEGKLLCRKCGGGYEIIQGIPRFVPQ 56 >gi|121997789|ref|YP_001002576.1| hypothetical protein Hhal_0998 [Halorhodospira halophila SL1] gi|121589194|gb|ABM61774.1| protein of unknown function DUF343 [Halorhodospira halophila SL1] Length = 86 Score = 52.5 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 17/79 (21%), Positives = 29/79 (36%), Gaps = 27/79 (34%) Query: 8 IDPQLLEILVCPLTKGNL--------------------TLISEG-------TELLSKKAS 40 +D +LL+IL CP+TK L + + L++ S Sbjct: 1 MDRKLLDILCCPITKRPLQPLSTQELEALNRHIADGQARYLDDTVVDTPLDEGLITDNGS 60 Query: 41 LAYPIRSGVPIMLVSEARQ 59 Y + G+P+ML + Sbjct: 61 RIYRVDDGIPVMLEERSIP 79 >gi|124002192|ref|ZP_01687046.1| hypothetical protein M23134_02032 [Microscilla marina ATCC 23134] gi|123992658|gb|EAY32003.1| hypothetical protein M23134_02032 [Microscilla marina ATCC 23134] Length = 295 Score = 52.5 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Query: 16 LVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEA 57 L CP+T+ +L+ SK + LAYPI GVP + +A Sbjct: 247 LACPVTRTSLSFDENAY--FSKSSLLAYPILHGVPCLTPDDA 286 >gi|76802014|ref|YP_327022.1| hypothetical protein NP2744A [Natronomonas pharaonis DSM 2160] gi|76557879|emb|CAI49463.1| conserved hypothetical protein [Natronomonas pharaonis DSM 2160] Length = 64 Score = 52.5 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 8/60 (13%) Query: 8 IDPQLLEILVCPLTKGNLTL------ISE--GTELLSKKASLAYPIRSGVPIMLVSEARQ 59 + LL+IL CPL KG+L L E LL ++ YPI G+P +L + R Sbjct: 1 MKESLLDILCCPLDKGDLELEVIREDDDEILEGRLLCEECGEEYPIEDGIPNLLPPDMRD 60 >gi|325067643|ref|ZP_08126316.1| hypothetical protein AoriK_07474 [Actinomyces oris K20] Length = 80 Score = 52.5 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 26/56 (46%), Positives = 33/56 (58%), Gaps = 3/56 (5%) Query: 12 LLEILVCPLTKGNLT--LISEG-TELLSKKASLAYPIRSGVPIMLVSEARQVDDQG 64 L L CPL+ L L G L+S+ A+LAYP+R GVPI+LV EA +V G Sbjct: 20 LRSALRCPLSGDELVDGLDEAGRPALVSRSAALAYPVRDGVPILLVHEASRVPAPG 75 >gi|88810847|ref|ZP_01126104.1| hypothetical protein NB231_17243 [Nitrococcus mobilis Nb-231] gi|88792477|gb|EAR23587.1| hypothetical protein NB231_17243 [Nitrococcus mobilis Nb-231] Length = 88 Score = 52.2 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 20/82 (24%), Positives = 31/82 (37%), Gaps = 27/82 (32%) Query: 6 FNIDPQLLEILVCPLTK--------------------GNLTLISEG-------TELLSKK 38 +D +LL+IL CP++K G+L + L++ Sbjct: 1 MALDRKLLDILCCPISKIPIRPLKRDELQRINEAIANGHLRYLDNSTVEAELDEGLITDN 60 Query: 39 ASLAYPIRSGVPIMLVSEARQV 60 A Y + G+PIML A V Sbjct: 61 AERVYRVDDGIPIMLEERAISV 82 >gi|322434033|ref|YP_004216245.1| protein of unknown function DUF343 [Acidobacterium sp. MP5ACTX9] gi|321161760|gb|ADW67465.1| protein of unknown function DUF343 [Acidobacterium sp. MP5ACTX9] Length = 53 Score = 52.2 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 13/44 (29%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Query: 14 EILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEA 57 ++LVCP+ G L L + + YP+ G+P++L A Sbjct: 9 DLLVCPVCFGRLVLAETT--VRCEGCGRVYPVVDGLPVLLADRA 50 >gi|220905009|ref|YP_002480321.1| hypothetical protein Ddes_1745 [Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774] gi|219869308|gb|ACL49643.1| protein of unknown function DUF343 [Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774] Length = 73 Score = 52.2 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 20/58 (34%), Positives = 28/58 (48%), Gaps = 4/58 (6%) Query: 6 FNID-PQLLEILVCPLTKGNLTLISEGTELLSKK---ASLAYPIRSGVPIMLVSEARQ 59 I+ +LL IL CP G LT + E + + YP+R +P+MLV EA Sbjct: 1 MPINTEELLRILACPKCLGGLTALEENAAVAGFACAACQVVYPVREDIPVMLVEEAED 58 >gi|294816165|ref|ZP_06774808.1| Trm112p domain-containing protein [Streptomyces clavuligerus ATCC 27064] gi|326444499|ref|ZP_08219233.1| hypothetical protein SclaA2_25696 [Streptomyces clavuligerus ATCC 27064] gi|294328764|gb|EFG10407.1| Trm112p domain-containing protein [Streptomyces clavuligerus ATCC 27064] Length = 73 Score = 52.2 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 20/60 (33%), Positives = 28/60 (46%), Gaps = 6/60 (10%) Query: 8 IDPQ--LLEILVCPLTKGNLTLI----SEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 ++P LL LVCPL KG L + + L + + YPI GVP +L + V Sbjct: 1 MNPADPLLAFLVCPLDKGPLRPVLSGTASVEALYNPRLRRLYPIVGGVPRLLPASGAPVS 60 >gi|296445154|ref|ZP_06887114.1| Methyltransferase type 11 [Methylosinus trichosporium OB3b] gi|296257328|gb|EFH04395.1| Methyltransferase type 11 [Methylosinus trichosporium OB3b] Length = 351 Score = 51.8 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 12/41 (29%), Positives = 22/41 (53%), Gaps = 3/41 (7%) Query: 16 LVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 LVCP+ + L +EG L ++P+ G+P++L + Sbjct: 5 LVCPIDRSPLH--AEGEALRCPH-GHSFPVVDGIPVLLRDD 42 >gi|124484892|ref|YP_001029508.1| hypothetical protein Mlab_0063 [Methanocorpusculum labreanum Z] gi|124362433|gb|ABN06241.1| protein of unknown function DUF343 [Methanocorpusculum labreanum Z] Length = 59 Score = 51.8 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 15/59 (25%), Positives = 24/59 (40%), Gaps = 8/59 (13%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTE--------LLSKKASLAYPIRSGVPIMLVSEAR 58 + ++L+I+ CP+ KG L L YPI SG+ +L + R Sbjct: 1 MKRRILDIICCPVCKGKFMLTEMEGNDTEIMEGLLTCTACKRVYPISSGIANLLPEDQR 59 >gi|303248412|ref|ZP_07334672.1| Methyltransferase type 11 [Desulfovibrio fructosovorans JJ] gi|302490210|gb|EFL50128.1| Methyltransferase type 11 [Desulfovibrio fructosovorans JJ] Length = 306 Score = 51.8 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 14/60 (23%), Positives = 24/60 (40%), Gaps = 11/60 (18%) Query: 8 IDPQLLEILVCPLT---KGNLTL--------ISEGTELLSKKASLAYPIRSGVPIMLVSE 56 + +LL++LVCP+ + L L L+ AY I G+ ++ E Sbjct: 1 MHARLLDLLVCPVCLPEEHPLQLQDHRHSGDDITSGTLVCPDCGAAYAITDGLADLVPPE 60 >gi|261381160|ref|ZP_05985733.1| tetraacyldisaccharide 4'-kinase [Neisseria subflava NJ9703] gi|284795971|gb|EFC51318.1| tetraacyldisaccharide 4'-kinase [Neisseria subflava NJ9703] Length = 34 Score = 51.0 bits (122), Expect = 5e-05, Method: Composition-based stats. Identities = 15/29 (51%), Positives = 22/29 (75%) Query: 35 LSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 S++A LAYPIR G+P ML +EAR + ++ Sbjct: 2 WSRQAKLAYPIRDGIPYMLENEARALSEE 30 >gi|307352176|ref|YP_003893227.1| hypothetical protein Mpet_0008 [Methanoplanus petrolearius DSM 11571] gi|307155409|gb|ADN34789.1| protein of unknown function DUF343 [Methanoplanus petrolearius DSM 11571] Length = 63 Score = 51.0 bits (122), Expect = 6e-05, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 23/55 (41%), Gaps = 13/55 (23%) Query: 14 EILVCPLTKGNLTL-------------ISEGTELLSKKASLAYPIRSGVPIMLVS 55 EIL CP+ KG+L L L +K + YPI G+P +L Sbjct: 7 EILCCPVCKGDLELKVVEKTVLESGEEDVIEGTLRCQKCGVDYPISGGIPNLLPQ 61 >gi|332796282|ref|YP_004457782.1| hypothetical protein Ahos_0596 [Acidianus hospitalis W1] gi|332694017|gb|AEE93484.1| conserved hypothetical protein [Acidianus hospitalis W1] Length = 129 Score = 50.6 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 17/101 (16%), Positives = 28/101 (27%), Gaps = 45/101 (44%) Query: 8 IDPQLLEILVCPLTKG---------------------NL--------------------- 25 + +L++IL CP+ K L Sbjct: 1 MKYRLMDILACPMCKHFPLQLIVISQKKVERTTDEKKPLCELYCAYKNSEVKNVENPPCD 60 Query: 26 ---TLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 T E L + YPI +P ML + R+ ++ Sbjct: 61 ECITYEIEEGVLYCPECKRWYPIIDEIPRMLPDKLRKKEED 101 >gi|55378078|ref|YP_135928.1| hypothetical protein rrnAC1284 [Haloarcula marismortui ATCC 43049] gi|55230803|gb|AAV46222.1| unknown [Haloarcula marismortui ATCC 43049] Length = 64 Score = 50.6 bits (121), Expect = 7e-05, Method: Composition-based stats. Identities = 18/60 (30%), Positives = 27/60 (45%), Gaps = 8/60 (13%) Query: 8 IDPQLLEILVCPLTKGNLTLISEG--------TELLSKKASLAYPIRSGVPIMLVSEARQ 59 + L+EI+ CPL K +L L EL + S +PI G+P +L + R Sbjct: 1 MKEDLMEIICCPLDKHDLDLEVTERDDGEILSGELTCTECSETFPIEDGIPNLLPPDMRD 60 >gi|163841742|ref|YP_001626147.1| hypothetical protein RSal33209_3012 [Renibacterium salmoninarum ATCC 33209] gi|162955218|gb|ABY24733.1| conserved hypothetical protein [Renibacterium salmoninarum ATCC 33209] Length = 71 Score = 50.2 bits (120), Expect = 8e-05, Method: Composition-based stats. Identities = 17/52 (32%), Positives = 23/52 (44%), Gaps = 7/52 (13%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKAS-----LAYPIRSGVPIMLV 54 + +LL IL CP+T L EL+S L Y I G+ I+L Sbjct: 4 LQKELLSILRCPVTGSRLQ--QGQHELVSDSPGPEGVPLHYRIEDGIAILLP 53 >gi|222479375|ref|YP_002565612.1| protein of unknown function DUF343 [Halorubrum lacusprofundi ATCC 49239] gi|222452277|gb|ACM56542.1| protein of unknown function DUF343 [Halorubrum lacusprofundi ATCC 49239] Length = 64 Score = 50.2 bits (120), Expect = 1e-04, Method: Composition-based stats. Identities = 15/60 (25%), Positives = 27/60 (45%), Gaps = 8/60 (13%) Query: 8 IDPQLLEILVCPLTKGNLTLISEG--------TELLSKKASLAYPIRSGVPIMLVSEARQ 59 + L++++ CPL K +L L + L + YPI G+P +L + R+ Sbjct: 1 MKESLMDVICCPLDKADLDLDIDERDDEEILTGTLTCTECGEIYPIEDGIPNLLPPDMRE 60 >gi|300711049|ref|YP_003736863.1| hypothetical protein HacjB3_08440 [Halalkalicoccus jeotgali B3] gi|299124732|gb|ADJ15071.1| hypothetical protein HacjB3_08440 [Halalkalicoccus jeotgali B3] Length = 59 Score = 49.9 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 24/55 (43%), Gaps = 8/55 (14%) Query: 13 LEILVCPLTKGNLTLI--------SEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 +EI+ CP+ K +L L L + YPI G+P +L + R+ Sbjct: 1 MEIVCCPIDKADLELDVEEREGEEILEGSLTCTECGEVYPIEDGIPNLLPPDMRE 55 >gi|119960880|ref|YP_947097.1| hypothetical protein AAur_1315 [Arthrobacter aurescens TC1] gi|119947739|gb|ABM06650.1| putative protein of unknown function (DUF343) [Arthrobacter aurescens TC1] Length = 72 Score = 49.9 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 7/50 (14%) Query: 5 IFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKA-----SLAYPIRSGV 49 + + P+LL IL CP+T L EG EL+S A L Y I G+ Sbjct: 1 MPKVSPELLSILRCPVTGSPLV--QEGDELVSTDAAADGEKLRYSIEDGI 48 >gi|255324651|ref|ZP_05365768.1| conserved hypothetical protein [Corynebacterium tuberculostearicum SK141] gi|255298557|gb|EET77857.1| conserved hypothetical protein [Corynebacterium tuberculostearicum SK141] Length = 38 Score = 49.9 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 22/34 (64%) Query: 26 TLISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 T + + L++++ +AYPI +P+MLV A++ Sbjct: 2 TYLEDKQVLVNERLGIAYPIEDDIPVMLVDHAQK 35 >gi|213857892|ref|ZP_03384863.1| hypothetical protein SentesT_22555 [Salmonella enterica subsp. enterica serovar Typhi str. M223] Length = 34 Score = 49.9 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 21/30 (70%) Query: 34 LLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 L+ K +LA+P+R G+P++L +EAR + Sbjct: 1 LICKLDNLAFPLRDGIPVLLENEARALTSD 30 >gi|194365147|ref|YP_002027757.1| hypothetical protein Smal_1369 [Stenotrophomonas maltophilia R551-3] gi|194347951|gb|ACF51074.1| protein of unknown function DUF343 [Stenotrophomonas maltophilia R551-3] Length = 89 Score = 49.9 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 16/79 (20%), Positives = 31/79 (39%), Gaps = 27/79 (34%) Query: 8 IDPQLLEILVCPLTKGNLTLISEG---------------------------TELLSKKAS 40 +D +LL++LV P T+ L+L+ G L+++ Sbjct: 1 MDRKLLDLLVSPDTRQPLSLLDGGGLEALNKAISTGAVNKADGNPLAQPLREALVTRDRK 60 Query: 41 LAYPIRSGVPIMLVSEARQ 59 + + G+P++L EA Sbjct: 61 QVFRVDDGIPVLLAEEAIP 79 >gi|190573603|ref|YP_001971448.1| hypothetical protein Smlt1612 [Stenotrophomonas maltophilia K279a] gi|254520904|ref|ZP_05132959.1| conserved hypothetical protein [Stenotrophomonas sp. SKA14] gi|190011525|emb|CAQ45143.1| CONSERVED HYPOTHETICAL PROTEIN [Stenotrophomonas maltophilia K279a] gi|219718495|gb|EED37020.1| conserved hypothetical protein [Stenotrophomonas sp. SKA14] Length = 89 Score = 49.5 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 15/79 (18%), Positives = 30/79 (37%), Gaps = 27/79 (34%) Query: 8 IDPQLLEILVCPLTKGNLTLISEG---------------------------TELLSKKAS 40 +D +LL++LV P T+ L+L+ L+++ Sbjct: 1 MDRKLLDLLVSPDTRQPLSLLDGKGLEALNKAISAGAVNKADGNPLAQPLREALVTRDRK 60 Query: 41 LAYPIRSGVPIMLVSEARQ 59 + + G+P++L EA Sbjct: 61 QVFRVDDGIPVLLAEEAIP 79 >gi|285018057|ref|YP_003375768.1| hypothetical protein XALc_1271 [Xanthomonas albilineans GPE PC73] gi|283473275|emb|CBA15780.1| conserved hypothetical protein [Xanthomonas albilineans] Length = 89 Score = 49.5 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 14/77 (18%), Positives = 28/77 (36%), Gaps = 27/77 (35%) Query: 8 IDPQLLEILVCPLTKGNLTLISEG---------------------------TELLSKKAS 40 +D +LL++L P T+ L L+ L+++ Sbjct: 1 MDRKLLDLLCSPDTRQPLALLEARGLEALNRAIAAGGVKRADGGAQTQALREALITRDRK 60 Query: 41 LAYPIRSGVPIMLVSEA 57 + + G+P++L EA Sbjct: 61 QVFRVEDGIPVLLSEEA 77 >gi|292490532|ref|YP_003525971.1| hypothetical protein Nhal_0394 [Nitrosococcus halophilus Nc4] gi|291579127|gb|ADE13584.1| protein of unknown function DUF343 [Nitrosococcus halophilus Nc4] Length = 300 Score = 49.5 bits (118), Expect = 2e-04, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 2/41 (4%) Query: 15 ILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVS 55 IL CP K L G L S +A + YPI G+P + + Sbjct: 247 ILACPKFKTPL--DEIGNMLFSPEALVVYPIIGGIPCLRIE 285 >gi|319786446|ref|YP_004145921.1| hypothetical protein Psesu_0838 [Pseudoxanthomonas suwonensis 11-1] gi|317464958|gb|ADV26690.1| protein of unknown function DUF343 [Pseudoxanthomonas suwonensis 11-1] Length = 89 Score = 49.5 bits (118), Expect = 2e-04, Method: Composition-based stats. Identities = 16/77 (20%), Positives = 29/77 (37%), Gaps = 27/77 (35%) Query: 8 IDPQLLEILVCPLTKGNLTLISEG---------------------------TELLSKKAS 40 +D +LL++L P T+ L L+ L+++ Sbjct: 1 MDRKLLDLLCSPDTRQPLALLESRGLEALNRAIAAGQVSRADGTPQREPLREALVTRDRR 60 Query: 41 LAYPIRSGVPIMLVSEA 57 Y + G+P++LV EA Sbjct: 61 QVYRVDDGIPVLLVEEA 77 >gi|308272064|emb|CBX28672.1| hypothetical protein N47_G39960 [uncultured Desulfobacterium sp.] Length = 314 Score = 49.5 bits (118), Expect = 2e-04, Method: Composition-based stats. Identities = 14/67 (20%), Positives = 20/67 (29%), Gaps = 11/67 (16%) Query: 8 IDPQLLEILVCPLT-----------KGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 + L + L+CP K EL +YPI GV ++L Sbjct: 1 MKKWLKDKLICPECINEGVLLDLNIKEEKEDDVTEGELSCSFCKRSYPIHKGVAVILPDT 60 Query: 57 ARQVDDQ 63 V Sbjct: 61 TMPVISD 67 >gi|257388223|ref|YP_003177996.1| hypothetical protein Hmuk_2176 [Halomicrobium mukohataei DSM 12286] gi|257170530|gb|ACV48289.1| protein of unknown function DUF343 [Halomicrobium mukohataei DSM 12286] Length = 59 Score = 49.1 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 26/55 (47%), Gaps = 8/55 (14%) Query: 13 LEILVCPLTKGNLTLISEG--------TELLSKKASLAYPIRSGVPIMLVSEARQ 59 ++I+ CPL K L L + L+ + +YPI G+P +L + R+ Sbjct: 1 MDIICCPLDKHELDLEVDERDDEEVLAGSLVCTECGESYPIEDGIPNLLPPDMRE 55 >gi|15920424|ref|NP_376093.1| hypothetical protein ST0241 [Sulfolobus tokodaii str. 7] gi|15621206|dbj|BAB65202.1| 132aa long hypothetical protein [Sulfolobus tokodaii str. 7] Length = 132 Score = 49.1 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 18/103 (17%), Positives = 28/103 (27%), Gaps = 47/103 (45%) Query: 8 IDPQLLEILVCPLTKG-NLTL------------------------------ISEGTE--- 33 + +LL++L CP+ K L I + E Sbjct: 1 MKYRLLDLLACPICKHFPLKYYVFSTRMVERGIGDEKKPLCELYCSYKNQFIKDMKEPTP 60 Query: 34 -------------LLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 L YPI +P ML + R+ D+ Sbjct: 61 CEECIKYEIVDGLLYCPNCKRWYPIIDEIPRMLPDKLRRKDED 103 >gi|156937091|ref|YP_001434887.1| hypothetical protein Igni_0297 [Ignicoccus hospitalis KIN4/I] gi|156566075|gb|ABU81480.1| protein of unknown function DUF343 [Ignicoccus hospitalis KIN4/I] Length = 127 Score = 48.7 bits (116), Expect = 3e-04, Method: Composition-based stats. Identities = 12/45 (26%), Positives = 18/45 (40%) Query: 19 PLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 P + L L+ K +PI G+P ML E R ++ Sbjct: 59 PPCEQCLDEEVVTGVLVCPKCGRWFPIIDGIPHMLPDELRNKEED 103 >gi|238063342|ref|ZP_04608051.1| hypothetical protein MCAG_04308 [Micromonospora sp. ATCC 39149] gi|237885153|gb|EEP73981.1| hypothetical protein MCAG_04308 [Micromonospora sp. ATCC 39149] Length = 70 Score = 48.7 bits (116), Expect = 3e-04, Method: Composition-based stats. Identities = 11/43 (25%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Query: 18 CPLT-KGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 CP T L +G L Y + G+P++L+ R Sbjct: 16 CPDTDHAPLRAAPDGRTLTCTGCGRVYDVVDGIPVLLLDRGRP 58 >gi|197118005|ref|YP_002138432.1| type 11 SAM-dependent methyltransferase [Geobacter bemidjiensis Bem] gi|197087365|gb|ACH38636.1| SAM-dependent methyltransferase, type 11 [Geobacter bemidjiensis Bem] Length = 299 Score = 48.7 bits (116), Expect = 3e-04, Method: Composition-based stats. Identities = 12/42 (28%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Query: 11 QLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIM 52 +L+ +L CP G + G EL+ S Y ++ +P M Sbjct: 251 ELMRLLACPTCGGTIK-KEGGKELICASCSARYQVKQEIPHM 291 >gi|302348547|ref|YP_003816185.1| hypothetical protein ASAC_0748 [Acidilobus saccharovorans 345-15] gi|302328959|gb|ADL19154.1| hypothetical protein ASAC_0748 [Acidilobus saccharovorans 345-15] Length = 128 Score = 48.7 bits (116), Expect = 3e-04, Method: Composition-based stats. Identities = 17/95 (17%), Positives = 25/95 (26%), Gaps = 45/95 (47%) Query: 14 EILVCPLTKGN-LTL--------------------------------------------I 28 E+L CP+ K L L Sbjct: 7 ELLACPVCKSPDLVLVEFRVDESRANVDPAKVRCRETCYLLRRPAAQVPLETCAQCVNKD 66 Query: 29 SEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 L+ + YPI G+P ML + R+V + Sbjct: 67 VVEGVLVCRSCGRWYPIIDGIPRMLDDKFRKVKED 101 >gi|281352829|gb|EFB28413.1| hypothetical protein PANDA_018286 [Ailuropoda melanoleuca] Length = 114 Score = 48.7 bits (116), Expect = 3e-04, Method: Composition-based stats. Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Query: 14 EILVCPLTKGNLTLISE-GTELLSKKASLAYPIRSGVPIMLVSEAR 58 E LVCPL++ + +L++++ +AYPI GVP M AR Sbjct: 56 EFLVCPLSQEASQICEAPANKLINEELGIAYPIIHGVPNMTPKAAR 101 >gi|15839262|ref|NP_299950.1| hypothetical protein XF2673 [Xylella fastidiosa 9a5c] gi|9107909|gb|AAF85470.1|AE004073_5 hypothetical protein XF_2673 [Xylella fastidiosa 9a5c] Length = 89 Score = 48.7 bits (116), Expect = 3e-04, Method: Composition-based stats. Identities = 14/77 (18%), Positives = 27/77 (35%), Gaps = 27/77 (35%) Query: 8 IDPQLLEILVCPLTKGNLTLISEG---------------------------TELLSKKAS 40 +D +LL +L P T+ L+L+ L+++ Sbjct: 1 MDRKLLHLLCSPDTRQPLSLLESKGLEALNKAIASGTVQRADGSIQNQSLHEALITRDRK 60 Query: 41 LAYPIRSGVPIMLVSEA 57 + I +P++L EA Sbjct: 61 QVFRIEDSIPVLLPEEA 77 >gi|28199898|ref|NP_780212.1| hypothetical protein PD2037 [Xylella fastidiosa Temecula1] gi|71275274|ref|ZP_00651561.1| Protein of unknown function DUF343 [Xylella fastidiosa Dixon] gi|71899957|ref|ZP_00682103.1| Protein of unknown function DUF343 [Xylella fastidiosa Ann-1] gi|71900140|ref|ZP_00682281.1| Protein of unknown function DUF343 [Xylella fastidiosa Ann-1] gi|170731276|ref|YP_001776709.1| hypothetical protein Xfasm12_2228 [Xylella fastidiosa M12] gi|182682648|ref|YP_001830808.1| hypothetical protein XfasM23_2138 [Xylella fastidiosa M23] gi|28058019|gb|AAO29861.1| conserved hypothetical protein [Xylella fastidiosa Temecula1] gi|71164083|gb|EAO13798.1| Protein of unknown function DUF343 [Xylella fastidiosa Dixon] gi|71730089|gb|EAO32179.1| Protein of unknown function DUF343 [Xylella fastidiosa Ann-1] gi|71730244|gb|EAO32329.1| Protein of unknown function DUF343 [Xylella fastidiosa Ann-1] gi|167966069|gb|ACA13079.1| conserved hypothetical protein [Xylella fastidiosa M12] gi|182632758|gb|ACB93534.1| protein of unknown function DUF343 [Xylella fastidiosa M23] gi|307578928|gb|ADN62897.1| hypothetical protein XFLM_04675 [Xylella fastidiosa subsp. fastidiosa GB514] Length = 89 Score = 48.3 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 14/77 (18%), Positives = 27/77 (35%), Gaps = 27/77 (35%) Query: 8 IDPQLLEILVCPLTKGNLTLISEG---------------------------TELLSKKAS 40 +D +LL +L P T+ L+L+ L+++ Sbjct: 1 MDRKLLHLLCSPDTRQPLSLLESKGLEALNKAIVSGTVQRADGSIQNQSLHEALITRDRK 60 Query: 41 LAYPIRSGVPIMLVSEA 57 + I +P++L EA Sbjct: 61 QVFRIEDSIPVLLPEEA 77 >gi|307595918|ref|YP_003902235.1| hypothetical protein Vdis_1812 [Vulcanisaeta distributa DSM 14429] gi|307551119|gb|ADN51184.1| protein of unknown function DUF343 [Vulcanisaeta distributa DSM 14429] Length = 134 Score = 48.3 bits (115), Expect = 4e-04, Method: Composition-based stats. Identities = 10/30 (33%), Positives = 15/30 (50%) Query: 34 LLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 L K YPI+ +PI+L E R ++ Sbjct: 72 LYCPKCGRWYPIKDEIPILLPDELRNKEED 101 >gi|197304920|pdb|2K5R|A Chain A, Solution Nmr Structure Of Xf2673 From Xylella Fastidiosa. Northeast Structural Genomics Consortium Target Xfr39 Length = 97 Score = 47.9 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 14/77 (18%), Positives = 27/77 (35%), Gaps = 27/77 (35%) Query: 8 IDPQLLEILVCPLTKGNLTLISEG---------------------------TELLSKKAS 40 +D +LL +L P T+ L+L+ L+++ Sbjct: 1 MDRKLLHLLCSPDTRQPLSLLESKGLEALNKAIVSGTVQRADGSIQNQSLHEALITRDRK 60 Query: 41 LAYPIRSGVPIMLVSEA 57 + I +P++L EA Sbjct: 61 QVFRIEDSIPVLLPEEA 77 >gi|325967777|ref|YP_004243969.1| hypothetical protein VMUT_0253 [Vulcanisaeta moutnovskia 768-28] gi|323706980|gb|ADY00467.1| hypothetical protein VMUT_0253 [Vulcanisaeta moutnovskia 768-28] Length = 134 Score = 47.9 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 15/33 (45%) Query: 31 GTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 L K YPI+ +PI+L E R ++ Sbjct: 69 EGILYCTKCGRWYPIKDEIPILLPDELRNKEED 101 >gi|325915562|ref|ZP_08177873.1| hypothetical protein XVE_1767 [Xanthomonas vesicatoria ATCC 35937] gi|325538278|gb|EGD09963.1| hypothetical protein XVE_1767 [Xanthomonas vesicatoria ATCC 35937] Length = 89 Score = 47.9 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 14/77 (18%), Positives = 29/77 (37%), Gaps = 27/77 (35%) Query: 8 IDPQLLEILVCPLTKGNLTLISEG---------------------------TELLSKKAS 40 +D +LL++L P T+ L+L+ L+++ Sbjct: 1 MDRKLLDLLCSPDTRQPLSLLDGKGLEALNTAIATGNLQRADGTAQSQPLREALITRDRK 60 Query: 41 LAYPIRSGVPIMLVSEA 57 + + G+P++L EA Sbjct: 61 QIFRVDDGIPVLLAEEA 77 >gi|311745040|ref|ZP_07718825.1| hypothetical protein ALPR1_00965 [Algoriphagus sp. PR1] gi|126577548|gb|EAZ81768.1| hypothetical protein ALPR1_00965 [Algoriphagus sp. PR1] Length = 94 Score = 47.9 bits (114), Expect = 5e-04, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 20/53 (37%), Gaps = 9/53 (16%) Query: 16 LVCPLTKGNLTL------ISE---GTELLSKKASLAYPIRSGVPIMLVSEARQ 59 L CP K +L L E L YPI G+PIM E R+ Sbjct: 9 LCCPFDKEDLELKTILTDDQENILEGWLTCGSCKRIYPIIKGIPIMNPDEYRE 61 >gi|325921387|ref|ZP_08183244.1| hypothetical protein XGA_2236 [Xanthomonas gardneri ATCC 19865] gi|325548145|gb|EGD19142.1| hypothetical protein XGA_2236 [Xanthomonas gardneri ATCC 19865] Length = 89 Score = 47.9 bits (114), Expect = 5e-04, Method: Composition-based stats. Identities = 14/77 (18%), Positives = 29/77 (37%), Gaps = 27/77 (35%) Query: 8 IDPQLLEILVCPLTKGNLTLISEG---------------------------TELLSKKAS 40 +D +LL++L P T+ L+L+ L+++ Sbjct: 1 MDRKLLDLLCSPDTRQPLSLLDGKGLEALNTAIAGGNLQRADGTVQAQPLREALITRDRK 60 Query: 41 LAYPIRSGVPIMLVSEA 57 + + G+P++L EA Sbjct: 61 QIFRVDDGIPVLLAEEA 77 >gi|159042435|ref|YP_001541687.1| hypothetical protein Cmaq_1880 [Caldivirga maquilingensis IC-167] gi|157921270|gb|ABW02697.1| protein of unknown function DUF343 [Caldivirga maquilingensis IC-167] Length = 133 Score = 47.5 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 13/33 (39%) Query: 31 GTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 L YPI+ +PI+L E R + Sbjct: 74 NGILYCPTCGRWYPIKDEIPILLPDELRNKKED 106 >gi|289665199|ref|ZP_06486780.1| hypothetical protein XcampvN_19551 [Xanthomonas campestris pv. vasculorum NCPPB702] gi|289667355|ref|ZP_06488430.1| hypothetical protein XcampmN_02263 [Xanthomonas campestris pv. musacearum NCPPB4381] Length = 89 Score = 47.5 bits (113), Expect = 6e-04, Method: Composition-based stats. Identities = 14/77 (18%), Positives = 29/77 (37%), Gaps = 27/77 (35%) Query: 8 IDPQLLEILVCPLTKGNLTLISEG---------------------------TELLSKKAS 40 +D +LL++L P T+ L+L+ L+++ Sbjct: 1 MDRKLLDLLCSPDTRQPLSLLDGKGLEALNAAIAGGTLQRADGAAQTQPLREALITRDRK 60 Query: 41 LAYPIRSGVPIMLVSEA 57 + + G+P++L EA Sbjct: 61 QIFRVDDGIPVLLAEEA 77 >gi|78048386|ref|YP_364561.1| hypothetical protein XCV2830 [Xanthomonas campestris pv. vesicatoria str. 85-10] gi|78036816|emb|CAJ24509.1| conserved hypothetical protein [Xanthomonas campestris pv. vesicatoria str. 85-10] Length = 89 Score = 47.5 bits (113), Expect = 6e-04, Method: Composition-based stats. Identities = 14/77 (18%), Positives = 29/77 (37%), Gaps = 27/77 (35%) Query: 8 IDPQLLEILVCPLTKGNLTLISEG---------------------------TELLSKKAS 40 +D +LL++L P T+ L+L+ L+++ Sbjct: 1 MDRKLLDLLCSPDTRQPLSLLDGKGLEALNAAIAGGTLQRADGTAQTQPLREALITRDRK 60 Query: 41 LAYPIRSGVPIMLVSEA 57 + + G+P++L EA Sbjct: 61 QIFRVDDGIPVLLAEEA 77 >gi|134046028|ref|YP_001097514.1| hypothetical protein MmarC5_0993 [Methanococcus maripaludis C5] gi|132663653|gb|ABO35299.1| protein of unknown function DUF343 [Methanococcus maripaludis C5] Length = 48 Score = 47.5 bits (113), Expect = 6e-04, Method: Composition-based stats. Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVS 55 +L+++L CP KG L L+ L KK + Y I+ +P++L Sbjct: 1 MKWLEELIDLLECPKCKGELELLGNK--LHCKKCNKNYLIKDKIPVLLDE 48 >gi|148656240|ref|YP_001276445.1| type 11 methyltransferase [Roseiflexus sp. RS-1] gi|148568350|gb|ABQ90495.1| Methyltransferase type 11 [Roseiflexus sp. RS-1] Length = 276 Score = 47.5 bits (113), Expect = 6e-04, Method: Composition-based stats. Identities = 18/54 (33%), Positives = 23/54 (42%), Gaps = 8/54 (14%) Query: 8 IDPQLLEILVCPLTKGNLTL----ISEGTELLS----KKASLAYPIRSGVPIML 53 +D +LL L CP G L L G E++S YPIR G+ L Sbjct: 1 MDDELLPSLRCPTCAGALDLRDRRCDTGGEIISGALHCACGAVYPIRDGIADFL 54 >gi|70606598|ref|YP_255468.1| hypothetical protein Saci_0805 [Sulfolobus acidocaldarius DSM 639] gi|68567246|gb|AAY80175.1| conserved Crenarchaeal protein [Sulfolobus acidocaldarius DSM 639] Length = 131 Score = 47.5 bits (113), Expect = 6e-04, Method: Composition-based stats. Identities = 15/104 (14%), Positives = 27/104 (25%), Gaps = 48/104 (46%) Query: 8 IDPQLLEILVCPLTKG-NLTLI---------SEGTE------------------------ 33 + +LL++L CP+ K L E Sbjct: 1 MKYRLLDLLACPICKHFPLQYHIFSYKKIQREIKDEKKPLCEIFCSFKNININEAKSSDL 60 Query: 34 --------------LLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 L YP+ +P ML + R+ +++ Sbjct: 61 PCDECYQYEIVDALLYCPNCKRWYPVIDEIPRMLPDKLRKKEEE 104 >gi|325924698|ref|ZP_08186136.1| hypothetical protein XPE_0044 [Xanthomonas perforans 91-118] gi|325544904|gb|EGD16249.1| hypothetical protein XPE_0044 [Xanthomonas perforans 91-118] Length = 89 Score = 47.5 bits (113), Expect = 6e-04, Method: Composition-based stats. Identities = 14/77 (18%), Positives = 29/77 (37%), Gaps = 27/77 (35%) Query: 8 IDPQLLEILVCPLTKGNLTLISEG---------------------------TELLSKKAS 40 +D +LL++L P T+ L+L+ L+++ Sbjct: 1 MDRKLLDLLCSPDTRQPLSLLDGKGLEALNAAIAGGTLQRADGAAQTQPLREALITRDRK 60 Query: 41 LAYPIRSGVPIMLVSEA 57 + + G+P++L EA Sbjct: 61 QIFRVDDGIPVLLAEEA 77 >gi|299471222|emb|CBN79077.1| conserved unknown protein [Ectocarpus siliculosus] Length = 62 Score = 47.5 bits (113), Expect = 7e-04, Method: Composition-based stats. Identities = 20/48 (41%), Positives = 28/48 (58%), Gaps = 2/48 (4%) Query: 12 LLEILVCPLTKGNLTLISEGTELLSKKASLAYPIR-SGVPIMLVSEAR 58 +L+ LVCP +K LT E ELLS +A+PI +G+ M + AR Sbjct: 1 MLKALVCPFSKLPLTYDLEARELLSPV-GVAFPITANGIADMTPASAR 47 >gi|21243409|ref|NP_642991.1| hypothetical protein XAC2680 [Xanthomonas axonopodis pv. citri str. 306] gi|21108959|gb|AAM37527.1| conserved hypothetical protein [Xanthomonas axonopodis pv. citri str. 306] Length = 89 Score = 47.2 bits (112), Expect = 7e-04, Method: Composition-based stats. Identities = 14/77 (18%), Positives = 29/77 (37%), Gaps = 27/77 (35%) Query: 8 IDPQLLEILVCPLTKGNLTLISEG---------------------------TELLSKKAS 40 +D +LL++L P T+ L+L+ L+++ Sbjct: 1 MDRKLLDLLCSPDTRQPLSLLDGKGLEALNAAIAGGALQRADGAAQTQPLREALITRDRK 60 Query: 41 LAYPIRSGVPIMLVSEA 57 + + G+P++L EA Sbjct: 61 QIFRVDDGIPVLLAEEA 77 >gi|332704792|ref|ZP_08424880.1| Methyltransferase type 11 [Desulfovibrio africanus str. Walvis Bay] gi|332554941|gb|EGJ51985.1| Methyltransferase type 11 [Desulfovibrio africanus str. Walvis Bay] Length = 356 Score = 46.8 bits (111), Expect = 0.001, Method: Composition-based stats. Identities = 14/48 (29%), Positives = 17/48 (35%), Gaps = 8/48 (16%) Query: 16 LVCPLTKGNLTLIS--------EGTELLSKKASLAYPIRSGVPIMLVS 55 L CP K +L L L S YPI +P M+ S Sbjct: 9 LHCPACKADLALDIFDKTVVGISAGILTCTACSTIYPIVDHIPRMVPS 56 >gi|58582834|ref|YP_201850.1| hypothetical protein XOO3211 [Xanthomonas oryzae pv. oryzae KACC10331] gi|84624701|ref|YP_452073.1| hypothetical protein XOO_3044 [Xanthomonas oryzae pv. oryzae MAFF 311018] gi|188577673|ref|YP_001914602.1| hypothetical protein PXO_01311 [Xanthomonas oryzae pv. oryzae PXO99A] gi|58427428|gb|AAW76465.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae KACC10331] gi|84368641|dbj|BAE69799.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae MAFF 311018] gi|188522125|gb|ACD60070.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae PXO99A] Length = 89 Score = 46.8 bits (111), Expect = 0.001, Method: Composition-based stats. Identities = 14/77 (18%), Positives = 29/77 (37%), Gaps = 27/77 (35%) Query: 8 IDPQLLEILVCPLTKGNLTLISEG---------------------------TELLSKKAS 40 +D +LL++L P T+ L+L+ L+++ Sbjct: 1 MDRKLLDLLCSPDTRQPLSLLDVKGLEVLNATIAGGTLQRADGTAQTQPLREALITRDRK 60 Query: 41 LAYPIRSGVPIMLVSEA 57 + + G+P++L EA Sbjct: 61 QIFRVDDGIPVLLAEEA 77 >gi|300176271|emb|CBK23582.2| Tetraacyldisaccharide-1-P 4-kinase [Blastocystis hominis] Length = 95 Score = 46.8 bits (111), Expect = 0.001, Method: Composition-based stats. Identities = 17/48 (35%), Positives = 27/48 (56%) Query: 10 PQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEA 57 ++ + V PL+K +L I E L++ + YPIR G+ IM +EA Sbjct: 36 QKMCSVFVDPLSKTDLKYIPERNVFLAETIGVEYPIRDGIYIMSPNEA 83 >gi|301119291|ref|XP_002907373.1| conserved hypothetical protein [Phytophthora infestans T30-4] gi|262105885|gb|EEY63937.1| conserved hypothetical protein [Phytophthora infestans T30-4] Length = 125 Score = 46.8 bits (111), Expect = 0.001, Method: Composition-based stats. Identities = 10/35 (28%), Positives = 20/35 (57%) Query: 22 KGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + + +L+ ++ A+PI G+P ML++E Sbjct: 88 HALLEVHVKQGKLVCPESGRAFPIIDGIPNMLLNE 122 >gi|166712591|ref|ZP_02243798.1| hypothetical protein Xoryp_14340 [Xanthomonas oryzae pv. oryzicola BLS256] Length = 89 Score = 46.4 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 14/77 (18%), Positives = 29/77 (37%), Gaps = 27/77 (35%) Query: 8 IDPQLLEILVCPLTKGNLTLISEG---------------------------TELLSKKAS 40 +D +LL++L P T+ L+L+ L+++ Sbjct: 1 MDRKLLDLLCSPDTRQPLSLLDVKGLEALNAAIAGGTLRRADGTAQTQPLREALITRDRK 60 Query: 41 LAYPIRSGVPIMLVSEA 57 + + G+P++L EA Sbjct: 61 QIFRVDDGIPVLLAEEA 77 >gi|159899219|ref|YP_001545466.1| type 11 methyltransferase [Herpetosiphon aurantiacus ATCC 23779] gi|159892258|gb|ABX05338.1| Methyltransferase type 11 [Herpetosiphon aurantiacus ATCC 23779] Length = 274 Score = 46.4 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 16/58 (27%), Positives = 27/58 (46%), Gaps = 9/58 (15%) Query: 8 IDPQLLEILVCPLTKGNLTLISEG--------TELLSKKASLAYPIRSGVPIMLVSEA 57 + P LL L CP+++ +L+L L+S ++PIR G+ +L A Sbjct: 1 MHPDLLPWLRCPVSQTSLSLHDARWRDGMIWSGTLVS-AVGHSWPIRDGIVDLLPRAA 57 >gi|67477710|ref|XP_654297.1| hypothetical protein [Entamoeba histolytica HM-1:IMSS] gi|56471332|gb|EAL48911.1| hypothetical protein, conserved [Entamoeba histolytica HM-1:IMSS] Length = 124 Score = 46.4 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 11/26 (42%), Positives = 15/26 (57%) Query: 31 GTELLSKKASLAYPIRSGVPIMLVSE 56 EL+ YPI +G+P ML+SE Sbjct: 96 EGELICPVCGRHYPIHNGIPNMLLSE 121 >gi|21231937|ref|NP_637854.1| hypothetical protein XCC2504 [Xanthomonas campestris pv. campestris str. ATCC 33913] gi|66767936|ref|YP_242698.1| hypothetical protein XC_1612 [Xanthomonas campestris pv. campestris str. 8004] gi|188991053|ref|YP_001903063.1| hypothetical protein xccb100_1657 [Xanthomonas campestris pv. campestris str. B100] gi|21113666|gb|AAM41778.1| conserved hypothetical protein [Xanthomonas campestris pv. campestris str. ATCC 33913] gi|66573268|gb|AAY48678.1| conserved hypothetical protein [Xanthomonas campestris pv. campestris str. 8004] gi|167732813|emb|CAP51007.1| Conserved hypothetical protein [Xanthomonas campestris pv. campestris] Length = 89 Score = 46.4 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 14/77 (18%), Positives = 29/77 (37%), Gaps = 27/77 (35%) Query: 8 IDPQLLEILVCPLTKGNLTLISEG---------------------------TELLSKKAS 40 +D +LL++L P T+ L+L+ L+++ Sbjct: 1 MDRKLLDLLCSPDTRQPLSLLDGKGLEALNRAIAAGTLQRVDGAVQDQPLREALITRDRK 60 Query: 41 LAYPIRSGVPIMLVSEA 57 + + G+P++L EA Sbjct: 61 QIFRVDDGIPVLLAEEA 77 >gi|196231323|ref|ZP_03130182.1| conserved hypothetical protein [Chthoniobacter flavus Ellin428] gi|196224659|gb|EDY19170.1| conserved hypothetical protein [Chthoniobacter flavus Ellin428] Length = 84 Score = 46.0 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 19/81 (23%), Positives = 33/81 (40%), Gaps = 27/81 (33%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGT---------------------------ELLSKKA 39 I +LL +L CP T +L+L S L+ + Sbjct: 1 MITDELLALLRCPQTMQSLSLASVEQLAQIEAARAAGKLLDRSGRTVKEPILGGLVREDG 60 Query: 40 SLAYPIRSGVPIMLVSEARQV 60 +L +PIR G+P++L+ +A + Sbjct: 61 ALLFPIRDGIPVLLLDDALPL 81 >gi|171185505|ref|YP_001794424.1| hypothetical protein Tneu_1047 [Thermoproteus neutrophilus V24Sta] gi|170934717|gb|ACB39978.1| protein of unknown function DUF343 [Thermoproteus neutrophilus V24Sta] Length = 140 Score = 46.0 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 12/50 (24%), Positives = 16/50 (32%), Gaps = 3/50 (6%) Query: 14 EILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 E L C E + YPI +P ML E R ++ Sbjct: 60 EALPCEECH---RWEIETGVIYCPTCGRWYPIIEEIPRMLPDELRNEKEE 106 >gi|14600764|ref|NP_147285.1| hypothetical protein APE_0505 [Aeropyrum pernix K1] gi|5104154|dbj|BAA79470.1| hypothetical protein [Aeropyrum pernix K1] Length = 136 Score = 46.0 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 9/32 (28%), Positives = 14/32 (43%) Query: 28 ISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 E L+ YPI G+P+M+ + R Sbjct: 68 DIEEGVLVCPACGRWYPIVEGIPVMMDDKYRD 99 >gi|261601822|gb|ACX91425.1| protein of unknown function DUF343 [Sulfolobus solfataricus 98/2] Length = 129 Score = 45.6 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 11/45 (24%), Positives = 19/45 (42%) Query: 19 PLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 P + + E L + + YPI +P ML + R+ +D Sbjct: 60 PPCEECIRHEIEEGMLYCESCNRWYPIIDEIPRMLPDKLRKEEDD 104 >gi|327542158|gb|EGF28651.1| protein containing DUF343 [Rhodopirellula baltica WH47] Length = 88 Score = 45.6 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 23/82 (28%), Positives = 31/82 (37%), Gaps = 27/82 (32%) Query: 7 NIDPQLLEILVCPLTKGNLTLISE---------------------------GTELLSKKA 39 I P +L IL CP + G LTL E L++ A Sbjct: 1 MITPDILPILRCPSSGGQLTLADESLIQRVNQAIRDGNARDQLDERVTDPIEGGLINSPA 60 Query: 40 SLAYPIRSGVPIMLVSEARQVD 61 YPIR G+P ++V EA + Sbjct: 61 DRLYPIRGGIPTLIVDEAIGLT 82 >gi|15897156|ref|NP_341761.1| hypothetical protein SSO0206 [Sulfolobus solfataricus P2] gi|284174401|ref|ZP_06388370.1| hypothetical protein Ssol98_07052 [Sulfolobus solfataricus 98/2] gi|13813343|gb|AAK40551.1| Conserved hypothetical protein [Sulfolobus solfataricus P2] Length = 129 Score = 45.6 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 11/45 (24%), Positives = 19/45 (42%) Query: 19 PLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 P + + E L + + YPI +P ML + R+ +D Sbjct: 60 PPCEECIRHEIEEGMLYCESCNRWYPIIDEIPRMLPDKLRKEEDD 104 >gi|330835706|ref|YP_004410434.1| hypothetical protein Mcup_1848 [Metallosphaera cuprina Ar-4] gi|329567845|gb|AEB95950.1| conserved hypothetical protein [Metallosphaera cuprina Ar-4] Length = 128 Score = 45.6 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 18/101 (17%), Positives = 30/101 (29%), Gaps = 46/101 (45%) Query: 8 IDPQLLEILVCPLTKG---NLTLISEGTE------------------------------- 33 + +L++IL CP+ K +L + E Sbjct: 1 MKYRLMDILACPMCKHFHLDLYVFQEKEYQKREPNEKIPLCEIYCSYKNVEVKEMANPPC 60 Query: 34 ------------LLSKKASLAYPIRSGVPIMLVSEARQVDD 62 L+ + YPI +P ML + R+ DD Sbjct: 61 FECIKKEIVEGLLVCPSCNRWYPIIDEIPRMLPDKLRKKDD 101 >gi|146303009|ref|YP_001190325.1| hypothetical protein Msed_0224 [Metallosphaera sedula DSM 5348] gi|145701259|gb|ABP94401.1| protein of unknown function DUF343 [Metallosphaera sedula DSM 5348] Length = 128 Score = 45.6 bits (108), Expect = 0.003, Method: Composition-based stats. Identities = 16/102 (15%), Positives = 30/102 (29%), Gaps = 46/102 (45%) Query: 8 IDPQLLEILVCPLTKG---NLTLISEGTE------------------------------- 33 + +L++IL CP+ K +L + E Sbjct: 1 MKYRLMDILACPMCKHFHLDLYVFQEKEYPKREPNGQLPLCEIYCAYKNTEVKSLESPPC 60 Query: 34 ------------LLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 L+ + YPI +P ML + R+ + + Sbjct: 61 QECIKKEVVEGLLVCPACNRWYPIIDEIPRMLPDKLRKRESE 102 >gi|91793116|ref|YP_562767.1| methyltransferase type 11 [Shewanella denitrificans OS217] gi|91715118|gb|ABE55044.1| Methyltransferase type 11 [Shewanella denitrificans OS217] Length = 300 Score = 45.2 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 13/38 (34%), Positives = 19/38 (50%), Gaps = 2/38 (5%) Query: 15 ILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIM 52 IL CP K L + L S ++ + YPI G+P + Sbjct: 247 ILACPKYKTPLE--NIENMLFSPESLMVYPIVGGIPCL 282 >gi|257438123|ref|ZP_05613878.1| conserved hypothetical protein [Faecalibacterium prausnitzii A2-165] gi|257199454|gb|EEU97738.1| conserved hypothetical protein [Faecalibacterium prausnitzii A2-165] Length = 366 Score = 45.2 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 7/30 (23%), Positives = 11/30 (36%) Query: 18 CPLTKGNLTLISEGTELLSKKASLAYPIRS 47 CP G L +L+ AY ++ Sbjct: 10 CPACTGPLHYDGASGKLVCDYCGSAYDVKD 39 >gi|124027947|ref|YP_001013267.1| hypothetical protein Hbut_1079 [Hyperthermus butylicus DSM 5456] gi|123978641|gb|ABM80922.1| conserved crenarchaeal protein [Hyperthermus butylicus DSM 5456] Length = 142 Score = 45.2 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 10/39 (25%), Positives = 14/39 (35%) Query: 25 LTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 L + L YPI +P ML R+ D+ Sbjct: 76 LKVEVVTGILYCPNCGRWYPIIDEIPRMLPDNLRRKDED 114 >gi|46200710|ref|ZP_00056597.2| COG0500: SAM-dependent methyltransferases [Magnetospirillum magnetotacticum MS-1] Length = 312 Score = 45.2 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 13/49 (26%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVS 55 D LL +L CP + L T L+++ + Y + GVP++ Sbjct: 1 MTDSLLLSLLRCPRSGEPLR-AEGETALVAEPSGRRYRVSGGVPLLAED 48 >gi|313141515|ref|ZP_07803708.1| 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Helicobacter canadensis MIT 98-5491] gi|313130546|gb|EFR48163.1| 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Helicobacter canadensis MIT 98-5491] Length = 329 Score = 45.2 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 15/48 (31%), Positives = 22/48 (45%), Gaps = 8/48 (16%) Query: 16 LVCPLTKGNLTL-ISEGTE-------LLSKKASLAYPIRSGVPIMLVS 55 +VCP KG L + ++G E LL +K Y I G+P + Sbjct: 1 MVCPKCKGQLEVENAKGNEEFIYEGKLLCRKCGGGYEIIQGIPRFVPQ 48 >gi|327405469|ref|YP_004346307.1| hypothetical protein Fluta_3498 [Fluviicola taffensis DSM 16823] gi|327320977|gb|AEA45469.1| protein of unknown function DUF343 [Fluviicola taffensis DSM 16823] Length = 310 Score = 45.2 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Query: 16 LVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVS 55 L CP+T LT +S+ L SK++ L YPI G+P +L Sbjct: 249 LRCPITLTELTKLSDS-FLYSKESFLTYPILDGIPCLLKD 287 >gi|242023082|ref|XP_002431965.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212517316|gb|EEB19227.1| conserved hypothetical protein [Pediculus humanus corporis] Length = 117 Score = 44.8 bits (106), Expect = 0.004, Method: Composition-based stats. Identities = 10/32 (31%), Positives = 17/32 (53%) Query: 25 LTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + EL+ + +PI G+P ML++E Sbjct: 83 LEVEVMEGELICPETGRKFPISDGIPNMLINE 114 >gi|119719724|ref|YP_920219.1| hypothetical protein Tpen_0815 [Thermofilum pendens Hrk 5] gi|119524844|gb|ABL78216.1| protein of unknown function DUF343 [Thermofilum pendens Hrk 5] Length = 123 Score = 44.8 bits (106), Expect = 0.004, Method: Composition-based stats. Identities = 7/45 (15%), Positives = 18/45 (40%) Query: 19 PLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 P + + L + +PI+ +P++L + R ++ Sbjct: 56 PGCDECIKVEVATGVLYCPECGRWWPIKDEIPVILPDDMRNKEED 100 >gi|239813783|ref|YP_002942693.1| glycosyl transferase family 2 [Variovorax paradoxus S110] gi|239800360|gb|ACS17427.1| glycosyl transferase family 2 [Variovorax paradoxus S110] Length = 1476 Score = 44.8 bits (106), Expect = 0.004, Method: Composition-based stats. Identities = 13/44 (29%), Positives = 19/44 (43%) Query: 12 LLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVS 55 LL IL CP T LT + L + +P+ G P++ Sbjct: 1198 LLPILRCPKTGLKLTADAASGALATVDGWRRWPVVQGRPVLCED 1241 >gi|327311405|ref|YP_004338302.1| hypothetical protein TUZN_1519 [Thermoproteus uzoniensis 768-20] gi|326947884|gb|AEA12990.1| hypothetical protein TUZN_1519 [Thermoproteus uzoniensis 768-20] Length = 139 Score = 44.8 bits (106), Expect = 0.004, Method: Composition-based stats. Identities = 12/50 (24%), Positives = 16/50 (32%), Gaps = 3/50 (6%) Query: 14 EILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 + L C E + YPI +P ML E R D+ Sbjct: 60 DTLPCEECH---RWEIETGVIYCPTCGRWYPIIEEIPRMLPDELRNEKDE 106 >gi|158335055|ref|YP_001516227.1| type 11 methyltransferase [Acaryochloris marina MBIC11017] gi|158305296|gb|ABW26913.1| methyltransferase type 11, putative [Acaryochloris marina MBIC11017] Length = 321 Score = 44.8 bits (106), Expect = 0.004, Method: Composition-based stats. Identities = 13/43 (30%), Positives = 21/43 (48%) Query: 15 ILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEA 57 +L CP+ KG L L + S +P+ + PI+L +A Sbjct: 14 LLCCPVCKGQLELQDHHLSCQNADCSSVFPVVNCAPILLNEDA 56 >gi|315428049|dbj|BAJ49637.1| conserved hypothetical protein [Candidatus Caldiarchaeum subterraneum] Length = 122 Score = 44.8 bits (106), Expect = 0.004, Method: Composition-based stats. Identities = 17/95 (17%), Positives = 25/95 (26%), Gaps = 43/95 (45%) Query: 8 IDPQLLEILVCPLTKG-NLTLISEGT------------ELLSK----------------- 37 + +L++IL CP+ K L L+ EL Sbjct: 1 MKYRLMDILACPMCKSFPLKLVVFEERIIEKPPFIRQCELYCALHGGFVRDFSKTDCERC 60 Query: 38 -------------KASLAYPIRSGVPIMLVSEARQ 59 YP+ +P ML E R Sbjct: 61 YGLEIASGYVECGGCGRWYPVVDEIPRMLPDEMRD 95 >gi|119873487|ref|YP_931494.1| hypothetical protein Pisl_2004 [Pyrobaculum islandicum DSM 4184] gi|119674895|gb|ABL89151.1| protein of unknown function DUF343 [Pyrobaculum islandicum DSM 4184] Length = 140 Score = 44.8 bits (106), Expect = 0.004, Method: Composition-based stats. Identities = 11/50 (22%), Positives = 16/50 (32%), Gaps = 3/50 (6%) Query: 14 EILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 + L C E + YPI +P ML E R ++ Sbjct: 60 DALPCEECH---KWEIETGVIYCPTCGRWYPIIEEIPRMLPDELRNEKEE 106 >gi|315426851|dbj|BAJ48472.1| conserved hypothetical protein [Candidatus Caldiarchaeum subterraneum] Length = 122 Score = 44.8 bits (106), Expect = 0.004, Method: Composition-based stats. Identities = 17/95 (17%), Positives = 25/95 (26%), Gaps = 43/95 (45%) Query: 8 IDPQLLEILVCPLTKG-NLTLISEGT------------ELLSK----------------- 37 + +L++IL CP+ K L L+ EL Sbjct: 1 MKYRLMDILACPMCKSFPLKLVVFEERIIEKPPFIRQCELYCALHGGYVRDFSKTDCERC 60 Query: 38 -------------KASLAYPIRSGVPIMLVSEARQ 59 YP+ +P ML E R Sbjct: 61 YGLEIASGYVECGGCGRWYPVVDEIPRMLPDEMRD 95 >gi|292493225|ref|YP_003528664.1| methyltransferase type 11 [Nitrosococcus halophilus Nc4] gi|291581820|gb|ADE16277.1| Methyltransferase type 11 [Nitrosococcus halophilus Nc4] Length = 684 Score = 44.5 bits (105), Expect = 0.005, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 12/34 (35%), Gaps = 2/34 (5%) Query: 16 LVCPLTKGNLTLISEGTELLSKKASLAYPIRSGV 49 L CP G + E YPIR G+ Sbjct: 6 LACPRCAGAIVADDTALE--CDACGATYPIRDGI 37 >gi|145592359|ref|YP_001154361.1| hypothetical protein Pars_2163 [Pyrobaculum arsenaticum DSM 13514] gi|145284127|gb|ABP51709.1| protein of unknown function DUF343 [Pyrobaculum arsenaticum DSM 13514] Length = 141 Score = 44.5 bits (105), Expect = 0.005, Method: Composition-based stats. Identities = 11/50 (22%), Positives = 16/50 (32%), Gaps = 3/50 (6%) Query: 14 EILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 + L C E + YPI +P ML E R ++ Sbjct: 60 DSLPCEECH---KWEIETGVIYCPSCGRWYPIIEEIPRMLPDELRNEKEE 106 >gi|298528137|ref|ZP_07015541.1| Methyltransferase type 11 [Desulfonatronospira thiodismutans ASO3-1] gi|298511789|gb|EFI35691.1| Methyltransferase type 11 [Desulfonatronospira thiodismutans ASO3-1] Length = 312 Score = 44.5 bits (105), Expect = 0.005, Method: Composition-based stats. Identities = 19/69 (27%), Positives = 28/69 (40%), Gaps = 14/69 (20%) Query: 8 IDPQLLEILVCPLT----KGNLTLISEGTE--------LLSKKASLAYPIRSGVPIMLVS 55 + L IL+CP KG L L ++ E L + YPIR G+ M+ Sbjct: 1 MKTWLTSILICPACLPLEKG-LQLKADSQEDDDVLEGTLNCPECLKEYPIREGIA-MVHP 58 Query: 56 EARQVDDQG 64 + + D G Sbjct: 59 QQDTIKDSG 67 >gi|150403550|ref|YP_001330844.1| hypothetical protein MmarC7_1635 [Methanococcus maripaludis C7] gi|150034580|gb|ABR66693.1| conserved hypothetical protein [Methanococcus maripaludis C7] Length = 48 Score = 44.5 bits (105), Expect = 0.005, Method: Composition-based stats. Identities = 13/50 (26%), Positives = 24/50 (48%), Gaps = 2/50 (4%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVS 55 +L+++L CP KG+L L+ + K Y I+ +P++L Sbjct: 1 MKWLEELIDLLECPNCKGDLELLGNK--VCCKNCKKIYSIKDKIPVLLDE 48 >gi|218778084|ref|YP_002429402.1| methyltransferase type 11 [Desulfatibacillum alkenivorans AK-01] gi|218759468|gb|ACL01934.1| Methyltransferase type 11 [Desulfatibacillum alkenivorans AK-01] Length = 313 Score = 44.5 bits (105), Expect = 0.005, Method: Composition-based stats. Identities = 12/67 (17%), Positives = 20/67 (29%), Gaps = 11/67 (16%) Query: 8 IDPQLLEILVCPLT-----------KGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 + L L CP K + L+ + I GV I+L + Sbjct: 1 MKKWLHNDLACPECFSNKNLLDLIVKEEVDDDVMEGRLVCTDCGAQFEISGGVAILLPKK 60 Query: 57 ARQVDDQ 63 R + + Sbjct: 61 TRHILSE 67 >gi|305663626|ref|YP_003859914.1| protein of unknown function DUF343 [Ignisphaera aggregans DSM 17230] gi|304378195|gb|ADM28034.1| protein of unknown function DUF343 [Ignisphaera aggregans DSM 17230] Length = 132 Score = 44.5 bits (105), Expect = 0.005, Method: Composition-based stats. Identities = 8/34 (23%), Positives = 14/34 (41%) Query: 30 EGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 + L+ YPI +P ML R+ ++ Sbjct: 73 KSGMLICTNCKRWYPIIDEIPRMLPDNYRKEEED 106 >gi|91079885|ref|XP_967890.1| PREDICTED: similar to predicted protein [Tribolium castaneum] gi|270004559|gb|EFA01007.1| hypothetical protein TcasGA2_TC003920 [Tribolium castaneum] Length = 124 Score = 44.5 bits (105), Expect = 0.005, Method: Composition-based stats. Identities = 9/35 (25%), Positives = 18/35 (51%) Query: 22 KGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + EL+ + +PI +G+P +L++E Sbjct: 87 HALLEIDIINGELICPETGRKFPINNGIPNLLLNE 121 >gi|126458852|ref|YP_001055130.1| hypothetical protein Pcal_0227 [Pyrobaculum calidifontis JCM 11548] gi|126248573|gb|ABO07664.1| protein of unknown function DUF343 [Pyrobaculum calidifontis JCM 11548] Length = 140 Score = 44.5 bits (105), Expect = 0.006, Method: Composition-based stats. Identities = 11/50 (22%), Positives = 16/50 (32%), Gaps = 3/50 (6%) Query: 14 EILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 + L C E + YPI +P ML E R ++ Sbjct: 60 DTLPCEECH---KWEIEAGVIYCPTCGRWYPIIEEIPRMLPDELRNEKEE 106 >gi|167390402|ref|XP_001739337.1| hypothetical protein [Entamoeba dispar SAW760] gi|165897004|gb|EDR24279.1| hypothetical protein, conserved [Entamoeba dispar SAW760] Length = 124 Score = 44.5 bits (105), Expect = 0.006, Method: Composition-based stats. Identities = 11/26 (42%), Positives = 15/26 (57%) Query: 31 GTELLSKKASLAYPIRSGVPIMLVSE 56 EL+ YPI +G+P ML+SE Sbjct: 96 EGELICPICERHYPIHNGIPNMLLSE 121 >gi|18311833|ref|NP_558500.1| hypothetical protein PAE0284 [Pyrobaculum aerophilum str. IM2] gi|18159244|gb|AAL62682.1| conserved hypothetical protein [Pyrobaculum aerophilum str. IM2] Length = 141 Score = 44.1 bits (104), Expect = 0.006, Method: Composition-based stats. Identities = 11/50 (22%), Positives = 16/50 (32%), Gaps = 3/50 (6%) Query: 14 EILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 + L C E + YPI +P ML E R ++ Sbjct: 60 DTLPCEECH---KWEIETGVIYCPNCGRWYPIIEEIPRMLPDELRNEKEE 106 >gi|110667616|ref|YP_657427.1| hypothetical protein HQ1659A [Haloquadratum walsbyi DSM 16790] gi|109625363|emb|CAJ51787.1| conserved hypothetical protein [Haloquadratum walsbyi DSM 16790] Length = 61 Score = 44.1 bits (104), Expect = 0.006, Method: Composition-based stats. Identities = 17/60 (28%), Positives = 27/60 (45%), Gaps = 8/60 (13%) Query: 8 IDPQLLEILVCPLTKGNLTLISEG--------TELLSKKASLAYPIRSGVPIMLVSEARQ 59 + L++IL PL K L L + L+ K+ YPI G+P +L + R+ Sbjct: 1 MKESLMDILCDPLDKSELELEVDERDGEEIIEGRLIGKETGEVYPIEDGIPNLLPPDMRE 60 >gi|163848784|ref|YP_001636828.1| type 11 methyltransferase [Chloroflexus aurantiacus J-10-fl] gi|222526735|ref|YP_002571206.1| type 11 methyltransferase [Chloroflexus sp. Y-400-fl] gi|163670073|gb|ABY36439.1| Methyltransferase type 11 [Chloroflexus aurantiacus J-10-fl] gi|222450614|gb|ACM54880.1| Methyltransferase type 11 [Chloroflexus sp. Y-400-fl] Length = 355 Score = 44.1 bits (104), Expect = 0.006, Method: Composition-based stats. Identities = 14/52 (26%), Positives = 21/52 (40%), Gaps = 7/52 (13%) Query: 11 QLLEILVCPLTKGNLTLIS-------EGTELLSKKASLAYPIRSGVPIMLVS 55 +LL L CP + L+L E +LL + Y I G+ + V Sbjct: 4 KLLHYLRCPQCRSQLSLSEATVGDWVEQGQLLCTQCRRTYAITKGIAYLYVE 55 >gi|257069216|ref|YP_003155471.1| phosphomannomutase [Brachybacterium faecium DSM 4810] gi|256560034|gb|ACU85881.1| phosphomannomutase [Brachybacterium faecium DSM 4810] Length = 592 Score = 44.1 bits (104), Expect = 0.006, Method: Composition-based stats. Identities = 10/43 (23%), Positives = 20/43 (46%), Gaps = 2/43 (4%) Query: 11 QLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIML 53 L IL CP G+L + + + +P+ G+P+++ Sbjct: 543 WLRSILRCPDCGGDLRDVERAMQ--CALCARVHPVEGGIPVLI 583 >gi|320353258|ref|YP_004194597.1| hypothetical protein Despr_1134 [Desulfobulbus propionicus DSM 2032] gi|320121760|gb|ADW17306.1| protein of unknown function DUF343 [Desulfobulbus propionicus DSM 2032] Length = 311 Score = 44.1 bits (104), Expect = 0.006, Method: Composition-based stats. Identities = 17/61 (27%), Positives = 25/61 (40%), Gaps = 12/61 (19%) Query: 8 IDPQLLEILVCPLT--KGNLTL---------ISEGTELLSKKASLAYPIRSGVPIMLVSE 56 + QLLE++VCP + +L + E L + YPI GV +L Sbjct: 1 MKKQLLELIVCPRCLPQEHLLVADIIQERDNDIETGALQCPRCRALYPITEGVA-LLDPH 59 Query: 57 A 57 A Sbjct: 60 A 60 >gi|300114375|ref|YP_003760950.1| methyltransferase type 11 [Nitrosococcus watsonii C-113] gi|299540312|gb|ADJ28629.1| Methyltransferase type 11 [Nitrosococcus watsonii C-113] Length = 681 Score = 44.1 bits (104), Expect = 0.006, Method: Composition-based stats. Identities = 12/38 (31%), Positives = 19/38 (50%), Gaps = 2/38 (5%) Query: 12 LLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGV 49 L E L CP + +EGT+ + +YP+R G+ Sbjct: 2 LREDLACPRCGSAIA--AEGTKFVCTACGASYPVRDGI 37 >gi|170590079|ref|XP_001899800.1| hypothetical protin, conserved [Brugia malayi] gi|158592719|gb|EDP31316.1| hypothetical protin, conserved [Brugia malayi] Length = 124 Score = 43.7 bits (103), Expect = 0.008, Method: Composition-based stats. Identities = 14/45 (31%), Positives = 20/45 (44%), Gaps = 8/45 (17%) Query: 11 QLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVS 55 +L +LVC L EL ++ +PIR G+P ML Sbjct: 83 ELHRLLVC--------LEVIEGELKCPESGRVFPIRDGIPNMLTD 119 >gi|217075881|gb|ACJ86300.1| unknown [Medicago truncatula] Length = 122 Score = 43.7 bits (103), Expect = 0.008, Method: Composition-based stats. Identities = 10/35 (28%), Positives = 17/35 (48%) Query: 22 KGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L L E L+ + +P++ G+P ML+ E Sbjct: 85 HALLELHLEEGALVCPETGRRFPVKKGIPNMLLHE 119 >gi|77165435|ref|YP_343960.1| UbiE/COQ5 methyltransferase [Nitrosococcus oceani ATCC 19707] gi|254434568|ref|ZP_05048076.1| Methyltransferase domain family [Nitrosococcus oceani AFC27] gi|76883749|gb|ABA58430.1| UbiE/COQ5 methyltransferase [Nitrosococcus oceani ATCC 19707] gi|207090901|gb|EDZ68172.1| Methyltransferase domain family [Nitrosococcus oceani AFC27] Length = 698 Score = 43.7 bits (103), Expect = 0.009, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Query: 16 LVCPLTKGNLTLISEGTELLSKKASLAYPIRSGV 49 L CP G + + TEL +YPIR G+ Sbjct: 20 LACPRCAGAIV--ANDTELGCVACGASYPIRDGI 51 >gi|312085230|ref|XP_003144596.1| adrenal gland protein AD-001 [Loa loa] gi|307760241|gb|EFO19475.1| adrenal gland protein AD-001 [Loa loa] Length = 124 Score = 43.7 bits (103), Expect = 0.009, Method: Composition-based stats. Identities = 9/25 (36%), Positives = 13/25 (52%) Query: 31 GTELLSKKASLAYPIRSGVPIMLVS 55 EL ++ +PIR G+P ML Sbjct: 95 EGELKCPESGRVFPIRDGIPNMLTD 119 >gi|32477481|ref|NP_870475.1| hypothetical protein RB12383 [Rhodopirellula baltica SH 1] gi|32448035|emb|CAD77552.1| hypothetical protein RB12383 [Rhodopirellula baltica SH 1] Length = 88 Score = 43.3 bits (102), Expect = 0.011, Method: Composition-based stats. Identities = 23/82 (28%), Positives = 30/82 (36%), Gaps = 27/82 (32%) Query: 7 NIDPQLLEILVCPLTKGNLTLISE---------------------------GTELLSKKA 39 I P +L IL CP G LTL E L++ A Sbjct: 1 MITPDILPILRCPSNGGQLTLADESLIQRVNQAIRDGNARDQLDERVTDPIEGGLINSPA 60 Query: 40 SLAYPIRSGVPIMLVSEARQVD 61 YPIR G+P ++V EA + Sbjct: 61 DRLYPIRGGIPTLIVDEAIGLT 82 >gi|229579827|ref|YP_002838226.1| protein of unknown function DUF343 [Sulfolobus islandicus Y.G.57.14] gi|228010542|gb|ACP46304.1| protein of unknown function DUF343 [Sulfolobus islandicus Y.G.57.14] Length = 124 Score = 43.3 bits (102), Expect = 0.012, Method: Composition-based stats. Identities = 8/33 (24%), Positives = 15/33 (45%) Query: 31 GTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 L + + YPI +P ML + R+ ++ Sbjct: 67 EGVLYCESCNRWYPIIDEIPRMLPDKLRKEEED 99 >gi|227828190|ref|YP_002829970.1| hypothetical protein M1425_1928 [Sulfolobus islandicus M.14.25] gi|227830949|ref|YP_002832729.1| protein of unknown function DUF343 [Sulfolobus islandicus L.S.2.15] gi|229581513|ref|YP_002839912.1| protein of unknown function DUF343 [Sulfolobus islandicus Y.N.15.51] gi|229585419|ref|YP_002843921.1| hypothetical protein M1627_2006 [Sulfolobus islandicus M.16.27] gi|238620381|ref|YP_002915207.1| protein of unknown function DUF343 [Sulfolobus islandicus M.16.4] gi|227457397|gb|ACP36084.1| protein of unknown function DUF343 [Sulfolobus islandicus L.S.2.15] gi|227459986|gb|ACP38672.1| protein of unknown function DUF343 [Sulfolobus islandicus M.14.25] gi|228012229|gb|ACP47990.1| protein of unknown function DUF343 [Sulfolobus islandicus Y.N.15.51] gi|228020469|gb|ACP55876.1| protein of unknown function DUF343 [Sulfolobus islandicus M.16.27] gi|238381451|gb|ACR42539.1| protein of unknown function DUF343 [Sulfolobus islandicus M.16.4] gi|323475257|gb|ADX85863.1| conserved hypothetical protein [Sulfolobus islandicus REY15A] gi|323477982|gb|ADX83220.1| conserved hypothetical protein [Sulfolobus islandicus HVE10/4] Length = 129 Score = 43.3 bits (102), Expect = 0.012, Method: Composition-based stats. Identities = 8/33 (24%), Positives = 15/33 (45%) Query: 31 GTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 L + + YPI +P ML + R+ ++ Sbjct: 72 EGVLYCESCNRWYPIIDEIPRMLPDKLRKEEED 104 >gi|225452543|ref|XP_002280169.1| PREDICTED: hypothetical protein [Vitis vinifera] gi|296087709|emb|CBI34965.3| unnamed protein product [Vitis vinifera] Length = 122 Score = 42.9 bits (101), Expect = 0.013, Method: Composition-based stats. Identities = 10/35 (28%), Positives = 16/35 (45%) Query: 22 KGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L L E L+ + +P+ G+P ML+ E Sbjct: 85 HALLELHLEEGALICPETGRRFPVNKGIPNMLLHE 119 >gi|220912039|ref|YP_002487348.1| hypothetical protein Achl_1268 [Arthrobacter chlorophenolicus A6] gi|219858917|gb|ACL39259.1| protein of unknown function DUF343 [Arthrobacter chlorophenolicus A6] Length = 78 Score = 42.9 bits (101), Expect = 0.014, Method: Composition-based stats. Identities = 16/50 (32%), Positives = 23/50 (46%), Gaps = 7/50 (14%) Query: 5 IFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASL-----AYPIRSGV 49 + I +LL +L CP+T L EG EL++ A Y I G+ Sbjct: 1 MPKISSELLSVLRCPVTGSPLV--QEGEELVATAAGADGVKPRYAIEDGI 48 >gi|17531497|ref|NP_497021.1| hypothetical protein C04H5.1 [Caenorhabditis elegans] gi|47606061|sp|O45241|TR112_CAEEL RecName: Full=TRM112-like protein gi|3873940|emb|CAB03840.1| C. elegans protein C04H5.1, confirmed by transcript evidence [Caenorhabditis elegans] Length = 125 Score = 42.9 bits (101), Expect = 0.015, Method: Composition-based stats. Identities = 10/32 (31%), Positives = 16/32 (50%) Query: 28 ISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 EL+ + +PIR G+P ML +A + Sbjct: 94 DVIDGELICPETKTVFPIRDGIPNMLKVDAEK 125 >gi|308502554|ref|XP_003113461.1| hypothetical protein CRE_26348 [Caenorhabditis remanei] gi|308263420|gb|EFP07373.1| hypothetical protein CRE_26348 [Caenorhabditis remanei] Length = 125 Score = 42.9 bits (101), Expect = 0.016, Method: Composition-based stats. Identities = 10/32 (31%), Positives = 16/32 (50%) Query: 28 ISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 EL+ + +PIR G+P ML +A + Sbjct: 94 DVVDGELICPETKTVFPIRDGIPNMLKVDAEK 125 >gi|313126852|ref|YP_004037122.1| hypothetical protein Hbor_21130 [Halogeometricum borinquense DSM 11551] gi|312293217|gb|ADQ67677.1| uncharacterized conserved protein [Halogeometricum borinquense DSM 11551] Length = 62 Score = 42.9 bits (101), Expect = 0.016, Method: Composition-based stats. Identities = 17/60 (28%), Positives = 29/60 (48%), Gaps = 8/60 (13%) Query: 8 IDPQLLEILVCPLTKGNLTL---ISEGTELLSKKA-----SLAYPIRSGVPIMLVSEARQ 59 + L++IL PL K +L L +G E+++ + YPI G+P +L + R Sbjct: 1 MKESLMDILCDPLDKSDLELKVTERDGDEIITGRLVGTVTGEEYPIEDGIPNLLPPDMRD 60 >gi|256827938|ref|YP_003156666.1| type 11 methyltransferase [Desulfomicrobium baculatum DSM 4028] gi|256577114|gb|ACU88250.1| Methyltransferase type 11 [Desulfomicrobium baculatum DSM 4028] Length = 363 Score = 42.9 bits (101), Expect = 0.016, Method: Composition-based stats. Identities = 12/47 (25%), Positives = 14/47 (29%), Gaps = 8/47 (17%) Query: 16 LVCPLTKGNLTLIS--------EGTELLSKKASLAYPIRSGVPIMLV 54 L CP G L L L YPI +P M+ Sbjct: 9 LRCPACYGALALDIFDKTTAGIREGLLTCGACGTVYPIAQHIPRMVP 55 >gi|145341533|ref|XP_001415861.1| predicted protein [Ostreococcus lucimarinus CCE9901] gi|144576084|gb|ABO94153.1| predicted protein [Ostreococcus lucimarinus CCE9901] Length = 122 Score = 42.9 bits (101), Expect = 0.017, Method: Composition-based stats. Identities = 10/35 (28%), Positives = 18/35 (51%) Query: 22 KGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + E L+ ++ +PI G+P ML++E Sbjct: 85 HALLEVHVEEGTLVCPESGRKFPINKGIPNMLLNE 119 >gi|303274338|ref|XP_003056490.1| methyltransferase-associated protein [Micromonas pusilla CCMP1545] gi|226462574|gb|EEH59866.1| methyltransferase-associated protein [Micromonas pusilla CCMP1545] Length = 123 Score = 42.5 bits (100), Expect = 0.017, Method: Composition-based stats. Identities = 8/35 (22%), Positives = 18/35 (51%) Query: 22 KGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + + L+ + +P+R G+P M+++E Sbjct: 85 HALLEIEVQEGYLICPETGRRFPVRKGIPNMMLNE 119 >gi|292655289|ref|YP_003535186.1| hypothetical protein HVO_1131 [Haloferax volcanii DS2] gi|291371385|gb|ADE03612.1| Protein of unknown function (DUF343) superfamily [Haloferax volcanii DS2] Length = 61 Score = 42.5 bits (100), Expect = 0.017, Method: Composition-based stats. Identities = 16/60 (26%), Positives = 24/60 (40%), Gaps = 8/60 (13%) Query: 8 IDPQLLEILVCPLTKGNLTLISEG--------TELLSKKASLAYPIRSGVPIMLVSEARQ 59 + L++IL PL K L L + L+ YPI G+P +L + R Sbjct: 1 MKESLMDILCDPLDKSELELEVDERDGDEIIEGRLIGTVTGEVYPIEDGIPNLLPPDMRD 60 >gi|258597640|ref|XP_001348245.2| nucleolar preribosomal GTPase, putative [Plasmodium falciparum 3D7] gi|255528763|gb|AAN36684.2| nucleolar preribosomal GTPase, putative [Plasmodium falciparum 3D7] Length = 125 Score = 42.5 bits (100), Expect = 0.017, Method: Composition-based stats. Identities = 8/23 (34%), Positives = 15/23 (65%) Query: 31 GTELLSKKASLAYPIRSGVPIML 53 L+ K ++++PI+ G+P ML Sbjct: 98 EGSLVCPKCNISFPIKDGIPNML 120 >gi|156102362|ref|XP_001616874.1| hypothetical protein [Plasmodium vivax SaI-1] gi|148805748|gb|EDL47147.1| hypothetical protein, conserved [Plasmodium vivax] Length = 95 Score = 42.5 bits (100), Expect = 0.018, Method: Composition-based stats. Identities = 9/20 (45%), Positives = 14/20 (70%) Query: 34 LLSKKASLAYPIRSGVPIML 53 L+ K + A+PI+ G+P ML Sbjct: 68 LICPKCNTAFPIKDGIPNML 87 >gi|326534278|dbj|BAJ89489.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 133 Score = 42.5 bits (100), Expect = 0.018, Method: Composition-based stats. Identities = 12/39 (30%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Query: 22 KGNLTLISEGTELLSKKASLAYPIRSGVPIML--VSEAR 58 L + E L+ + ++PI GVP ML E R Sbjct: 94 HALLEIHVEEGTLVCPDSGRSFPILKGVPNMLLHEDEVR 132 >gi|144897487|emb|CAM74351.1| conserved hypothetical protein [Magnetospirillum gryphiswaldense MSR-1] Length = 327 Score = 42.5 bits (100), Expect = 0.020, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 21/53 (39%), Gaps = 10/53 (18%) Query: 8 IDPQLLEILVCPLTKGN--LTLISE--------GTELLSKKASLAYPIRSGVP 50 + LL++LVCP G LTL + L +P+R VP Sbjct: 1 MRRWLLDLLVCPHCVGEQALTLTVDWAMDDEIIDGSLECPHCRAKWPVRDAVP 53 >gi|255037588|ref|YP_003088209.1| Methyltransferase type 11 [Dyadobacter fermentans DSM 18053] gi|254950344|gb|ACT95044.1| Methyltransferase type 11 [Dyadobacter fermentans DSM 18053] Length = 293 Score = 42.5 bits (100), Expect = 0.020, Method: Composition-based stats. Identities = 18/57 (31%), Positives = 27/57 (47%), Gaps = 8/57 (14%) Query: 10 PQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRS-GVPIM------LVSEARQ 59 + LE LVCP+T LT+ +G L S + Y + G+ M L +AR+ Sbjct: 4 QEFLESLVCPITGTPLTIAEDGKSLKS-EDGTVYEVGDTGIVNMLYPKELLPEDARE 59 >gi|87311613|ref|ZP_01093731.1| hypothetical protein DSM3645_25037 [Blastopirellula marina DSM 3645] gi|87285735|gb|EAQ77651.1| hypothetical protein DSM3645_25037 [Blastopirellula marina DSM 3645] Length = 313 Score = 42.5 bits (100), Expect = 0.021, Method: Composition-based stats. Identities = 16/50 (32%), Positives = 23/50 (46%), Gaps = 1/50 (2%) Query: 13 LEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 L++L CP+ L + S YP GVPI L++EA + D Sbjct: 5 LDVLDCPICGQALIHQDDTLACESPTCGHVYPTSRGVPI-LINEANSIFD 53 >gi|324503185|gb|ADY41388.1| tRNA methyltransferase 112 [Ascaris suum] Length = 125 Score = 42.1 bits (99), Expect = 0.022, Method: Composition-based stats. Identities = 12/32 (37%), Positives = 18/32 (56%) Query: 25 LTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L++ EL + +PIR G+P MLV+E Sbjct: 90 LSVEVIEGELKCPETGRIFPIREGIPNMLVNE 121 >gi|156550368|ref|XP_001607595.1| PREDICTED: hypothetical protein [Nasonia vitripennis] Length = 124 Score = 42.1 bits (99), Expect = 0.023, Method: Composition-based stats. Identities = 11/32 (34%), Positives = 18/32 (56%) Query: 25 LTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + ELL ++ +PI G+P ML++E Sbjct: 90 LEVEIINGELLCPESGRKFPISDGIPNMLLNE 121 >gi|255579320|ref|XP_002530505.1| Protein trm112, putative [Ricinus communis] gi|223529962|gb|EEF31889.1| Protein trm112, putative [Ricinus communis] Length = 122 Score = 42.1 bits (99), Expect = 0.027, Method: Composition-based stats. Identities = 9/35 (25%), Positives = 16/35 (45%) Query: 22 KGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + E L+ + +P+ G+P ML+ E Sbjct: 85 HALLEVDLEEGALICPETGRKFPVNKGIPNMLLHE 119 >gi|268680836|ref|YP_003305267.1| methyltransferase type 11 [Sulfurospirillum deleyianum DSM 6946] gi|268618867|gb|ACZ13232.1| Methyltransferase type 11 [Sulfurospirillum deleyianum DSM 6946] Length = 314 Score = 42.1 bits (99), Expect = 0.028, Method: Composition-based stats. Identities = 11/57 (19%), Positives = 20/57 (35%), Gaps = 8/57 (14%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTE--------LLSKKASLAYPIRSGVPIMLVSE 56 + + LE LVCP + + L E L ++ I +P + + Sbjct: 1 MHKKALEYLVCPSCQSDFELKDVVEESGCIKEGKLFCPSCQASFKIHHFIPRFVEDQ 57 >gi|85860854|ref|YP_463057.1| putative cytoplasmic protein [Syntrophus aciditrophicus SB] gi|85723945|gb|ABC78888.1| hypothetical cytosolic protein [Syntrophus aciditrophicus SB] Length = 319 Score = 41.8 bits (98), Expect = 0.029, Method: Composition-based stats. Identities = 14/59 (23%), Positives = 22/59 (37%), Gaps = 11/59 (18%) Query: 8 IDPQLLEILVCPLTK------GNLTLISEGTE-----LLSKKASLAYPIRSGVPIMLVS 55 + LL+IL+CP ++ L + TE L YPI G+ + Sbjct: 8 MKKILLDILICPRCLPEEIRLSDVALETSSTEILKGRLHCGNCGTDYPIEEGIAFLEPD 66 >gi|116782770|gb|ABK22651.1| unknown [Picea sitchensis] Length = 122 Score = 41.8 bits (98), Expect = 0.031, Method: Composition-based stats. Identities = 10/35 (28%), Positives = 16/35 (45%) Query: 22 KGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L L E L+ + +P+ G+P ML+ E Sbjct: 85 HALLELHLEEGALICPETGRRFPVNKGIPNMLLHE 119 >gi|116785625|gb|ABK23797.1| unknown [Picea sitchensis] Length = 122 Score = 41.8 bits (98), Expect = 0.031, Method: Composition-based stats. Identities = 10/35 (28%), Positives = 16/35 (45%) Query: 22 KGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L L E L+ + +P+ G+P ML+ E Sbjct: 85 HALLELHLEEGALICPETGRRFPVNKGIPNMLLHE 119 >gi|167524745|ref|XP_001746708.1| hypothetical protein [Monosiga brevicollis MX1] gi|163774978|gb|EDQ88604.1| predicted protein [Monosiga brevicollis MX1] Length = 123 Score = 41.8 bits (98), Expect = 0.033, Method: Composition-based stats. Identities = 14/50 (28%), Positives = 21/50 (42%), Gaps = 12/50 (24%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 + LLE+LV EL + +PI+ G+P ML+ E Sbjct: 83 AMHHVLLEVLV------------LEGELECPETGRKFPIKKGIPNMLLDE 120 >gi|326428851|gb|EGD74421.1| hypothetical protein PTSG_11519 [Salpingoeca sp. ATCC 50818] Length = 126 Score = 41.8 bits (98), Expect = 0.034, Method: Composition-based stats. Identities = 11/32 (34%), Positives = 17/32 (53%) Query: 25 LTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + EL A+PI+ G+P ML++E Sbjct: 92 LEIEVIEGELECPDTGRAFPIKRGIPNMLLNE 123 >gi|159904670|ref|YP_001548332.1| hypothetical protein MmarC6_0279 [Methanococcus maripaludis C6] gi|159886163|gb|ABX01100.1| hypothetical protein MmarC6_0279 [Methanococcus maripaludis C6] Length = 48 Score = 41.8 bits (98), Expect = 0.037, Method: Composition-based stats. Identities = 13/50 (26%), Positives = 21/50 (42%), Gaps = 2/50 (4%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVS 55 +L+++L C KG L L L K Y I+ +P++L Sbjct: 1 MKWLKELIDLLECSKCKGELMLFD--NRLCCKNCKKIYLIKDKIPVLLDE 48 >gi|320162180|ref|YP_004175405.1| hypothetical protein ANT_27790 [Anaerolinea thermophila UNI-1] gi|319996034|dbj|BAJ64805.1| hypothetical protein ANT_27790 [Anaerolinea thermophila UNI-1] Length = 295 Score = 41.4 bits (97), Expect = 0.039, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 12/33 (36%), Gaps = 1/33 (3%) Query: 17 VCPLTKGNLTLISEGTELLSKKASLAYPIRSGV 49 CP L E+L YP+R G+ Sbjct: 255 RCPACGQE-GLADTPPEILCPSCGQRYPVRDGI 286 >gi|309356133|emb|CAP37812.2| hypothetical protein CBG_20872 [Caenorhabditis briggsae AF16] Length = 125 Score = 41.4 bits (97), Expect = 0.040, Method: Composition-based stats. Identities = 9/26 (34%), Positives = 13/26 (50%) Query: 28 ISEGTELLSKKASLAYPIRSGVPIML 53 EL+ + +PIR G+P ML Sbjct: 94 DVVDGELICPETKTVFPIRDGIPNML 119 >gi|255630635|gb|ACU15677.1| unknown [Glycine max] Length = 122 Score = 41.4 bits (97), Expect = 0.041, Method: Composition-based stats. Identities = 10/35 (28%), Positives = 16/35 (45%) Query: 22 KGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L L E L+ + +P+ G+P ML+ E Sbjct: 85 HALLELHLEEGVLVCPETGRRFPVSKGIPNMLLHE 119 >gi|116748685|ref|YP_845372.1| type 11 methyltransferase [Syntrophobacter fumaroxidans MPOB] gi|116697749|gb|ABK16937.1| Methyltransferase type 11 [Syntrophobacter fumaroxidans MPOB] Length = 322 Score = 41.4 bits (97), Expect = 0.044, Method: Composition-based stats. Identities = 14/58 (24%), Positives = 21/58 (36%), Gaps = 11/58 (18%) Query: 8 IDPQLLEILVCP--------LTKGNLTLISEG---TELLSKKASLAYPIRSGVPIMLV 54 + P L+E+LVCP L + E L +PI G ++L Sbjct: 1 MKPFLVEMLVCPSCLPEEVGLCLTTVEADDEEVIRGSLACPSCREIFPIAEGTAVILP 58 >gi|169635176|gb|ACA58363.1| hypothetical protein [Arachis diogoi] Length = 101 Score = 41.4 bits (97), Expect = 0.047, Method: Composition-based stats. Identities = 10/35 (28%), Positives = 16/35 (45%) Query: 22 KGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L L E L+ + +P+ G+P ML+ E Sbjct: 64 HALLELHLEEGALVCPETGRRFPVNKGIPNMLLHE 98 >gi|325962632|ref|YP_004240538.1| hypothetical protein Asphe3_12250 [Arthrobacter phenanthrenivorans Sphe3] gi|323468719|gb|ADX72404.1| hypothetical protein Asphe3_12250 [Arthrobacter phenanthrenivorans Sphe3] Length = 75 Score = 41.0 bits (96), Expect = 0.059, Method: Composition-based stats. Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 7/50 (14%) Query: 5 IFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKA-----SLAYPIRSGV 49 + I P+LL +L CP+T L EG EL++ A Y I G+ Sbjct: 1 MPKISPELLSVLRCPVTGSALV--QEGEELVAAVAAESGVKPRYAIEDGI 48 >gi|242309488|ref|ZP_04808643.1| 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Helicobacter pullorum MIT 98-5489] gi|239524059|gb|EEQ63925.1| 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Helicobacter pullorum MIT 98-5489] Length = 325 Score = 41.0 bits (96), Expect = 0.061, Method: Composition-based stats. Identities = 14/42 (33%), Positives = 18/42 (42%), Gaps = 8/42 (19%) Query: 16 LVCPLTKGNLTLI--SEGTELL------SKKASLAYPIRSGV 49 +VCP KG L L E E + KK +Y I G+ Sbjct: 1 MVCPKCKGKLILESLEENKEFVKEGSLECKKCKKSYKITRGI 42 >gi|158520142|ref|YP_001528012.1| hypothetical protein Dole_0125 [Desulfococcus oleovorans Hxd3] gi|158508968|gb|ABW65935.1| protein of unknown function DUF343 [Desulfococcus oleovorans Hxd3] Length = 339 Score = 40.6 bits (95), Expect = 0.068, Method: Composition-based stats. Identities = 15/60 (25%), Positives = 23/60 (38%), Gaps = 12/60 (20%) Query: 12 LLEILVCPLT----KG-NLTLISE------GTELLSKKASLAYPIRSGVPIMLV-SEARQ 59 L E+L+CP+ G L +L ++PIR G+ + EAR Sbjct: 32 LTELLICPVCLPGEHGLKLKSDETVADDIIRGDLTCDCCGRSFPIRDGLADLDPGREARS 91 >gi|297842593|ref|XP_002889178.1| hypothetical protein ARALYDRAFT_895712 [Arabidopsis lyrata subsp. lyrata] gi|297335019|gb|EFH65437.1| hypothetical protein ARALYDRAFT_895712 [Arabidopsis lyrata subsp. lyrata] Length = 124 Score = 40.6 bits (95), Expect = 0.072, Method: Composition-based stats. Identities = 10/35 (28%), Positives = 16/35 (45%) Query: 22 KGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L L E L+ + +P+ G+P ML+ E Sbjct: 87 HALLELHLEEGSLVCPETGRKFPVNKGIPNMLLHE 121 >gi|255523734|ref|ZP_05390700.1| Methyltransferase type 11 [Clostridium carboxidivorans P7] gi|296186738|ref|ZP_06855140.1| methyltransferase domain protein [Clostridium carboxidivorans P7] gi|255512603|gb|EET88877.1| Methyltransferase type 11 [Clostridium carboxidivorans P7] gi|296048775|gb|EFG88207.1| methyltransferase domain protein [Clostridium carboxidivorans P7] Length = 306 Score = 40.6 bits (95), Expect = 0.076, Method: Composition-based stats. Identities = 9/40 (22%), Positives = 14/40 (35%), Gaps = 2/40 (5%) Query: 18 CPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEA 57 CP+ K L + S +PI +P + A Sbjct: 260 CPICKKELIKSDGNY--FCEDCSTIFPIIKNIPCLTTDSA 297 >gi|156741736|ref|YP_001431865.1| type 11 methyltransferase [Roseiflexus castenholzii DSM 13941] gi|156233064|gb|ABU57847.1| Methyltransferase type 11 [Roseiflexus castenholzii DSM 13941] Length = 276 Score = 40.6 bits (95), Expect = 0.079, Method: Composition-based stats. Identities = 16/50 (32%), Positives = 19/50 (38%), Gaps = 8/50 (16%) Query: 12 LLEILVCPLTKGNLTL----ISEGTELLS----KKASLAYPIRSGVPIML 53 LL L CP G L L E++S YPIR G+ L Sbjct: 5 LLPDLRCPTCAGALDLGDARRDAAGEIISGALRCACGAVYPIRDGIADFL 54 >gi|302686718|ref|XP_003033039.1| hypothetical protein SCHCODRAFT_15141 [Schizophyllum commune H4-8] gi|300106733|gb|EFI98136.1| hypothetical protein SCHCODRAFT_15141 [Schizophyllum commune H4-8] Length = 123 Score = 40.6 bits (95), Expect = 0.079, Method: Composition-based stats. Identities = 13/50 (26%), Positives = 22/50 (44%), Gaps = 4/50 (8%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 +D + L+ L L + E + YPI +G+P ML++E Sbjct: 74 MMDDEFLQALH----HVLLEIHVEEGVMTCPNCGHKYPISNGIPNMLLAE 119 >gi|225713650|gb|ACO12671.1| TRM112-like protein [Lepeophtheirus salmonis] gi|290462467|gb|ADD24281.1| TRM112-like protein [Lepeophtheirus salmonis] gi|290462543|gb|ADD24319.1| TRM112-like protein [Lepeophtheirus salmonis] gi|290561577|gb|ADD38188.1| TRM112-like protein [Lepeophtheirus salmonis] Length = 124 Score = 40.6 bits (95), Expect = 0.079, Method: Composition-based stats. Identities = 9/32 (28%), Positives = 17/32 (53%) Query: 25 LTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + +L+ + +PI G+P ML++E Sbjct: 90 LEIEVINGDLVCPETGRKFPITDGIPNMLLNE 121 >gi|302833245|ref|XP_002948186.1| hypothetical protein VOLCADRAFT_73677 [Volvox carteri f. nagariensis] gi|300266406|gb|EFJ50593.1| hypothetical protein VOLCADRAFT_73677 [Volvox carteri f. nagariensis] Length = 123 Score = 40.2 bits (94), Expect = 0.086, Method: Composition-based stats. Identities = 9/35 (25%), Positives = 17/35 (48%) Query: 22 KGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + E L+ + +P+ G+P ML++E Sbjct: 86 HALLEVTLEEGSLICPETGRKFPVSKGIPNMLLNE 120 >gi|159465733|ref|XP_001691077.1| predicted protein [Chlamydomonas reinhardtii] gi|158279763|gb|EDP05523.1| predicted protein [Chlamydomonas reinhardtii] Length = 132 Score = 40.2 bits (94), Expect = 0.087, Method: Composition-based stats. Identities = 9/35 (25%), Positives = 17/35 (48%) Query: 22 KGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + E L+ + +P+ G+P ML++E Sbjct: 95 HALLEVFLEEGSLVCPETGRKFPVTKGIPNMLLNE 129 >gi|328792738|ref|XP_001119891.2| PREDICTED: tRNA methyltransferase 112 homolog [Apis mellifera] Length = 124 Score = 40.2 bits (94), Expect = 0.089, Method: Composition-based stats. Identities = 10/32 (31%), Positives = 18/32 (56%) Query: 25 LTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + +LL ++ +PI G+P ML++E Sbjct: 90 LEVEIINGDLLCPESGRKFPINDGIPNMLLNE 121 >gi|168020978|ref|XP_001763019.1| predicted protein [Physcomitrella patens subsp. patens] gi|162685831|gb|EDQ72224.1| predicted protein [Physcomitrella patens subsp. patens] Length = 122 Score = 40.2 bits (94), Expect = 0.099, Method: Composition-based stats. Identities = 10/35 (28%), Positives = 17/35 (48%) Query: 22 KGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + E L+ + +P+ GVP ML++E Sbjct: 85 HALLEVHLEEGALICPETGRRFPVTKGVPNMLLNE 119 >gi|170109512|ref|XP_001885963.1| predicted protein [Laccaria bicolor S238N-H82] gi|164639234|gb|EDR03507.1| predicted protein [Laccaria bicolor S238N-H82] Length = 123 Score = 40.2 bits (94), Expect = 0.10, Method: Composition-based stats. Identities = 10/32 (31%), Positives = 17/32 (53%) Query: 25 LTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + E ++ YPI +G+P ML++E Sbjct: 88 LEVHVEEGSMICPNCKHDYPISNGIPNMLLAE 119 >gi|307188152|gb|EFN72984.1| TRM112-like protein [Camponotus floridanus] Length = 124 Score = 40.2 bits (94), Expect = 0.11, Method: Composition-based stats. Identities = 10/32 (31%), Positives = 18/32 (56%) Query: 25 LTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + +LL ++ +PI G+P ML++E Sbjct: 90 LEVEVINGDLLCPESGRKFPINDGIPNMLLNE 121 >gi|332024529|gb|EGI64727.1| TRM112-like protein [Acromyrmex echinatior] Length = 124 Score = 39.8 bits (93), Expect = 0.11, Method: Composition-based stats. Identities = 10/32 (31%), Positives = 18/32 (56%) Query: 25 LTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + +LL ++ +PI G+P ML++E Sbjct: 90 LEVEVINGDLLCPESGRKFPINDGIPNMLLNE 121 >gi|313236947|emb|CBY12194.1| unnamed protein product [Oikopleura dioica] gi|313241310|emb|CBY33586.1| unnamed protein product [Oikopleura dioica] Length = 123 Score = 39.8 bits (93), Expect = 0.11, Method: Composition-based stats. Identities = 8/35 (22%), Positives = 20/35 (57%) Query: 22 KGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + +L+ ++ +P+++G+P ML++E Sbjct: 86 HALLEVEMVEGKLVCPESGREFPVKNGIPNMLLNE 120 >gi|291225563|ref|XP_002732752.1| PREDICTED: tRNA methyltransferase 11-2 homolog [Saccoglossus kowalevskii] Length = 131 Score = 39.8 bits (93), Expect = 0.12, Method: Composition-based stats. Identities = 8/26 (30%), Positives = 16/26 (61%) Query: 31 GTELLSKKASLAYPIRSGVPIMLVSE 56 L+ ++ +PI +G+P ML++E Sbjct: 103 EGSLVCPESGRKFPISNGIPNMLLNE 128 >gi|225718454|gb|ACO15073.1| TRM112-like protein [Caligus clemensi] Length = 124 Score = 39.8 bits (93), Expect = 0.12, Method: Composition-based stats. Identities = 9/32 (28%), Positives = 17/32 (53%) Query: 25 LTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + +L+ + +PI G+P ML++E Sbjct: 90 LEIEVINGDLVCPETGRKFPIADGIPNMLLNE 121 >gi|170085617|ref|XP_001874032.1| predicted protein [Laccaria bicolor S238N-H82] gi|164651584|gb|EDR15824.1| predicted protein [Laccaria bicolor S238N-H82] Length = 123 Score = 39.8 bits (93), Expect = 0.12, Method: Composition-based stats. Identities = 10/32 (31%), Positives = 17/32 (53%) Query: 25 LTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + E ++ YPI +G+P ML++E Sbjct: 88 LEIHVEEGSMICPNCKHDYPISNGIPNMLLAE 119 >gi|218883325|ref|YP_002427707.1| hypothetical protein DKAM_0011 [Desulfurococcus kamchatkensis 1221n] gi|218764941|gb|ACL10340.1| hypothetical protein DKAM_0011 [Desulfurococcus kamchatkensis 1221n] Length = 96 Score = 39.8 bits (93), Expect = 0.13, Method: Composition-based stats. Identities = 8/43 (18%), Positives = 16/43 (37%) Query: 21 TKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 + L + + L YP+++G+ ML R + Sbjct: 21 CQECLRIGIKTAVLYCTSCGRWYPVKNGIVYMLTDNRRNLSSD 63 >gi|307208662|gb|EFN85952.1| TRM112-like protein [Harpegnathos saltator] Length = 124 Score = 39.8 bits (93), Expect = 0.14, Method: Composition-based stats. Identities = 10/32 (31%), Positives = 17/32 (53%) Query: 25 LTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + +LL ++ +PI G+P ML+ E Sbjct: 90 LEVEVINGDLLCPESGRKFPINDGIPNMLLHE 121 >gi|218295042|ref|ZP_03495878.1| Methyltransferase type 11 [Thermus aquaticus Y51MC23] gi|218244245|gb|EED10770.1| Methyltransferase type 11 [Thermus aquaticus Y51MC23] Length = 237 Score = 39.8 bits (93), Expect = 0.14, Method: Composition-based stats. Identities = 13/43 (30%), Positives = 15/43 (34%), Gaps = 3/43 (6%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSG 48 P L +L CP + L L E L YP R G Sbjct: 1 MRFLPWLSPLLACPRCRAGLLLGEEA---LCPACGAHYPWRGG 40 >gi|302761876|ref|XP_002964360.1| hypothetical protein SELMODRAFT_438712 [Selaginella moellendorffii] gi|302769043|ref|XP_002967941.1| hypothetical protein SELMODRAFT_88231 [Selaginella moellendorffii] gi|300164679|gb|EFJ31288.1| hypothetical protein SELMODRAFT_88231 [Selaginella moellendorffii] gi|300168089|gb|EFJ34693.1| hypothetical protein SELMODRAFT_438712 [Selaginella moellendorffii] Length = 122 Score = 39.8 bits (93), Expect = 0.14, Method: Composition-based stats. Identities = 9/35 (25%), Positives = 18/35 (51%) Query: 22 KGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + E +L+ + +P+ G+P ML++E Sbjct: 85 HALLEIHLEEGDLVCPETGRKFPVAKGIPNMLLNE 119 >gi|156407864|ref|XP_001641577.1| predicted protein [Nematostella vectensis] gi|156228716|gb|EDO49514.1| predicted protein [Nematostella vectensis] Length = 123 Score = 39.8 bits (93), Expect = 0.14, Method: Composition-based stats. Identities = 7/32 (21%), Positives = 19/32 (59%) Query: 25 LTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + + +L+ + +P+ +G+P ML+++ Sbjct: 89 LEVEVQEGQLICPETGRKFPVTNGIPNMLLND 120 >gi|255070829|ref|XP_002507496.1| methyltransferase-associated protein [Micromonas sp. RCC299] gi|226522771|gb|ACO68754.1| methyltransferase-associated protein [Micromonas sp. RCC299] Length = 123 Score = 39.5 bits (92), Expect = 0.14, Method: Composition-based stats. Identities = 8/35 (22%), Positives = 16/35 (45%) Query: 22 KGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 + + + L+ +PI G+P ML++E Sbjct: 85 HALMEVHVKEGYLICPDTGRRFPITKGIPNMLLNE 119 >gi|224082123|ref|XP_002306574.1| predicted protein [Populus trichocarpa] gi|222856023|gb|EEE93570.1| predicted protein [Populus trichocarpa] Length = 115 Score = 39.5 bits (92), Expect = 0.17, Method: Composition-based stats. Identities = 10/35 (28%), Positives = 15/35 (42%) Query: 22 KGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L L E L + +P+ G+P ML+ E Sbjct: 78 HALLELHLEEGALTCPETGRKFPVTKGIPNMLLHE 112 >gi|126465831|ref|YP_001040940.1| zinc finger TFIIB-type domain-containing protein [Staphylothermus marinus F1] gi|126014654|gb|ABN70032.1| Zinc finger, TFIIB-type domain protein [Staphylothermus marinus F1] Length = 199 Score = 39.5 bits (92), Expect = 0.18, Method: Composition-based stats. Identities = 8/32 (25%), Positives = 13/32 (40%), Gaps = 3/32 (9%) Query: 18 CPLTKGNLTLISEGTELLSKKASLAYPIRSGV 49 CP+ G L E E++ K L + + Sbjct: 5 CPVCGGTLIWDYESGEVVCSKCGL---VVDKI 33 >gi|242209466|ref|XP_002470580.1| predicted protein [Postia placenta Mad-698-R] gi|220730374|gb|EED84232.1| predicted protein [Postia placenta Mad-698-R] Length = 123 Score = 39.1 bits (91), Expect = 0.19, Method: Composition-based stats. Identities = 10/32 (31%), Positives = 18/32 (56%) Query: 25 LTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + E ++ + YPI +G+P ML++E Sbjct: 88 LEIHIEEGAMVCPNCAHVYPISNGIPNMLLAE 119 >gi|119509825|ref|ZP_01628969.1| hypothetical protein N9414_07009 [Nodularia spumigena CCY9414] gi|119465560|gb|EAW46453.1| hypothetical protein N9414_07009 [Nodularia spumigena CCY9414] Length = 347 Score = 39.1 bits (91), Expect = 0.19, Method: Composition-based stats. Identities = 12/38 (31%), Positives = 19/38 (50%), Gaps = 2/38 (5%) Query: 15 ILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIM 52 +L CP+TK L L L+S+ Y + G+P + Sbjct: 229 LLACPITKQPLHLQD--NSLVSENGKFIYGFQQGIPYL 264 >gi|321478058|gb|EFX89016.1| hypothetical protein DAPPUDRAFT_230231 [Daphnia pulex] Length = 124 Score = 39.1 bits (91), Expect = 0.22, Method: Composition-based stats. Identities = 7/26 (26%), Positives = 14/26 (53%) Query: 31 GTELLSKKASLAYPIRSGVPIMLVSE 56 +L+ + +P+ G+P ML +E Sbjct: 96 NGDLICPETGRKFPVTDGIPNMLANE 121 >gi|189424945|ref|YP_001952122.1| methyltransferase type 11 [Geobacter lovleyi SZ] gi|189421204|gb|ACD95602.1| Methyltransferase type 11 [Geobacter lovleyi SZ] Length = 313 Score = 39.1 bits (91), Expect = 0.22, Method: Composition-based stats. Identities = 13/63 (20%), Positives = 22/63 (34%), Gaps = 13/63 (20%) Query: 8 IDPQLLEILVCPLT--KG-NL------TLISE--GTELLSKKASLAYPIRSGVPIML--V 54 + LL L+CP K L L E L + +P++ G+ ++ Sbjct: 1 MKRILLPHLICPTCLPKEYPLQPSITKELDGEIETGLLTCPRCRQDFPVQDGIANLVSNP 60 Query: 55 SEA 57 A Sbjct: 61 DSA 63 >gi|21358217|ref|NP_649293.1| CG12975 [Drosophila melanogaster] gi|47606220|sp|Q9VP65|TR112_DROME RecName: Full=TRM112-like protein gi|7296402|gb|AAF51690.1| CG12975 [Drosophila melanogaster] gi|17946242|gb|AAL49161.1| RE57810p [Drosophila melanogaster] gi|220948610|gb|ACL86848.1| CG12975-PA [synthetic construct] gi|220958044|gb|ACL91565.1| CG12975-PA [synthetic construct] Length = 124 Score = 39.1 bits (91), Expect = 0.23, Method: Composition-based stats. Identities = 8/31 (25%), Positives = 15/31 (48%) Query: 26 TLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 + +L + +PI G+P ML++E Sbjct: 91 EIDVLEGQLECPETGRVFPISDGIPNMLLNE 121 >gi|51246944|ref|YP_066828.1| hypothetical protein DP3092 [Desulfotalea psychrophila LSv54] gi|50877981|emb|CAG37821.1| unknown protein [Desulfotalea psychrophila LSv54] Length = 300 Score = 39.1 bits (91), Expect = 0.23, Method: Composition-based stats. Identities = 9/38 (23%), Positives = 13/38 (34%), Gaps = 3/38 (7%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAY 43 I P + IL+CP + L E + Y Sbjct: 1 MTISPSIKNILICPSCQSPLQFGDETS---CPNCGARY 35 >gi|169843333|ref|XP_001828396.1| trm112 [Coprinopsis cinerea okayama7#130] gi|116510493|gb|EAU93388.1| trm112 [Coprinopsis cinerea okayama7#130] Length = 123 Score = 39.1 bits (91), Expect = 0.23, Method: Composition-based stats. Identities = 11/32 (34%), Positives = 17/32 (53%) Query: 25 LTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + E ++ YPI SG+P ML++E Sbjct: 88 LEIHVEEGAMVCPNCKHEYPISSGIPNMLLAE 119 >gi|218132273|ref|ZP_03461077.1| hypothetical protein BACPEC_00130 [Bacteroides pectinophilus ATCC 43243] gi|217992788|gb|EEC58789.1| hypothetical protein BACPEC_00130 [Bacteroides pectinophilus ATCC 43243] Length = 582 Score = 39.1 bits (91), Expect = 0.24, Method: Composition-based stats. Identities = 5/29 (17%), Positives = 8/29 (27%) Query: 15 ILVCPLTKGNLTLISEGTELLSKKASLAY 43 ++ CP L +L Y Sbjct: 33 MIACPDCGSALEFDVAKQKLKCPSCRQEY 61 >gi|194875404|ref|XP_001973591.1| GG13253 [Drosophila erecta] gi|190655374|gb|EDV52617.1| GG13253 [Drosophila erecta] Length = 124 Score = 39.1 bits (91), Expect = 0.24, Method: Composition-based stats. Identities = 8/31 (25%), Positives = 15/31 (48%) Query: 26 TLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 + +L + +PI G+P ML++E Sbjct: 91 EIDVLEGQLECPETGRVFPITDGIPNMLLNE 121 >gi|321253176|ref|XP_003192654.1| hypothetical protein CGB_C2230W [Cryptococcus gattii WM276] gi|317459123|gb|ADV20867.1| conserved hypothetical protein [Cryptococcus gattii WM276] Length = 124 Score = 38.7 bits (90), Expect = 0.25, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 17/31 (54%) Query: 26 TLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L E + + AYP+ +G+P ML++E Sbjct: 89 ELHVEEGIMTCRGCGHAYPVSNGIPNMLLAE 119 >gi|195592074|ref|XP_002085761.1| GD12134 [Drosophila simulans] gi|194197770|gb|EDX11346.1| GD12134 [Drosophila simulans] Length = 124 Score = 38.7 bits (90), Expect = 0.26, Method: Composition-based stats. Identities = 8/31 (25%), Positives = 15/31 (48%) Query: 26 TLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 + +L + +PI G+P ML++E Sbjct: 91 EIDVLEGQLECPETGRVFPITDGIPNMLLNE 121 >gi|322371117|ref|ZP_08045669.1| Transcription factor TFIIB cyclin-related protein [Haladaptatus paucihalophilus DX253] gi|320549107|gb|EFW90769.1| Transcription factor TFIIB cyclin-related protein [Haladaptatus paucihalophilus DX253] Length = 324 Score = 38.7 bits (90), Expect = 0.27, Method: Composition-based stats. Identities = 7/26 (26%), Positives = 8/26 (30%) Query: 17 VCPLTKGNLTLISEGTELLSKKASLA 42 CP G L E E + L Sbjct: 28 RCPECGGPLVTDEERGERVCDDCGLV 53 >gi|158521914|ref|YP_001529784.1| methyltransferase type 11 [Desulfococcus oleovorans Hxd3] gi|158510740|gb|ABW67707.1| Methyltransferase type 11 [Desulfococcus oleovorans Hxd3] Length = 282 Score = 38.7 bits (90), Expect = 0.28, Method: Composition-based stats. Identities = 11/51 (21%), Positives = 20/51 (39%), Gaps = 5/51 (9%) Query: 10 PQLLEILVCPLT----KGNLTLISE-GTELLSKKASLAYPIRSGVPIMLVS 55 + L+ L CP + +L+ + L +YP+ +GV L Sbjct: 6 EKALDFLSCPACSANAEASLSFVRAPAPALQCTGCRASYPVVNGVLDFLPD 56 >gi|298712937|emb|CBJ26839.1| Protein trm112, putative [Ectocarpus siliculosus] Length = 123 Score = 38.7 bits (90), Expect = 0.28, Method: Composition-based stats. Identities = 10/26 (38%), Positives = 15/26 (57%) Query: 31 GTELLSKKASLAYPIRSGVPIMLVSE 56 EL+ + +P+R GVP ML+ E Sbjct: 95 EGELVCPETGRKFPVRQGVPNMLLHE 120 >gi|325180798|emb|CCA15208.1| conserved hypothetical protein [Albugo laibachii Nc14] Length = 123 Score = 38.7 bits (90), Expect = 0.28, Method: Composition-based stats. Identities = 7/27 (25%), Positives = 17/27 (62%) Query: 30 EGTELLSKKASLAYPIRSGVPIMLVSE 56 + L+ +++ +PI G+P ML+++ Sbjct: 94 KKGRLICPESNREFPIVDGIPNMLLND 120 >gi|323452789|gb|EGB08662.1| hypothetical protein AURANDRAFT_69798 [Aureococcus anophagefferens] Length = 112 Score = 38.7 bits (90), Expect = 0.28, Method: Composition-based stats. Identities = 9/26 (34%), Positives = 15/26 (57%) Query: 31 GTELLSKKASLAYPIRSGVPIMLVSE 56 L+ K+ +PI +G+P ML+ E Sbjct: 84 KGALVCPKSGRRFPINNGIPNMLLHE 109 >gi|322783889|gb|EFZ11090.1| hypothetical protein SINV_12608 [Solenopsis invicta] Length = 64 Score = 38.7 bits (90), Expect = 0.28, Method: Composition-based stats. Identities = 10/32 (31%), Positives = 18/32 (56%) Query: 25 LTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + +LL ++ +PI G+P ML++E Sbjct: 30 LEIEVINGDLLCPESGRKFPINDGIPNMLLNE 61 >gi|289743749|gb|ADD20622.1| uncharacterized conserved protein [Glossina morsitans morsitans] Length = 124 Score = 38.7 bits (90), Expect = 0.29, Method: Composition-based stats. Identities = 8/31 (25%), Positives = 15/31 (48%) Query: 26 TLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 + +L + +PI G+P ML++E Sbjct: 91 EIDVVEGQLECPETGRVFPITDGIPNMLLNE 121 >gi|195428130|ref|XP_002062127.1| GK17370 [Drosophila willistoni] gi|194158212|gb|EDW73113.1| GK17370 [Drosophila willistoni] Length = 124 Score = 38.7 bits (90), Expect = 0.30, Method: Composition-based stats. Identities = 8/31 (25%), Positives = 15/31 (48%) Query: 26 TLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 + +L + +PI G+P ML++E Sbjct: 91 EVDVIEGQLECPETGRVFPIADGIPNMLLNE 121 >gi|300176151|emb|CBK23462.2| unnamed protein product [Blastocystis hominis] Length = 118 Score = 38.7 bits (90), Expect = 0.31, Method: Composition-based stats. Identities = 10/35 (28%), Positives = 15/35 (42%) Query: 22 KGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L L +L+ + Y I G+P ML+ E Sbjct: 81 HALLELEVMSGKLVCRHCGREYVIEQGIPNMLLRE 115 >gi|262275233|ref|ZP_06053043.1| hypothetical protein VHA_002215 [Grimontia hollisae CIP 101886] gi|262220478|gb|EEY71793.1| hypothetical protein VHA_002215 [Grimontia hollisae CIP 101886] Length = 311 Score = 38.3 bits (89), Expect = 0.32, Method: Composition-based stats. Identities = 14/52 (26%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Query: 6 FNIDPQ-LLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 +D + +L +L CP + + I +S + Y + G PI+L SE Sbjct: 1 MLLDQKDVLALLRCPRSGAEIKSIDTEANAISMSDDIQYQVLDGYPILLCSE 52 >gi|195348471|ref|XP_002040772.1| GM22158 [Drosophila sechellia] gi|194122282|gb|EDW44325.1| GM22158 [Drosophila sechellia] Length = 124 Score = 38.3 bits (89), Expect = 0.32, Method: Composition-based stats. Identities = 8/31 (25%), Positives = 15/31 (48%) Query: 26 TLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 + +L + +PI G+P ML++E Sbjct: 91 EIDVLEGQLECPETGRVFPITDGIPNMLLNE 121 >gi|58264626|ref|XP_569469.1| hypothetical protein [Cryptococcus neoformans var. neoformans JEC21] gi|134109963|ref|XP_776367.1| hypothetical protein CNBC5840 [Cryptococcus neoformans var. neoformans B-3501A] gi|50259041|gb|EAL21720.1| hypothetical protein CNBC5840 [Cryptococcus neoformans var. neoformans B-3501A] gi|57225701|gb|AAW42162.1| conserved hypothetical protein [Cryptococcus neoformans var. neoformans JEC21] Length = 124 Score = 38.3 bits (89), Expect = 0.33, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 17/31 (54%) Query: 26 TLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L E + + AYP+ +G+P ML++E Sbjct: 89 ELHVEEGIMTCRGCGHAYPVANGIPNMLLAE 119 >gi|119513380|ref|ZP_01632413.1| Glycosyltransferase [Nodularia spumigena CCY9414] gi|119461959|gb|EAW42963.1| Glycosyltransferase [Nodularia spumigena CCY9414] Length = 671 Score = 38.3 bits (89), Expect = 0.33, Method: Composition-based stats. Identities = 14/42 (33%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Query: 13 LEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLV 54 L +L CP L + L S YPI + VPI L Sbjct: 12 LSLLKCPKCHH-YHLRIKTDYLECTNCSAQYPILNKVPIFLE 52 >gi|195477060|ref|XP_002086290.1| GE22955 [Drosophila yakuba] gi|194186080|gb|EDW99691.1| GE22955 [Drosophila yakuba] Length = 124 Score = 38.3 bits (89), Expect = 0.34, Method: Composition-based stats. Identities = 8/31 (25%), Positives = 15/31 (48%) Query: 26 TLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 + +L + +PI G+P ML++E Sbjct: 91 EIDVLEGQLECPETGRVFPITDGIPNMLLNE 121 >gi|296241931|ref|YP_003649418.1| hypothetical protein Tagg_0186 [Thermosphaera aggregans DSM 11486] gi|296094515|gb|ADG90466.1| protein of unknown function DUF343 [Thermosphaera aggregans DSM 11486] Length = 129 Score = 38.3 bits (89), Expect = 0.36, Method: Composition-based stats. Identities = 8/43 (18%), Positives = 16/43 (37%) Query: 21 TKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 L + L + YP+R G+ +L R+ ++ Sbjct: 61 CGECLKTGIKTGVLYCPNCNRWYPVRDGIVYLLADNRRKPEND 103 >gi|281205050|gb|EFA79243.1| hypothetical protein PPL_07661 [Polysphondylium pallidum PN500] Length = 132 Score = 38.3 bits (89), Expect = 0.36, Method: Composition-based stats. Identities = 9/26 (34%), Positives = 12/26 (46%) Query: 31 GTELLSKKASLAYPIRSGVPIMLVSE 56 +L YPI G+P ML+ E Sbjct: 93 TGQLTCPNCQRVYPIDQGIPNMLLKE 118 >gi|269929311|ref|YP_003321632.1| methylase [Sphaerobacter thermophilus DSM 20745] gi|269788668|gb|ACZ40810.1| methylase [Sphaerobacter thermophilus DSM 20745] Length = 566 Score = 38.3 bits (89), Expect = 0.38, Method: Composition-based stats. Identities = 10/45 (22%), Positives = 16/45 (35%), Gaps = 3/45 (6%) Query: 16 LVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPI-MLVS-EAR 58 L CP + L + + +P G+ +L EAR Sbjct: 18 LACPRCRAPLVPDGD-DAVRCLVEGDRFPNEDGIWRFLLPEREAR 61 >gi|31247998|ref|XP_316602.1| AGAP006575-PA [Anopheles gambiae str. PEST] gi|21299129|gb|EAA11274.1| AGAP006575-PA [Anopheles gambiae str. PEST] Length = 122 Score = 38.3 bits (89), Expect = 0.38, Method: Composition-based stats. Identities = 9/32 (28%), Positives = 16/32 (50%) Query: 25 LTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + L + +PI +G+P ML++E Sbjct: 88 LEVDVVEGTLECPETGRIFPINNGIPNMLLNE 119 >gi|297527495|ref|YP_003669519.1| Zinc finger TFIIB-type domain protein [Staphylothermus hellenicus DSM 12710] gi|297256411|gb|ADI32620.1| Zinc finger TFIIB-type domain protein [Staphylothermus hellenicus DSM 12710] Length = 199 Score = 38.3 bits (89), Expect = 0.38, Method: Composition-based stats. Identities = 8/33 (24%), Positives = 13/33 (39%), Gaps = 3/33 (9%) Query: 17 VCPLTKGNLTLISEGTELLSKKASLAYPIRSGV 49 CP+ G L E E++ K L + + Sbjct: 4 RCPVCGGLLIWDYERGEVVCSKCGL---VVDKI 33 >gi|331250467|ref|XP_003337842.1| hypothetical protein PGTG_19500 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] gi|309316832|gb|EFP93423.1| hypothetical protein PGTG_19500 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 133 Score = 38.3 bits (89), Expect = 0.40, Method: Composition-based stats. Identities = 7/35 (20%), Positives = 16/35 (45%) Query: 22 KGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + + ++ + I+ G+P ML++E Sbjct: 94 HALLEIHVQEGNMVCPSCGHIFVIKDGIPNMLLAE 128 >gi|241122398|ref|XP_002403549.1| conserved hypothetical protein [Ixodes scapularis] gi|215493454|gb|EEC03095.1| conserved hypothetical protein [Ixodes scapularis] Length = 124 Score = 38.3 bits (89), Expect = 0.41, Method: Composition-based stats. Identities = 8/23 (34%), Positives = 15/23 (65%) Query: 34 LLSKKASLAYPIRSGVPIMLVSE 56 L+ + +PI +G+P ML++E Sbjct: 99 LVCPETGRKFPITNGIPNMLLNE 121 >gi|139439999|ref|ZP_01773322.1| Hypothetical protein COLAER_02361 [Collinsella aerofaciens ATCC 25986] gi|133774688|gb|EBA38508.1| Hypothetical protein COLAER_02361 [Collinsella aerofaciens ATCC 25986] Length = 440 Score = 38.3 bits (89), Expect = 0.41, Method: Composition-based stats. Identities = 6/30 (20%), Positives = 10/30 (33%) Query: 18 CPLTKGNLTLISEGTELLSKKASLAYPIRS 47 CP G L S +L+ + + Sbjct: 10 CPACGGPLHFASAEQKLVCDYCDSRFEVEE 39 >gi|56756671|gb|AAW26508.1| SJCHGC04493 protein [Schistosoma japonicum] gi|226467478|emb|CAX69615.1| TRM112-like protein [Schistosoma japonicum] Length = 125 Score = 37.9 bits (88), Expect = 0.42, Method: Composition-based stats. Identities = 9/32 (28%), Positives = 16/32 (50%) Query: 25 LTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + L+ + + I +G+P MLV+E Sbjct: 92 LEVDVMEGVLVCPETGREFTISNGIPNMLVNE 123 >gi|195126619|ref|XP_002007768.1| GI12204 [Drosophila mojavensis] gi|193919377|gb|EDW18244.1| GI12204 [Drosophila mojavensis] Length = 124 Score = 37.9 bits (88), Expect = 0.43, Method: Composition-based stats. Identities = 8/31 (25%), Positives = 15/31 (48%) Query: 26 TLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 + +L + +PI G+P ML++E Sbjct: 91 EIDVLEGQLECPETGRVFPITDGIPNMLLNE 121 >gi|256076108|ref|XP_002574356.1| hypothetical protein [Schistosoma mansoni] gi|238659559|emb|CAZ30589.1| expressed protein [Schistosoma mansoni] Length = 136 Score = 37.9 bits (88), Expect = 0.44, Method: Composition-based stats. Identities = 9/32 (28%), Positives = 16/32 (50%) Query: 25 LTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + L+ + + I +G+P MLV+E Sbjct: 103 LEVDVMEGVLVCPETGREFTISNGIPNMLVNE 134 >gi|256076110|ref|XP_002574357.1| hypothetical protein [Schistosoma mansoni] gi|238659560|emb|CAZ30590.1| expressed protein [Schistosoma mansoni] Length = 125 Score = 37.9 bits (88), Expect = 0.46, Method: Composition-based stats. Identities = 9/32 (28%), Positives = 16/32 (50%) Query: 25 LTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + L+ + + I +G+P MLV+E Sbjct: 92 LEVDVMEGVLVCPETGREFTISNGIPNMLVNE 123 >gi|150400224|ref|YP_001323991.1| hypothetical protein Mevan_1485 [Methanococcus vannielii SB] gi|150012927|gb|ABR55379.1| hypothetical protein Mevan_1485 [Methanococcus vannielii SB] Length = 48 Score = 37.9 bits (88), Expect = 0.47, Method: Composition-based stats. Identities = 10/50 (20%), Positives = 20/50 (40%), Gaps = 2/50 (4%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVS 55 +L +IL CP+ GN + + + K Y + + + + L Sbjct: 1 MEWIEKLKDILKCPICGGNFEIGIKK--ITCKVCKKNYKVENNILVFLEE 48 >gi|304314526|ref|YP_003849673.1| methyltransferase [Methanothermobacter marburgensis str. Marburg] gi|302587985|gb|ADL58360.1| predicted methyltransferase [Methanothermobacter marburgensis str. Marburg] Length = 314 Score = 37.9 bits (88), Expect = 0.48, Method: Composition-based stats. Identities = 11/48 (22%), Positives = 22/48 (45%), Gaps = 2/48 (4%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVS 55 ++P++ + VCP K + LI K Y I + +P+++ Sbjct: 1 MNPKIEHVFVCPDCK--IRLIKSQRCFKCPKCDYEYTIINKIPVIIKE 46 >gi|158424212|ref|YP_001525504.1| hypothetical protein AZC_2588 [Azorhizobium caulinodans ORS 571] gi|158331101|dbj|BAF88586.1| protein of unknown function [Azorhizobium caulinodans ORS 571] Length = 487 Score = 37.9 bits (88), Expect = 0.48, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 17/55 (30%), Gaps = 16/55 (29%) Query: 17 VCPLTKG-----NLTL---------ISEGTELLS--KKASLAYPIRSGVPIMLVS 55 VCP + L L L AYPI SG PI++ Sbjct: 147 VCPACRQTGAEHPLALEAGAVIVEGDVRTGILRCSGPACGKAYPILSGTPILVPD 201 >gi|126466177|ref|YP_001041286.1| hypothetical protein Smar_1287 [Staphylothermus marinus F1] gi|126015000|gb|ABN70378.1| protein of unknown function DUF343 [Staphylothermus marinus F1] Length = 133 Score = 37.9 bits (88), Expect = 0.49, Method: Composition-based stats. Identities = 9/43 (20%), Positives = 18/43 (41%) Query: 21 TKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 + L + + L K YPI++G+ +L R+ + Sbjct: 61 CEKCLRIGIKEGVLYCPKCKRWYPIKNGIVYLLRDNKRRKESD 103 >gi|257388038|ref|YP_003177811.1| transcription factor TFIIB cyclin-related [Halomicrobium mukohataei DSM 12286] gi|257170345|gb|ACV48104.1| Transcription factor TFIIB cyclin-related [Halomicrobium mukohataei DSM 12286] Length = 322 Score = 37.9 bits (88), Expect = 0.50, Method: Composition-based stats. Identities = 9/26 (34%), Positives = 12/26 (46%) Query: 17 VCPLTKGNLTLISEGTELLSKKASLA 42 VCP G+L SE E + + L Sbjct: 26 VCPECGGDLVADSERGETVCEDCGLV 51 >gi|328873041|gb|EGG21408.1| hypothetical protein DFA_01292 [Dictyostelium fasciculatum] Length = 142 Score = 37.9 bits (88), Expect = 0.50, Method: Composition-based stats. Identities = 9/26 (34%), Positives = 12/26 (46%) Query: 31 GTELLSKKASLAYPIRSGVPIMLVSE 56 L + YPI G+P ML+ E Sbjct: 83 NGSLTCPSCNRVYPIEVGIPNMLLKE 108 >gi|297527139|ref|YP_003669163.1| protein of unknown function DUF343 [Staphylothermus hellenicus DSM 12710] gi|297256055|gb|ADI32264.1| protein of unknown function DUF343 [Staphylothermus hellenicus DSM 12710] Length = 133 Score = 37.9 bits (88), Expect = 0.51, Method: Composition-based stats. Identities = 9/43 (20%), Positives = 18/43 (41%) Query: 21 TKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 + L + + L K YPI++G+ +L R+ + Sbjct: 61 CEKCLRIGIKEGVLYCPKCKRWYPIKNGIVYLLRDNKRRKESD 103 >gi|195495652|ref|XP_002095358.1| GE22352 [Drosophila yakuba] gi|194181459|gb|EDW95070.1| GE22352 [Drosophila yakuba] Length = 121 Score = 37.9 bits (88), Expect = 0.51, Method: Composition-based stats. Identities = 8/31 (25%), Positives = 15/31 (48%) Query: 26 TLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 + +L + +PI G+P ML++E Sbjct: 88 EIDVLEGQLECPETGRVFPITDGIPNMLLNE 118 >gi|283455902|ref|YP_003360466.1| hypothetical protein BDP_0999 [Bifidobacterium dentium Bd1] gi|283102536|gb|ADB09642.1| Conserved hypothetical protein [Bifidobacterium dentium Bd1] Length = 448 Score = 37.9 bits (88), Expect = 0.52, Method: Composition-based stats. Identities = 5/22 (22%), Positives = 6/22 (27%) Query: 18 CPLTKGNLTLISEGTELLSKKA 39 CP G L L+ Sbjct: 17 CPACGGPLRYDGAKALLVCDHC 38 >gi|289582455|ref|YP_003480921.1| transcription factor TFIIB cyclin-related protein [Natrialba magadii ATCC 43099] gi|289532008|gb|ADD06359.1| Transcription factor TFIIB cyclin-related protein [Natrialba magadii ATCC 43099] Length = 326 Score = 37.9 bits (88), Expect = 0.52, Method: Composition-based stats. Identities = 9/27 (33%), Positives = 12/27 (44%) Query: 16 LVCPLTKGNLTLISEGTELLSKKASLA 42 L CP GNL + E E + + L Sbjct: 29 LACPECAGNLVVDDEHGETVCEDCGLV 55 >gi|219121440|ref|XP_002185944.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1] gi|209582793|gb|ACI65414.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1] Length = 132 Score = 37.9 bits (88), Expect = 0.52, Method: Composition-based stats. Identities = 7/23 (30%), Positives = 12/23 (52%) Query: 34 LLSKKASLAYPIRSGVPIMLVSE 56 L +P+R G+P M++ E Sbjct: 102 LTCPATGREFPVRDGIPNMVLEE 124 >gi|157130004|ref|XP_001655512.1| hypothetical protein AaeL_AAEL000330 [Aedes aegypti] gi|94468700|gb|ABF18199.1| hypothetical conserved protein [Aedes aegypti] gi|108884395|gb|EAT48620.1| conserved hypothetical protein [Aedes aegypti] Length = 122 Score = 37.9 bits (88), Expect = 0.53, Method: Composition-based stats. Identities = 8/31 (25%), Positives = 14/31 (45%) Query: 26 TLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 + L + +PI G+P ML++E Sbjct: 89 EVDVVEGTLECPETGRVFPISDGIPNMLLNE 119 >gi|118355377|ref|XP_001010948.1| hypothetical protein TTHERM_00705190 [Tetrahymena thermophila] gi|89292715|gb|EAR90703.1| hypothetical protein TTHERM_00705190 [Tetrahymena thermophila SB210] Length = 151 Score = 37.9 bits (88), Expect = 0.54, Method: Composition-based stats. Identities = 7/26 (26%), Positives = 17/26 (65%) Query: 31 GTELLSKKASLAYPIRSGVPIMLVSE 56 L+ + + YPI++G+P M++++ Sbjct: 123 EGALICEGCNKRYPIKNGIPNMILND 148 >gi|125980073|ref|XP_001354069.1| GA11949 [Drosophila pseudoobscura pseudoobscura] gi|195170926|ref|XP_002026262.1| GL24597 [Drosophila persimilis] gi|54641056|gb|EAL29807.1| GA11949 [Drosophila pseudoobscura pseudoobscura] gi|194111157|gb|EDW33200.1| GL24597 [Drosophila persimilis] Length = 124 Score = 37.5 bits (87), Expect = 0.54, Method: Composition-based stats. Identities = 8/31 (25%), Positives = 15/31 (48%) Query: 26 TLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 + +L + +PI G+P ML++E Sbjct: 91 EIDVLEGQLECPETGRIFPITDGIPNMLLNE 121 >gi|306822901|ref|ZP_07456277.1| YjbE family integral membrane protein [Bifidobacterium dentium ATCC 27679] gi|304553533|gb|EFM41444.1| YjbE family integral membrane protein [Bifidobacterium dentium ATCC 27679] Length = 441 Score = 37.5 bits (87), Expect = 0.55, Method: Composition-based stats. Identities = 5/22 (22%), Positives = 6/22 (27%) Query: 18 CPLTKGNLTLISEGTELLSKKA 39 CP G L L+ Sbjct: 10 CPACGGPLRYDGAKALLVCDHC 31 >gi|219363341|ref|NP_001137041.1| hypothetical protein LOC100217212 [Zea mays] gi|194698108|gb|ACF83138.1| unknown [Zea mays] Length = 131 Score = 37.5 bits (87), Expect = 0.55, Method: Composition-based stats. Identities = 9/35 (25%), Positives = 16/35 (45%) Query: 22 KGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + + L+ S +PI G+P M++ E Sbjct: 94 HALLEVHVQEGSLVCPDTSRCFPINKGIPNMMLHE 128 >gi|171743089|ref|ZP_02918896.1| hypothetical protein BIFDEN_02215 [Bifidobacterium dentium ATCC 27678] gi|171278703|gb|EDT46364.1| hypothetical protein BIFDEN_02215 [Bifidobacterium dentium ATCC 27678] Length = 448 Score = 37.5 bits (87), Expect = 0.55, Method: Composition-based stats. Identities = 5/22 (22%), Positives = 6/22 (27%) Query: 18 CPLTKGNLTLISEGTELLSKKA 39 CP G L L+ Sbjct: 17 CPACGGPLRYDGAKALLVCDHC 38 >gi|195652303|gb|ACG45619.1| hypothetical protein [Zea mays] Length = 131 Score = 37.5 bits (87), Expect = 0.59, Method: Composition-based stats. Identities = 9/35 (25%), Positives = 16/35 (45%) Query: 22 KGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + + L+ S +PI G+P M++ E Sbjct: 94 HALLEVHVQEGSLVCPDTSRCFPINKGIPNMMLHE 128 >gi|309801277|ref|ZP_07695406.1| conserved hypothetical protein [Bifidobacterium dentium JCVIHMP022] gi|308222166|gb|EFO78449.1| conserved hypothetical protein [Bifidobacterium dentium JCVIHMP022] Length = 448 Score = 37.5 bits (87), Expect = 0.60, Method: Composition-based stats. Identities = 5/22 (22%), Positives = 6/22 (27%) Query: 18 CPLTKGNLTLISEGTELLSKKA 39 CP G L L+ Sbjct: 17 CPACGGPLRYDGAKALLVCDHC 38 >gi|219847440|ref|YP_002461873.1| methyltransferase type 11 [Chloroflexus aggregans DSM 9485] gi|219541699|gb|ACL23437.1| Methyltransferase type 11 [Chloroflexus aggregans DSM 9485] Length = 281 Score = 37.5 bits (87), Expect = 0.61, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 20/54 (37%), Gaps = 14/54 (25%) Query: 8 IDPQLLEILVCPLTKGN---LTLIS---------EGTELLSKKASLAYPIRSGV 49 +DP LL ++ CP LT+ E L + YPI G+ Sbjct: 1 MDPNLLPLITCP--HHPTVTLTVEQIEHANDGTIERGYLRCPHCTRRYPITEGI 52 >gi|37523871|ref|NP_927248.1| hypothetical protein gll4302 [Gloeobacter violaceus PCC 7421] gi|35214877|dbj|BAC92243.1| gll4302 [Gloeobacter violaceus PCC 7421] Length = 335 Score = 37.5 bits (87), Expect = 0.61, Method: Composition-based stats. Identities = 13/44 (29%), Positives = 21/44 (47%), Gaps = 3/44 (6%) Query: 15 ILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVP-IMLVSEA 57 +L CP + L + +G L+S YP + G P ++ EA Sbjct: 285 LLACPRSHQPL--LGDGQALVSADRQWLYPFQEGRPQVLHAEEA 326 >gi|298505023|gb|ADI83746.1| SAM-dependent methyltransferase [Geobacter sulfurreducens KN400] Length = 313 Score = 37.5 bits (87), Expect = 0.62, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 24/59 (40%), Gaps = 11/59 (18%) Query: 8 IDPQLLEILVCPLT---KGNLTLISEGTE--------LLSKKASLAYPIRSGVPIMLVS 55 + LL +L+CP + L L G L ++ YPIR GV ++L Sbjct: 1 MKRVLLPLLICPACLPKEHPLDLSGAGERDEDIVSGTLSCRRCRRRYPIREGVALLLPD 59 >gi|329934644|ref|ZP_08284685.1| rRNA methyltransferase [Streptomyces griseoaurantiacus M045] gi|329305466|gb|EGG49322.1| rRNA methyltransferase [Streptomyces griseoaurantiacus M045] Length = 295 Score = 37.5 bits (87), Expect = 0.63, Method: Composition-based stats. Identities = 10/38 (26%), Positives = 17/38 (44%), Gaps = 3/38 (7%) Query: 13 LEILVCPLTKGN-LTLISEGTELLSKKASLAYPI-RSG 48 L++L CP+ + L + L A A+ + R G Sbjct: 13 LDLLRCPVCRMPGLRPDRDRGALRCP-ARHAFDVARHG 49 >gi|77920291|ref|YP_358106.1| hypothetical protein Pcar_2700 [Pelobacter carbinolicus DSM 2380] gi|77546374|gb|ABA89936.1| conserved hypothetical protein [Pelobacter carbinolicus DSM 2380] Length = 312 Score = 37.5 bits (87), Expect = 0.65, Method: Composition-based stats. Identities = 13/68 (19%), Positives = 20/68 (29%), Gaps = 12/68 (17%) Query: 8 IDPQLLEILVCPLT-----------KGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 + LL++L+CP +L YPIR G+ L Sbjct: 1 MKTSLLQMLICPNCLPAEIALRATVHRQSHDDILEGDLCCGNCGHLYPIRDGLA-FLEPH 59 Query: 57 ARQVDDQG 64 +G Sbjct: 60 YVPRKQEG 67 >gi|194749061|ref|XP_001956958.1| GF10180 [Drosophila ananassae] gi|190624240|gb|EDV39764.1| GF10180 [Drosophila ananassae] Length = 124 Score = 37.5 bits (87), Expect = 0.65, Method: Composition-based stats. Identities = 8/31 (25%), Positives = 15/31 (48%) Query: 26 TLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 + +L + +PI G+P ML++E Sbjct: 91 EIDVLEGQLECPETGRIFPITDGIPNMLLNE 121 >gi|82595087|ref|XP_725700.1| hypothetical protein [Plasmodium yoelii yoelii str. 17XNL] gi|23480804|gb|EAA17265.1| hypothetical protein [Plasmodium yoelii yoelii] Length = 29 Score = 37.5 bits (87), Expect = 0.67, Method: Composition-based stats. Identities = 8/23 (34%), Positives = 14/23 (60%) Query: 31 GTELLSKKASLAYPIRSGVPIML 53 L K ++++PI+ G+P ML Sbjct: 2 EGSLTCPKCNISFPIKDGIPNML 24 >gi|188585376|ref|YP_001916921.1| Methyltransferase type 11 [Natranaerobius thermophilus JW/NM-WN-LF] gi|179350063|gb|ACB84333.1| Methyltransferase type 11 [Natranaerobius thermophilus JW/NM-WN-LF] Length = 266 Score = 37.1 bits (86), Expect = 0.72, Method: Composition-based stats. Identities = 14/49 (28%), Positives = 22/49 (44%), Gaps = 2/49 (4%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 + L +L+ P T L EG +L+ K + I +PIML + Sbjct: 1 MKETTLSLLINPSTGNELK--KEGQKLIDTKTGEQFTISDAIPIMLKDD 47 >gi|115675628|ref|XP_784899.2| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus] gi|115959564|ref|XP_001187136.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus] Length = 126 Score = 37.1 bits (86), Expect = 0.73, Method: Composition-based stats. Identities = 8/32 (25%), Positives = 18/32 (56%) Query: 25 LTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + L+ ++ +PI++G+ ML++E Sbjct: 82 LEIEIVEGNLVCPESGRKFPIKNGIANMLLNE 113 >gi|242050916|ref|XP_002463202.1| hypothetical protein SORBIDRAFT_02g039700 [Sorghum bicolor] gi|241926579|gb|EER99723.1| hypothetical protein SORBIDRAFT_02g039700 [Sorghum bicolor] Length = 131 Score = 37.1 bits (86), Expect = 0.74, Method: Composition-based stats. Identities = 9/35 (25%), Positives = 16/35 (45%) Query: 22 KGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + + L+ S +PI G+P M++ E Sbjct: 94 HALLEVHVQEGSLVCPDTSRCFPINKGIPNMMLHE 128 >gi|218780347|ref|YP_002431665.1| methyltransferase type 11 [Desulfatibacillum alkenivorans AK-01] gi|218761731|gb|ACL04197.1| Methyltransferase type 11 [Desulfatibacillum alkenivorans AK-01] Length = 268 Score = 37.1 bits (86), Expect = 0.75, Method: Composition-based stats. Identities = 11/39 (28%), Positives = 13/39 (33%), Gaps = 6/39 (15%) Query: 14 EILVCPLTKGNLTLI----SEGTELLSKKASLAYPIRSG 48 ++ CP KG E K YPIR G Sbjct: 7 NLVRCPSCKGG--YCSVNRDEKDFFTCKVCGERYPIRDG 43 >gi|163849120|ref|YP_001637164.1| type 11 methyltransferase [Chloroflexus aurantiacus J-10-fl] gi|222527093|ref|YP_002571564.1| type 11 methyltransferase [Chloroflexus sp. Y-400-fl] gi|163670409|gb|ABY36775.1| Methyltransferase type 11 [Chloroflexus aurantiacus J-10-fl] gi|222450972|gb|ACM55238.1| Methyltransferase type 11 [Chloroflexus sp. Y-400-fl] Length = 275 Score = 37.1 bits (86), Expect = 0.76, Method: Composition-based stats. Identities = 16/57 (28%), Positives = 24/57 (42%), Gaps = 12/57 (21%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTE-----------LLSKKASLAYPIRSGVPIML 53 +DP+LL +L CP +TL E E L + Y I+ G+ M+ Sbjct: 1 MDPRLLPLLSCPR-HPTVTLTVEQVERVVNGAIVSGRLRCPVCATTYLIKDGILDMI 56 >gi|221194702|ref|ZP_03567759.1| primosomal protein N' [Atopobium rimae ATCC 49626] gi|221185606|gb|EEE17996.1| primosomal protein N' [Atopobium rimae ATCC 49626] Length = 768 Score = 37.1 bits (86), Expect = 0.77, Method: Composition-based stats. Identities = 7/29 (24%), Positives = 11/29 (37%) Query: 18 CPLTKGNLTLISEGTELLSKKASLAYPIR 46 CP +LT EL+ + +R Sbjct: 476 CPHCSTSLTYHERTCELVCHTCGRRWSVR 504 >gi|14520892|ref|NP_126367.1| transcription initiation factor IIB [Pyrococcus abyssi GE5] gi|13878809|sp|Q9V0V5|TF2B_PYRAB RecName: Full=Transcription initiation factor IIB; Short=TFIIB gi|5458109|emb|CAB49598.1| TATA box binding protein TFIIB-BBRE complex, chain B [Pyrococcus abyssi GE5] Length = 300 Score = 37.1 bits (86), Expect = 0.78, Method: Composition-based stats. Identities = 8/40 (20%), Positives = 13/40 (32%), Gaps = 3/40 (7%) Query: 17 VCPLTKG-NLTLISEGTELLSKKASLAYPIRSGVPIMLVS 55 VCP+ E E++ + Y I + M Sbjct: 6 VCPVCGSTEFIYDPERGEIVCARCG--YVIEENIVDMGPE 43 >gi|332157709|ref|YP_004422988.1| transcription initiation factor IIB [Pyrococcus sp. NA2] gi|331033172|gb|AEC50984.1| transcription initiation factor IIB [Pyrococcus sp. NA2] Length = 300 Score = 37.1 bits (86), Expect = 0.81, Method: Composition-based stats. Identities = 8/40 (20%), Positives = 13/40 (32%), Gaps = 3/40 (7%) Query: 17 VCPLTKG-NLTLISEGTELLSKKASLAYPIRSGVPIMLVS 55 VCP+ E E++ + Y I + M Sbjct: 6 VCPVCGSTEFIYDPERGEIVCARCG--YVIEENIVDMGPE 43 >gi|149198144|ref|ZP_01875191.1| hypothetical protein LNTAR_15822 [Lentisphaera araneosa HTCC2155] gi|149138746|gb|EDM27152.1| hypothetical protein LNTAR_15822 [Lentisphaera araneosa HTCC2155] Length = 62 Score = 37.1 bits (86), Expect = 0.82, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 22/55 (40%), Gaps = 5/55 (9%) Query: 6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIR-----SGVPIMLVS 55 + LLE+L CP+ K L +G EL + ++ G +++ Sbjct: 1 MQLKANLLELLNCPVCKSGEGLEQKGKELHCLSCKQVFKLKQLDGPDGQGVLMPD 55 >gi|328849649|gb|EGF98826.1| hypothetical protein MELLADRAFT_40640 [Melampsora larici-populina 98AG31] Length = 133 Score = 37.1 bits (86), Expect = 0.83, Method: Composition-based stats. Identities = 8/35 (22%), Positives = 18/35 (51%) Query: 22 KGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + + +++ S + I+ G+P ML++E Sbjct: 94 HALLEIHVQEGQMVCPSCSHIFVIKDGIPNMLLAE 128 >gi|39996005|ref|NP_951956.1| hypothetical protein GSU0900 [Geobacter sulfurreducens PCA] gi|39982770|gb|AAR34229.1| hypothetical protein GSU0900 [Geobacter sulfurreducens PCA] Length = 313 Score = 37.1 bits (86), Expect = 0.84, Method: Composition-based stats. Identities = 15/59 (25%), Positives = 27/59 (45%), Gaps = 11/59 (18%) Query: 8 IDPQLLEILVCPLT---KGNLTLI---SEGTELLS-----KKASLAYPIRSGVPIMLVS 55 + LL +L+CP + L L + +++S ++ YPIR GV ++L Sbjct: 1 MKRILLPLLICPACLPKEHPLDLSGAGEQAEDIVSGTLSCRRCRRRYPIREGVALLLPE 59 >gi|325118290|emb|CBZ53841.1| DEHA2B13398p, related [Neospora caninum Liverpool] Length = 126 Score = 37.1 bits (86), Expect = 0.89, Method: Composition-based stats. Identities = 8/26 (30%), Positives = 15/26 (57%) Query: 31 GTELLSKKASLAYPIRSGVPIMLVSE 56 +L+ + YPI +G+P ML+ + Sbjct: 98 EGKLVCPVCTREYPISNGIPNMLLQD 123 >gi|119715750|ref|YP_922715.1| NUDIX hydrolase [Nocardioides sp. JS614] gi|119536411|gb|ABL81028.1| NUDIX hydrolase [Nocardioides sp. JS614] Length = 307 Score = 37.1 bits (86), Expect = 0.92, Method: Composition-based stats. Identities = 14/47 (29%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Query: 18 CPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQ-VDDQ 63 CP L S G EL+ +P IMLV+ V+D+ Sbjct: 135 CPRCGEPLRPRSSGHELVCDNGHTQFPRTDPAVIMLVTSGEPGVEDE 181 >gi|30725332|gb|AAP37688.1| At1g78190 [Arabidopsis thaliana] Length = 117 Score = 36.8 bits (85), Expect = 0.92, Method: Composition-based stats. Identities = 9/35 (25%), Positives = 15/35 (42%) Query: 22 KGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L L E L+ + + + G+P ML+ E Sbjct: 80 HALLELHLEEGSLVCPETGRKFSVSKGIPNMLLHE 114 >gi|257077069|ref|ZP_05571430.1| hypothetical protein Faci_08396 [Ferroplasma acidarmanus fer1] Length = 117 Score = 36.8 bits (85), Expect = 0.93, Method: Composition-based stats. Identities = 13/83 (15%), Positives = 23/83 (27%), Gaps = 31/83 (37%) Query: 8 IDPQLLEILVCPLT---------------------KGNLTL----------ISEGTELLS 36 + L++++ CP+ G T + LL Sbjct: 1 MQYDLIDLIACPMCRGNSFSKSVIREEGDNVIIPGHGEHTYTDSNNDGANHDMKNGILLC 60 Query: 37 KKASLAYPIRSGVPIMLVSEARQ 59 YPI + + I+L R Sbjct: 61 NTCGRWYPIINSIHILLPDTYRD 83 >gi|14591268|ref|NP_143345.1| transcription initiation factor IIB [Pyrococcus horikoshii OT3] gi|6647871|sp|O59151|TF2B_PYRHO RecName: Full=Transcription initiation factor IIB; Short=TFIIB gi|3257906|dbj|BAA30589.1| 300aa long hypothetical transcription initiation factor IIB [Pyrococcus horikoshii OT3] Length = 300 Score = 36.8 bits (85), Expect = 0.95, Method: Composition-based stats. Identities = 8/40 (20%), Positives = 13/40 (32%), Gaps = 3/40 (7%) Query: 17 VCPLTKG-NLTLISEGTELLSKKASLAYPIRSGVPIMLVS 55 VCP+ E E++ + Y I + M Sbjct: 6 VCPVCGSTEFIYDPERGEIVCARCG--YVIEENIIDMGPE 43 >gi|66808727|ref|XP_638086.1| hypothetical protein DDB_G0285489 [Dictyostelium discoideum AX4] gi|74853823|sp|Q54N57|TR112_DICDI RecName: Full=TRM112-like protein gi|60466530|gb|EAL64582.1| hypothetical protein DDB_G0285489 [Dictyostelium discoideum AX4] Length = 128 Score = 36.8 bits (85), Expect = 0.98, Method: Composition-based stats. Identities = 9/26 (34%), Positives = 11/26 (42%) Query: 31 GTELLSKKASLAYPIRSGVPIMLVSE 56 L YPI G+P ML+ E Sbjct: 94 TGSLTCPNCQRVYPIDKGIPNMLLRE 119 >gi|15218237|ref|NP_177943.1| unknown protein [Arabidopsis thaliana] gi|47606209|sp|Q9C9R3|T112B_ARATH RecName: Full=TRM112-like protein At1g78190 gi|12324252|gb|AAG52099.1|AC012680_10 unknown protein; 53758-53384 [Arabidopsis thaliana] gi|332197958|gb|AEE36079.1| Trm1.2-like protein [Arabidopsis thaliana] Length = 124 Score = 36.8 bits (85), Expect = 0.99, Method: Composition-based stats. Identities = 9/35 (25%), Positives = 15/35 (42%) Query: 22 KGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L L E L+ + + + G+P ML+ E Sbjct: 87 HALLELHLEEGSLVCPETGRKFSVSKGIPNMLLHE 121 >gi|330801505|ref|XP_003288767.1| hypothetical protein DICPUDRAFT_153040 [Dictyostelium purpureum] gi|325081201|gb|EGC34726.1| hypothetical protein DICPUDRAFT_153040 [Dictyostelium purpureum] Length = 128 Score = 36.8 bits (85), Expect = 1.00, Method: Composition-based stats. Identities = 9/26 (34%), Positives = 11/26 (42%) Query: 31 GTELLSKKASLAYPIRSGVPIMLVSE 56 L YPI G+P ML+ E Sbjct: 94 TGSLQCPNCQRVYPIDKGIPNMLLRE 119 >gi|320162287|ref|YP_004175512.1| primosomal protein N' [Anaerolinea thermophila UNI-1] gi|319996141|dbj|BAJ64912.1| primosomal protein N' [Anaerolinea thermophila UNI-1] Length = 841 Score = 36.8 bits (85), Expect = 1.00, Method: Composition-based stats. Identities = 5/27 (18%), Positives = 10/27 (37%) Query: 16 LVCPLTKGNLTLISEGTELLSKKASLA 42 L CP + L ++ L+ + Sbjct: 563 LRCPRCEVPLVYHADAAALICHTCGYS 589 >gi|224132960|ref|XP_002321452.1| predicted protein [Populus trichocarpa] gi|222868448|gb|EEF05579.1| predicted protein [Populus trichocarpa] Length = 445 Score = 36.8 bits (85), Expect = 1.00, Method: Composition-based stats. Identities = 10/28 (35%), Positives = 14/28 (50%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLI 28 ++ I L EILVCP++K L Sbjct: 9 LKRAGEGISKTLSEILVCPISKQPLRWN 36 >gi|195379016|ref|XP_002048277.1| GJ11437 [Drosophila virilis] gi|194155435|gb|EDW70619.1| GJ11437 [Drosophila virilis] Length = 124 Score = 36.8 bits (85), Expect = 1.00, Method: Composition-based stats. Identities = 8/31 (25%), Positives = 15/31 (48%) Query: 26 TLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 + +L + +PI G+P ML++E Sbjct: 91 EIDVLEGQLECPETGRIFPIADGIPNMLLNE 121 >gi|18977749|ref|NP_579106.1| transcription initiation factor IIB [Pyrococcus furiosus DSM 3638] gi|48429160|sp|P61998|TF2B_PYRFU RecName: Full=Transcription initiation factor IIB; Short=TFIIB gi|48429161|sp|P61999|TF2B_PYRWO RecName: Full=Transcription initiation factor IIB; Short=TFIIB gi|1206029|gb|AAC43724.1| TFIIB [Pyrococcus furiosus] gi|18893488|gb|AAL81501.1| transcription initiation factor IIB chain b [Pyrococcus furiosus DSM 3638] Length = 300 Score = 36.8 bits (85), Expect = 1.0, Method: Composition-based stats. Identities = 10/40 (25%), Positives = 14/40 (35%), Gaps = 3/40 (7%) Query: 17 VCPLTK-GNLTLISEGTELLSKKASLAYPIRSGVPIMLVS 55 VCP + L E E++ K Y I + M Sbjct: 6 VCPACESAELIYDPERGEIVCAKCG--YVIEENIIDMGPE 43 >gi|47225269|emb|CAG09769.1| unnamed protein product [Tetraodon nigroviridis] Length = 123 Score = 36.8 bits (85), Expect = 1.1, Method: Composition-based stats. Identities = 10/35 (28%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Query: 25 LTLISEGTELLSKKASLAYPIRSGVPIML--VSEA 57 L + L ++ +PI G+P ML EA Sbjct: 89 LEVEVMEGCLKCPESGREFPISRGIPNMLLNEDEA 123 >gi|219849732|ref|YP_002464165.1| methyltransferase type 11 [Chloroflexus aggregans DSM 9485] gi|219543991|gb|ACL25729.1| Methyltransferase type 11 [Chloroflexus aggregans DSM 9485] Length = 355 Score = 36.8 bits (85), Expect = 1.1, Method: Composition-based stats. Identities = 11/43 (25%), Positives = 16/43 (37%), Gaps = 3/43 (6%) Query: 7 NIDPQLLEILVCPLTK-GNLTLISEGTELLSKKASLAYPIRSG 48 ID ++ +L CP L + E L + YP G Sbjct: 1 MIDHRIFPLLRCPTCGLRPLIV--EDHGLRCPRCQAYYPFCDG 41 >gi|299532680|ref|ZP_07046068.1| hypothetical protein CTS44_17843 [Comamonas testosteroni S44] gi|298719315|gb|EFI60284.1| hypothetical protein CTS44_17843 [Comamonas testosteroni S44] Length = 364 Score = 36.8 bits (85), Expect = 1.2, Method: Composition-based stats. Identities = 7/24 (29%), Positives = 9/24 (37%) Query: 17 VCPLTKGNLTLISEGTELLSKKAS 40 VCP GNL ++ L Sbjct: 6 VCPECGGNLEWNAKAQSLRCPYCG 29 >gi|264680354|ref|YP_003280264.1| hypothetical protein CtCNB1_4222 [Comamonas testosteroni CNB-2] gi|262210870|gb|ACY34968.1| conserved hypothetical protein [Comamonas testosteroni CNB-2] Length = 364 Score = 36.8 bits (85), Expect = 1.2, Method: Composition-based stats. Identities = 7/24 (29%), Positives = 9/24 (37%) Query: 17 VCPLTKGNLTLISEGTELLSKKAS 40 VCP GNL ++ L Sbjct: 6 VCPECGGNLEWNAKAQSLRCPYCG 29 >gi|240848623|ref|NP_001155812.1| hypothetical protein LOC100169083 [Acyrthosiphon pisum] gi|239793346|dbj|BAH72801.1| ACYPI009734 [Acyrthosiphon pisum] Length = 125 Score = 36.8 bits (85), Expect = 1.2, Method: Composition-based stats. Identities = 8/26 (30%), Positives = 16/26 (61%) Query: 31 GTELLSKKASLAYPIRSGVPIMLVSE 56 EL+ + +PI +G+P +L++E Sbjct: 96 NGELICPETDRVFPISAGIPNLLLNE 121 >gi|221065028|ref|ZP_03541133.1| conserved hypothetical protein [Comamonas testosteroni KF-1] gi|220710051|gb|EED65419.1| conserved hypothetical protein [Comamonas testosteroni KF-1] Length = 364 Score = 36.8 bits (85), Expect = 1.2, Method: Composition-based stats. Identities = 7/24 (29%), Positives = 9/24 (37%) Query: 17 VCPLTKGNLTLISEGTELLSKKAS 40 VCP GNL ++ L Sbjct: 6 VCPECGGNLEWNAKAQSLRCPYCG 29 >gi|237832845|ref|XP_002365720.1| hypothetical protein TGME49_070540 [Toxoplasma gondii ME49] gi|211963384|gb|EEA98579.1| hypothetical protein TGME49_070540 [Toxoplasma gondii ME49] Length = 126 Score = 36.8 bits (85), Expect = 1.2, Method: Composition-based stats. Identities = 7/26 (26%), Positives = 15/26 (57%) Query: 31 GTELLSKKASLAYPIRSGVPIMLVSE 56 +L+ + YP+ +G+P ML+ + Sbjct: 98 EGKLVCPVCAREYPVSNGIPNMLLQD 123 >gi|198420552|ref|XP_002129541.1| PREDICTED: similar to predicted protein [Ciona intestinalis] Length = 131 Score = 36.8 bits (85), Expect = 1.2, Method: Composition-based stats. Identities = 8/26 (30%), Positives = 15/26 (57%) Query: 31 GTELLSKKASLAYPIRSGVPIMLVSE 56 L ++ +PI +G+P ML++E Sbjct: 103 TGSLTCPESGREFPIANGIPNMLLNE 128 >gi|221508689|gb|EEE34258.1| conserved hypothetical protein [Toxoplasma gondii VEG] Length = 126 Score = 36.4 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 7/26 (26%), Positives = 15/26 (57%) Query: 31 GTELLSKKASLAYPIRSGVPIMLVSE 56 +L+ + YP+ +G+P ML+ + Sbjct: 98 EGKLVCPVCAREYPVSNGIPNMLLQD 123 >gi|328767749|gb|EGF77798.1| hypothetical protein BATDEDRAFT_91462 [Batrachochytrium dendrobatidis JAM81] Length = 246 Score = 36.4 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 12/61 (19%), Positives = 29/61 (47%), Gaps = 11/61 (18%) Query: 2 RETIFNIDPQLLEI----LVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEA 57 +E + D LE+ L+CP+ + +L + + +L+ + +M+++E+ Sbjct: 184 QEEMMLFDEHGLEMPFEYLICPVCQHP-SLATNQECIDCTGCNLS------IKVMIMNES 236 Query: 58 R 58 R Sbjct: 237 R 237 >gi|288958624|ref|YP_003448965.1| hypothetical protein AZL_017830 [Azospirillum sp. B510] gi|288910932|dbj|BAI72421.1| hypothetical protein AZL_017830 [Azospirillum sp. B510] Length = 355 Score = 36.4 bits (84), Expect = 1.3, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 19/56 (33%), Gaps = 17/56 (30%) Query: 17 VCPLTKG------NLTLISEGTE---------LLS--KKASLAYPIRSGVPIMLVS 55 VCP LT+ L+ ++ YP+ GVP+++ Sbjct: 12 VCPRCLANRGATVPLTIGLVEQATAADLRWGTLVCGDPACAMEYPVIDGVPVLVPD 67 >gi|16740612|gb|AAH16191.1| 0610038D11Rik protein [Mus musculus] Length = 124 Score = 36.4 bits (84), Expect = 1.3, Method: Composition-based stats. Identities = 8/32 (25%), Positives = 16/32 (50%) Query: 25 LTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + L ++ +PI G+P ML+++ Sbjct: 89 LEVDVLEGTLQCPESGRLFPISRGIPNMLLND 120 >gi|229366094|gb|ACQ58027.1| TRM112-like protein [Anoplopoma fimbria] Length = 123 Score = 36.4 bits (84), Expect = 1.3, Method: Composition-based stats. Identities = 10/32 (31%), Positives = 16/32 (50%) Query: 25 LTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + L ++ +PI G+P ML+SE Sbjct: 89 LEVEVIEGCLRCPESGREFPISRGIPNMLLSE 120 >gi|149725384|ref|XP_001489771.1| PREDICTED: similar to TRM112-like protein [Equus caballus] Length = 125 Score = 36.4 bits (84), Expect = 1.3, Method: Composition-based stats. Identities = 9/32 (28%), Positives = 16/32 (50%) Query: 25 LTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + L ++ +PI G+P ML+S+ Sbjct: 89 LEVDVLEGTLQCPESGRVFPISRGIPNMLLSD 120 >gi|110667127|ref|YP_656938.1| transcription initiation factor TFB [Haloquadratum walsbyi DSM 16790] gi|109624874|emb|CAJ51283.1| transcription initiation factor TFB [Haloquadratum walsbyi DSM 16790] Length = 366 Score = 36.4 bits (84), Expect = 1.3, Method: Composition-based stats. Identities = 9/27 (33%), Positives = 11/27 (40%) Query: 16 LVCPLTKGNLTLISEGTELLSKKASLA 42 LVCP GN+ E E + L Sbjct: 69 LVCPECSGNVVADDEHGETICDDCGLV 95 >gi|325969119|ref|YP_004245311.1| zinc finger TFIIB-type domain protein [Vulcanisaeta moutnovskia 768-28] gi|323708322|gb|ADY01809.1| Zinc finger TFIIB-type domain protein [Vulcanisaeta moutnovskia 768-28] Length = 311 Score = 36.4 bits (84), Expect = 1.4, Method: Composition-based stats. Identities = 9/30 (30%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Query: 14 EILVCPLTKG-NLTLISEGTELLSKKASLA 42 E LVCP ++ E EL+ + L Sbjct: 11 EKLVCPNCGSTDIVFDPERAELVCRHCGLV 40 >gi|157821673|ref|NP_001099800.1| hypothetical protein LOC293700 [Rattus norvegicus] gi|149062201|gb|EDM12624.1| similar to RIKEN cDNA 0610038D11 (predicted), isoform CRA_b [Rattus norvegicus] gi|187469110|gb|AAI66890.1| Similar to RIKEN cDNA 0610038D11 [Rattus norvegicus] gi|197245933|gb|AAI68764.1| Similar to RIKEN cDNA 0610038D11 [Rattus norvegicus] gi|197245988|gb|AAI68731.1| Similar to RIKEN cDNA 0610038D11 [Rattus norvegicus] gi|197246788|gb|AAI68762.1| Similar to RIKEN cDNA 0610038D11 [Rattus norvegicus] Length = 125 Score = 36.4 bits (84), Expect = 1.4, Method: Composition-based stats. Identities = 8/32 (25%), Positives = 16/32 (50%) Query: 25 LTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + L ++ +PI G+P ML+++ Sbjct: 89 LEVDVLEGTLQCPESGRLFPISRGIPNMLLND 120 >gi|261823936|ref|NP_080582.3| tRNA methyltransferase 112 homolog [Mus musculus] gi|261823938|ref|NP_001159842.1| tRNA methyltransferase 112 homolog [Mus musculus] gi|82896077|ref|XP_897794.1| PREDICTED: tRNA methyltransferase 112 homolog [Mus musculus] gi|309265174|ref|XP_003086453.1| PREDICTED: tRNA methyltransferase 112 homolog [Mus musculus] gi|47606210|sp|Q9DCG9|TR112_MOUSE RecName: Full=tRNA methyltransferase 112 homolog; AltName: Full=TRM112-like protein gi|12833034|dbj|BAB22361.1| unnamed protein product [Mus musculus] gi|148682916|gb|EDL14863.1| mCG132103 [Mus musculus] gi|148701311|gb|EDL33258.1| mCG130245, isoform CRA_a [Mus musculus] Length = 125 Score = 36.4 bits (84), Expect = 1.4, Method: Composition-based stats. Identities = 8/32 (25%), Positives = 16/32 (50%) Query: 25 LTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + L ++ +PI G+P ML+++ Sbjct: 89 LEVDVLEGTLQCPESGRLFPISRGIPNMLLND 120 >gi|167945058|ref|ZP_02532132.1| hypothetical protein Epers_00525 [Endoriftia persephone 'Hot96_1+Hot96_2'] Length = 237 Score = 36.4 bits (84), Expect = 1.4, Method: Composition-based stats. Identities = 8/27 (29%), Positives = 12/27 (44%), Gaps = 2/27 (7%) Query: 31 GTELLS--KKASLAYPIRSGVPIMLVS 55 L L YPI G+PI++ + Sbjct: 2 EGILHCSNPACQLEYPIIDGIPIIVPN 28 >gi|12833869|dbj|BAB22695.1| unnamed protein product [Mus musculus] Length = 125 Score = 36.4 bits (84), Expect = 1.4, Method: Composition-based stats. Identities = 8/32 (25%), Positives = 16/32 (50%) Query: 25 LTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + L ++ +PI G+P ML+++ Sbjct: 89 LEVDVLEGTLQCPESGRLFPISRGIPNMLLND 120 >gi|320526912|ref|ZP_08028102.1| zinc finger domain, LSD1 subclass [Solobacterium moorei F0204] gi|320132880|gb|EFW25420.1| zinc finger domain, LSD1 subclass [Solobacterium moorei F0204] Length = 364 Score = 36.4 bits (84), Expect = 1.4, Method: Composition-based stats. Identities = 7/26 (26%), Positives = 9/26 (34%) Query: 18 CPLTKGNLTLISEGTELLSKKASLAY 43 CP G LT +L A+ Sbjct: 11 CPNCNGPLTFDPGSQKLKCGNCGSAF 36 >gi|224007409|ref|XP_002292664.1| predicted protein [Thalassiosira pseudonana CCMP1335] gi|220971526|gb|EED89860.1| predicted protein [Thalassiosira pseudonana CCMP1335] Length = 115 Score = 36.4 bits (84), Expect = 1.4, Method: Composition-based stats. Identities = 5/26 (19%), Positives = 12/26 (46%) Query: 31 GTELLSKKASLAYPIRSGVPIMLVSE 56 L+ +P++ +P M++ E Sbjct: 87 EGWLICPDTGRRFPVKDSIPNMILHE 112 >gi|150018318|ref|YP_001310572.1| MerR family transcriptional regulator [Clostridium beijerinckii NCIMB 8052] gi|149904783|gb|ABR35616.1| putative transcriptional regulator, MerR family [Clostridium beijerinckii NCIMB 8052] Length = 405 Score = 36.4 bits (84), Expect = 1.5, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 21/56 (37%), Gaps = 9/56 (16%) Query: 2 RETIFNIDPQLLEILVCPLTKGNLTLISE--------GTELLSKKASLAYPIRSGV 49 ++I ID + L++L C K +L L +L Y I G+ Sbjct: 121 DKSIIGIDLKALDLLRCFKCKKDLKLREGNIANNQVINGKLTC-SCGEEYIIEDGI 175 >gi|332709258|ref|ZP_08429222.1| methylase involved in ubiquinone/menaquinone biosynthesis [Lyngbya majuscula 3L] gi|332351983|gb|EGJ31559.1| methylase involved in ubiquinone/menaquinone biosynthesis [Lyngbya majuscula 3L] Length = 331 Score = 36.4 bits (84), Expect = 1.5, Method: Composition-based stats. Identities = 9/42 (21%), Positives = 17/42 (40%) Query: 14 EILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVS 55 ++L CP +L I + + YP+ PI++ Sbjct: 20 DLLCCPCCLSSLESIKNQLRCTNYQCQKNYPVVQDKPILINE 61 >gi|313126285|ref|YP_004036555.1| transcription initiation factor iib (tfiib) [Halogeometricum borinquense DSM 11551] gi|312292650|gb|ADQ67110.1| Transcription initiation factor IIB (TFIIB) [Halogeometricum borinquense DSM 11551] Length = 330 Score = 36.4 bits (84), Expect = 1.5, Method: Composition-based stats. Identities = 7/26 (26%), Positives = 9/26 (34%) Query: 17 VCPLTKGNLTLISEGTELLSKKASLA 42 VCP G+L E + L Sbjct: 34 VCPECGGSLITDEARGETVCGDCGLV 59 >gi|71024417|ref|XP_762438.1| hypothetical protein UM06291.1 [Ustilago maydis 521] gi|46097687|gb|EAK82920.1| hypothetical protein UM06291.1 [Ustilago maydis 521] Length = 209 Score = 36.4 bits (84), Expect = 1.5, Method: Composition-based stats. Identities = 11/32 (34%), Positives = 18/32 (56%) Query: 25 LTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + +++ S Y IRSG+P ML++E Sbjct: 173 LEIHVVEGQMICPNCSHIYQIRSGIPNMLLAE 204 >gi|62859907|ref|NP_001016673.1| tRNA methyltransferase 11-2 homolog [Xenopus (Silurana) tropicalis] gi|140832805|gb|AAI35640.1| hypothetical protein LOC549427 [Xenopus (Silurana) tropicalis] Length = 123 Score = 36.4 bits (84), Expect = 1.6, Method: Composition-based stats. Identities = 9/32 (28%), Positives = 16/32 (50%) Query: 25 LTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + L ++ +PI G+P ML++E Sbjct: 89 LEVEVIEGALKCPESGTEFPITRGIPNMLINE 120 >gi|238577289|ref|XP_002388341.1| hypothetical protein MPER_12648 [Moniliophthora perniciosa FA553] gi|215449533|gb|EEB89271.1| hypothetical protein MPER_12648 [Moniliophthora perniciosa FA553] Length = 134 Score = 36.0 bits (83), Expect = 1.6, Method: Composition-based stats. Identities = 9/29 (31%), Positives = 15/29 (51%) Query: 25 LTLISEGTELLSKKASLAYPIRSGVPIML 53 L + E ++ S YPI +G+P M+ Sbjct: 78 LEIHVEDGIMICPNCSHNYPISNGIPNMI 106 >gi|332250132|ref|XP_003274207.1| PREDICTED: tRNA methyltransferase 112 homolog isoform 1 [Nomascus leucogenys] gi|332250134|ref|XP_003274208.1| PREDICTED: tRNA methyltransferase 112 homolog isoform 2 [Nomascus leucogenys] Length = 141 Score = 36.0 bits (83), Expect = 1.6, Method: Composition-based stats. Identities = 10/32 (31%), Positives = 16/32 (50%) Query: 25 LTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + L ++ +PI G+P ML+SE Sbjct: 105 LEVEVIEGTLQCPESGRIFPISRGIPNMLLSE 136 >gi|195998339|ref|XP_002109038.1| hypothetical protein TRIADDRAFT_52665 [Trichoplax adhaerens] gi|190589814|gb|EDV29836.1| hypothetical protein TRIADDRAFT_52665 [Trichoplax adhaerens] Length = 124 Score = 36.0 bits (83), Expect = 1.7, Method: Composition-based stats. Identities = 8/32 (25%), Positives = 16/32 (50%) Query: 25 LTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + + L+ + + I +G+P ML+ E Sbjct: 89 LEVEVKEGHLICPTSKKKFQISNGIPNMLLGE 120 >gi|312370917|gb|EFR19217.1| hypothetical protein AND_31069 [Anopheles darlingi] Length = 88 Score = 36.0 bits (83), Expect = 1.7, Method: Composition-based stats. Identities = 10/32 (31%), Positives = 16/32 (50%) Query: 25 LTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + L + +PI +GVP ML++E Sbjct: 54 LEVDVIEGTLECPETGRVFPINNGVPNMLLNE 85 >gi|55978273|ref|YP_145329.1| hypothetical protein TTHB090 [Thermus thermophilus HB8] gi|55773446|dbj|BAD71886.1| conserved hypothetical protein [Thermus thermophilus HB8] Length = 250 Score = 36.0 bits (83), Expect = 1.7, Method: Composition-based stats. Identities = 9/38 (23%), Positives = 13/38 (34%), Gaps = 6/38 (15%) Query: 11 QLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSG 48 LL +L CP +G L +P + G Sbjct: 22 WLLPLLACPFCRGPLLGEG------CPGCGRVFPRKGG 53 >gi|55596061|ref|XP_525713.1| PREDICTED: tRNA methyltransferase 112 homolog [Pan troglodytes] Length = 135 Score = 36.0 bits (83), Expect = 1.8, Method: Composition-based stats. Identities = 10/32 (31%), Positives = 16/32 (50%) Query: 25 LTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + L ++ +PI G+P ML+SE Sbjct: 99 LEVEVIEGTLQCPESGRMFPISRGIPNMLLSE 130 >gi|260790207|ref|XP_002590135.1| hypothetical protein BRAFLDRAFT_83415 [Branchiostoma floridae] gi|229275323|gb|EEN46146.1| hypothetical protein BRAFLDRAFT_83415 [Branchiostoma floridae] Length = 123 Score = 36.0 bits (83), Expect = 1.8, Method: Composition-based stats. Identities = 8/26 (30%), Positives = 15/26 (57%) Query: 31 GTELLSKKASLAYPIRSGVPIMLVSE 56 L + +PI++G+P ML++E Sbjct: 95 EGNLECPETGRKFPIKNGIPNMLLNE 120 >gi|148673342|gb|EDL05289.1| mCG12532 [Mus musculus] Length = 125 Score = 36.0 bits (83), Expect = 1.8, Method: Composition-based stats. Identities = 8/32 (25%), Positives = 16/32 (50%) Query: 25 LTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + L ++ +PI G+P ML+++ Sbjct: 89 LEVDVLEGTLQCPESGRLFPISRGIPNMLLND 120 >gi|257389069|ref|YP_003178842.1| transcription factor TFIIB cyclin-related [Halomicrobium mukohataei DSM 12286] gi|257171376|gb|ACV49135.1| Transcription factor TFIIB cyclin-related [Halomicrobium mukohataei DSM 12286] Length = 327 Score = 36.0 bits (83), Expect = 1.8, Method: Composition-based stats. Identities = 7/26 (26%), Positives = 10/26 (38%) Query: 17 VCPLTKGNLTLISEGTELLSKKASLA 42 CP G L + E E + + L Sbjct: 31 ACPECSGTLVVDDEHGETVCEDCGLV 56 >gi|221115556|ref|XP_002163537.1| PREDICTED: similar to predicted protein [Hydra magnipapillata] gi|221136260|ref|XP_002154900.1| PREDICTED: similar to predicted protein [Hydra magnipapillata] Length = 126 Score = 36.0 bits (83), Expect = 1.8, Method: Composition-based stats. Identities = 8/26 (30%), Positives = 13/26 (50%) Query: 31 GTELLSKKASLAYPIRSGVPIMLVSE 56 L+ + +PI G+P ML+ E Sbjct: 98 EGNLICPETGRKFPISKGIPNMLLKE 123 >gi|76801766|ref|YP_326774.1| transcription initiation factor TFB 3 [Natronomonas pharaonis DSM 2160] gi|76557631|emb|CAI49214.1| transcription initiation factor TFB 3 [Natronomonas pharaonis DSM 2160] Length = 319 Score = 36.0 bits (83), Expect = 1.8, Method: Composition-based stats. Identities = 7/25 (28%), Positives = 10/25 (40%) Query: 18 CPLTKGNLTLISEGTELLSKKASLA 42 CP G L +E E + + L Sbjct: 24 CPECGGKLAADTEHGETVCRDCGLV 48 >gi|296138900|ref|YP_003646143.1| methyltransferase type 11 [Tsukamurella paurometabola DSM 20162] gi|296027034|gb|ADG77804.1| Methyltransferase type 11 [Tsukamurella paurometabola DSM 20162] Length = 285 Score = 36.0 bits (83), Expect = 1.9, Method: Composition-based stats. Identities = 11/37 (29%), Positives = 16/37 (43%), Gaps = 4/37 (10%) Query: 13 LEILVCPLTKGNLTLISEGTELLSKKASLAYPI-RSG 48 L L CP L ++G L+ + A+ I R G Sbjct: 12 LPALACPHCG--LEFDADGGTLVCPR-GHAFDIARQG 45 >gi|57234913|ref|YP_181084.1| primosomal protein N' [Dehalococcoides ethenogenes 195] gi|57225361|gb|AAW40418.1| primosomal protein N' [Dehalococcoides ethenogenes 195] Length = 815 Score = 36.0 bits (83), Expect = 1.9, Method: Composition-based stats. Identities = 6/27 (22%), Positives = 9/27 (33%) Query: 18 CPLTKGNLTLISEGTELLSKKASLAYP 44 C LT + L+ + YP Sbjct: 537 CKSCDAPLTYHPDQENLVCHQCGRHYP 563 >gi|55378612|ref|YP_136462.1| transcription initiation factor IIB [Haloarcula marismortui ATCC 43049] gi|55231337|gb|AAV46756.1| transcription initiation factor IIB [Haloarcula marismortui ATCC 43049] Length = 321 Score = 36.0 bits (83), Expect = 2.0, Method: Composition-based stats. Identities = 7/26 (26%), Positives = 11/26 (42%) Query: 17 VCPLTKGNLTLISEGTELLSKKASLA 42 CP G+L + E E + + L Sbjct: 25 ACPECSGSLVIDDEHGETVCEDCGLV 50 >gi|326334229|ref|ZP_08200452.1| MutT/NUDIX family protein [Nocardioidaceae bacterium Broad-1] gi|325948020|gb|EGD40137.1| MutT/NUDIX family protein [Nocardioidaceae bacterium Broad-1] Length = 303 Score = 36.0 bits (83), Expect = 2.0, Method: Composition-based stats. Identities = 13/46 (28%), Positives = 19/46 (41%) Query: 18 CPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 C G+L + G EL + L +P IMLV+ D+ Sbjct: 131 CSRCGGSLVPRAAGHELACPEGHLTFPRTDPAVIMLVTSGEPGTDE 176 >gi|46255116|ref|YP_006028.1| hypothetical protein TT_P0045 [Thermus thermophilus HB27] gi|46197965|gb|AAS82375.1| hypothetical conserved protein [Thermus thermophilus HB27] Length = 250 Score = 36.0 bits (83), Expect = 2.0, Method: Composition-based stats. Identities = 9/38 (23%), Positives = 13/38 (34%), Gaps = 6/38 (15%) Query: 11 QLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSG 48 LL +L CP +G L +P + G Sbjct: 22 WLLPLLACPFCRGPLLGEG------CPGCGRVFPRKGG 53 >gi|57099691|ref|XP_533242.1| PREDICTED: similar to UPF0315 protein [Canis familiaris] Length = 125 Score = 36.0 bits (83), Expect = 2.0, Method: Composition-based stats. Identities = 9/32 (28%), Positives = 16/32 (50%) Query: 25 LTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + L ++ +PI G+P ML+S+ Sbjct: 89 LEVDVLEGTLQCPESGRLFPISRGIPNMLLSD 120 >gi|291333532|gb|ADD93228.1| transcription initiation factor IIB [uncultured archaeon MedDCM-OCT-S08-C54] Length = 311 Score = 35.6 bits (82), Expect = 2.1, Method: Composition-based stats. Identities = 9/37 (24%), Positives = 14/37 (37%), Gaps = 3/37 (8%) Query: 14 EILVCPLTKGN-LTLISEGTELLSKKASLAYPIRSGV 49 EI CP KG L + E++ L + + Sbjct: 12 EITACPDCKGTHLKRDYDHAEIVCADCGLV--LEDNI 46 >gi|213410383|ref|XP_002175961.1| trm112 [Schizosaccharomyces japonicus yFS275] gi|212004008|gb|EEB09668.1| trm112 [Schizosaccharomyces japonicus yFS275] Length = 126 Score = 35.6 bits (82), Expect = 2.1, Method: Composition-based stats. Identities = 10/32 (31%), Positives = 14/32 (43%) Query: 25 LTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L ++ YPI G+P ML+SE Sbjct: 92 LETEITEGKMTCGSCGHVYPIVEGIPNMLLSE 123 >gi|55378144|ref|YP_135994.1| transcription initiation factor IIB [Haloarcula marismortui ATCC 43049] gi|55230869|gb|AAV46288.1| transcription initiation factor IIB [Haloarcula marismortui ATCC 43049] Length = 324 Score = 35.6 bits (82), Expect = 2.2, Method: Composition-based stats. Identities = 10/27 (37%), Positives = 12/27 (44%) Query: 16 LVCPLTKGNLTLISEGTELLSKKASLA 42 LVCP G L SE E + + L Sbjct: 28 LVCPECSGALLSDSERGETVCEDCGLV 54 >gi|221633589|ref|YP_002522815.1| primosomal protein N' [Thermomicrobium roseum DSM 5159] gi|221156444|gb|ACM05571.1| primosomal protein N' [Thermomicrobium roseum DSM 5159] Length = 812 Score = 35.6 bits (82), Expect = 2.3, Method: Composition-based stats. Identities = 7/26 (26%), Positives = 12/26 (46%) Query: 17 VCPLTKGNLTLISEGTELLSKKASLA 42 VCPL L ++ +L+ + L Sbjct: 533 VCPLCDVPLVYHADRRQLICHRCDLR 558 >gi|219116566|ref|XP_002179078.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1] gi|217409845|gb|EEC49776.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1] Length = 130 Score = 35.6 bits (82), Expect = 2.3, Method: Composition-based stats. Identities = 8/26 (30%), Positives = 13/26 (50%) Query: 31 GTELLSKKASLAYPIRSGVPIMLVSE 56 L+ +PI+ GVP M++ E Sbjct: 102 EGHLVCPDTGRKFPIKEGVPNMILHE 127 >gi|219851004|ref|YP_002465436.1| transcription initiation factor IIB [Methanosphaerula palustris E1-9c] gi|254784087|sp|B8GJQ9|TF2B_METPE RecName: Full=Transcription initiation factor IIB; Short=TFIIB gi|219545263|gb|ACL15713.1| Transcription factor TFIIB cyclin-related [Methanosphaerula palustris E1-9c] Length = 334 Score = 35.6 bits (82), Expect = 2.3, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 12/33 (36%), Gaps = 3/33 (9%) Query: 17 VCPLTKGN-LTLISEGTELLSKKASLAYPIRSG 48 VCP K L E EL+ + L I Sbjct: 37 VCPECKSRQLVHDYERAELVCQNCGLV--IDDD 67 >gi|154151850|ref|YP_001405468.1| transcription initiation factor IIB [Candidatus Methanoregula boonei 6A8] gi|189029854|sp|A7IAR4|TF2B_METB6 RecName: Full=Transcription initiation factor IIB; Short=TFIIB gi|154000402|gb|ABS56825.1| Transcription factor TFIIB, cyclin-related [Methanoregula boonei 6A8] Length = 334 Score = 35.6 bits (82), Expect = 2.3, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 12/33 (36%), Gaps = 3/33 (9%) Query: 17 VCPLTKGN-LTLISEGTELLSKKASLAYPIRSG 48 VCP G L E EL+ + L I Sbjct: 37 VCPECGGRQLVHDYERAELVCQSCGLV--IDDD 67 >gi|270307709|ref|YP_003329767.1| primosomal protein N, (replication factor Y) (superfamily II helicase) [Dehalococcoides sp. VS] gi|270153601|gb|ACZ61439.1| primosomal protein N, (replication factor Y) (superfamily II helicase) [Dehalococcoides sp. VS] Length = 815 Score = 35.6 bits (82), Expect = 2.3, Method: Composition-based stats. Identities = 6/27 (22%), Positives = 9/27 (33%) Query: 18 CPLTKGNLTLISEGTELLSKKASLAYP 44 C LT + L+ + YP Sbjct: 537 CKSCDAPLTYHPDQENLVCHQCGRQYP 563 >gi|296242988|ref|YP_003650475.1| zinc finger TFIIB-type domain-containing protein [Thermosphaera aggregans DSM 11486] gi|296095572|gb|ADG91523.1| Zinc finger TFIIB-type domain protein [Thermosphaera aggregans DSM 11486] Length = 203 Score = 35.6 bits (82), Expect = 2.4, Method: Composition-based stats. Identities = 7/41 (17%), Positives = 13/41 (31%), Gaps = 7/41 (17%) Query: 18 CPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEAR 58 CP+ L ++ L + + + EAR Sbjct: 6 CPVCGNPLVWDYRDGFVVCSGCGL---VVENI----IEEAR 39 >gi|307594882|ref|YP_003901199.1| Zinc finger TFIIB-type domain-containing protein [Vulcanisaeta distributa DSM 14429] gi|307550083|gb|ADN50148.1| Zinc finger TFIIB-type domain protein [Vulcanisaeta distributa DSM 14429] Length = 311 Score = 35.6 bits (82), Expect = 2.5, Method: Composition-based stats. Identities = 9/30 (30%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Query: 14 EILVCPLTKG-NLTLISEGTELLSKKASLA 42 E LVCP + ++ E EL+ + L Sbjct: 11 EKLVCPNCESTDIVFDPERGELVCRHCGLV 40 >gi|310823351|ref|YP_003955709.1| type 11 methyltransferase [Stigmatella aurantiaca DW4/3-1] gi|309396423|gb|ADO73882.1| Methyltransferase type 11 [Stigmatella aurantiaca DW4/3-1] Length = 265 Score = 35.6 bits (82), Expect = 2.5, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 16/33 (48%), Gaps = 3/33 (9%) Query: 17 VCPLTKGNLTLISEGTELLSKKASLAYPIRSGV 49 VCP +G L EG E + +P++ GV Sbjct: 13 VCPRCRGKLL---EGPEPTCSQCRTPFPVQDGV 42 >gi|325959626|ref|YP_004291092.1| hypothetical protein Metbo_1900 [Methanobacterium sp. AL-21] gi|325331058|gb|ADZ10120.1| hypothetical protein Metbo_1900 [Methanobacterium sp. AL-21] Length = 145 Score = 35.6 bits (82), Expect = 2.5, Method: Composition-based stats. Identities = 9/46 (19%), Positives = 14/46 (30%), Gaps = 3/46 (6%) Query: 18 CPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 CPL K L EL + + +P V + + Sbjct: 8 CPLCKQKLEF---HGELFKCSCGNTFNLLDDIPYFWVDNGKTREMD 50 >gi|327290845|ref|XP_003230132.1| PREDICTED: tRNA methyltransferase 112 homolog isoform 2 [Anolis carolinensis] Length = 121 Score = 35.6 bits (82), Expect = 2.6, Method: Composition-based stats. Identities = 9/26 (34%), Positives = 12/26 (46%) Query: 31 GTELLSKKASLAYPIRSGVPIMLVSE 56 L +PI G+P ML+SE Sbjct: 93 EGVLKCPDTGREFPITKGIPNMLLSE 118 >gi|327290843|ref|XP_003230131.1| PREDICTED: tRNA methyltransferase 112 homolog isoform 1 [Anolis carolinensis] Length = 125 Score = 35.6 bits (82), Expect = 2.6, Method: Composition-based stats. Identities = 9/26 (34%), Positives = 12/26 (46%) Query: 31 GTELLSKKASLAYPIRSGVPIMLVSE 56 L +PI G+P ML+SE Sbjct: 97 EGVLKCPDTGREFPITKGIPNMLLSE 122 >gi|322824540|gb|EFZ29919.1| hypothetical protein TCSYLVIO_3801 [Trypanosoma cruzi] Length = 127 Score = 35.6 bits (82), Expect = 2.7, Method: Composition-based stats. Identities = 7/25 (28%), Positives = 13/25 (52%) Query: 31 GTELLSKKASLAYPIRSGVPIMLVS 55 L+ ++ YPIR +P M++ Sbjct: 101 NGRLVCQQCQREYPIRDFIPDMVIE 125 >gi|255513741|gb|EET90006.1| Transcription factor TFIIB cyclin-related [Candidatus Micrarchaeum acidiphilum ARMAN-2] Length = 380 Score = 35.6 bits (82), Expect = 2.7, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 12/34 (35%), Gaps = 3/34 (8%) Query: 17 VCPLTKGN-LTLISEGTELLSKKASLAYPIRSGV 49 VCP L SE EL+ L I V Sbjct: 83 VCPSCGSTALIFDSERGELVCNNCGLV--IEENV 114 >gi|145591944|ref|YP_001153946.1| zinc finger TFIIB-type domain-containing protein [Pyrobaculum arsenaticum DSM 13514] gi|145283712|gb|ABP51294.1| Zinc finger, TFIIB-type domain protein [Pyrobaculum arsenaticum DSM 13514] Length = 298 Score = 35.6 bits (82), Expect = 2.7, Method: Composition-based stats. Identities = 9/41 (21%), Positives = 19/41 (46%), Gaps = 4/41 (9%) Query: 17 VCPLT--KGNLTLISEGTELLSKKASLAYPIRSGVPIMLVS 55 VCP+ KG +T+ E +++ + +R G+ + Sbjct: 13 VCPVCGSKGEITIDHERGQVVCRACGTV--VREGIADLGPE 51 >gi|71654515|ref|XP_815875.1| hypothetical protein [Trypanosoma cruzi strain CL Brener] gi|70880964|gb|EAN94024.1| hypothetical protein, conserved [Trypanosoma cruzi] Length = 127 Score = 35.2 bits (81), Expect = 2.7, Method: Composition-based stats. Identities = 7/25 (28%), Positives = 13/25 (52%) Query: 31 GTELLSKKASLAYPIRSGVPIMLVS 55 L+ ++ YPIR +P M++ Sbjct: 101 NGRLVCQQCQREYPIRDFIPDMVIE 125 >gi|206895799|ref|YP_002247300.1| hypothetical protein COPRO5265_0980 [Coprothermobacter proteolyticus DSM 5265] gi|206738416|gb|ACI17494.1| hypothetical protein COPRO5265_0980 [Coprothermobacter proteolyticus DSM 5265] Length = 630 Score = 35.2 bits (81), Expect = 2.7, Method: Composition-based stats. Identities = 6/27 (22%), Positives = 7/27 (25%) Query: 15 ILVCPLTKGNLTLISEGTELLSKKASL 41 IL CP L L + Sbjct: 409 ILTCPECGTPLRYHRRSKRLECHRCGY 435 >gi|115373473|ref|ZP_01460770.1| hypothetical protein STIAU_3286 [Stigmatella aurantiaca DW4/3-1] gi|115369479|gb|EAU68417.1| hypothetical protein STIAU_3286 [Stigmatella aurantiaca DW4/3-1] Length = 427 Score = 35.2 bits (81), Expect = 2.7, Method: Composition-based stats. Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 3/39 (7%) Query: 15 ILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIML 53 IL CP + G L L +L S+ L YP+ +G P+++ Sbjct: 11 ILRCPRSHGRLHLRD--GQLASESGEL-YPLVNGKPVLV 46 >gi|71405578|ref|XP_805396.1| hypothetical protein [Trypanosoma cruzi strain CL Brener] gi|70868789|gb|EAN83545.1| hypothetical protein, conserved [Trypanosoma cruzi] Length = 127 Score = 35.2 bits (81), Expect = 2.7, Method: Composition-based stats. Identities = 7/25 (28%), Positives = 13/25 (52%) Query: 31 GTELLSKKASLAYPIRSGVPIMLVS 55 L+ ++ YPIR +P M++ Sbjct: 101 NGRLVCQQCQREYPIRDFIPDMVIE 125 >gi|303274789|ref|XP_003056709.1| predicted protein [Micromonas pusilla CCMP1545] gi|226461061|gb|EEH58354.1| predicted protein [Micromonas pusilla CCMP1545] Length = 384 Score = 35.2 bits (81), Expect = 2.8, Method: Composition-based stats. Identities = 8/36 (22%), Positives = 14/36 (38%), Gaps = 5/36 (13%) Query: 15 ILVCPLTKGNLTLISEGTELLSKKASL-AYPIRSGV 49 +L CP+ L + + AYP + G+ Sbjct: 63 LLACPICLTPF----PAGSLRCARCARDAYPTKDGI 94 >gi|292655824|ref|YP_003535721.1| transcription initiation factor TFB [Haloferax volcanii DS2] gi|14195256|sp|Q9YGA5|TFB2_HALVO RecName: Full=Transcription initiation factor IIB 2; Short=TFIIB 2 gi|5410473|gb|AAD43074.1|AF143693_1 transcription factor B [Haloferax volcanii] gi|291372841|gb|ADE05068.1| transcription initiation factor TFB [Haloferax volcanii DS2] Length = 332 Score = 35.2 bits (81), Expect = 2.8, Method: Composition-based stats. Identities = 8/26 (30%), Positives = 11/26 (42%) Query: 17 VCPLTKGNLTLISEGTELLSKKASLA 42 VCP G+L E E + + L Sbjct: 36 VCPECSGHLVTDEEHGETICEDCGLV 61 >gi|147668962|ref|YP_001213780.1| primosomal protein N' [Dehalococcoides sp. BAV1] gi|146269910|gb|ABQ16902.1| replication restart DNA helicase PriA [Dehalococcoides sp. BAV1] Length = 815 Score = 35.2 bits (81), Expect = 2.8, Method: Composition-based stats. Identities = 6/27 (22%), Positives = 9/27 (33%) Query: 18 CPLTKGNLTLISEGTELLSKKASLAYP 44 C LT + L+ + YP Sbjct: 537 CKSCDTPLTYHPDQENLVCHQCGRHYP 563 >gi|238916313|ref|YP_002929830.1| hypothetical protein EUBELI_00347 [Eubacterium eligens ATCC 27750] gi|238871673|gb|ACR71383.1| Hypothetical protein EUBELI_00347 [Eubacterium eligens ATCC 27750] Length = 520 Score = 35.2 bits (81), Expect = 2.9, Method: Composition-based stats. Identities = 5/28 (17%), Positives = 9/28 (32%) Query: 18 CPLTKGNLTLISEGTELLSKKASLAYPI 45 CP L + +L + Y + Sbjct: 4 CPGCGAELKYDIKTGKLRCSRCGNKYDV 31 >gi|239934146|ref|ZP_04691099.1| methyltransferase type 11 [Streptomyces ghanaensis ATCC 14672] gi|291442589|ref|ZP_06581979.1| methyltransferase type 11 [Streptomyces ghanaensis ATCC 14672] gi|291345484|gb|EFE72440.1| methyltransferase type 11 [Streptomyces ghanaensis ATCC 14672] Length = 504 Score = 35.2 bits (81), Expect = 2.9, Method: Composition-based stats. Identities = 8/31 (25%), Positives = 14/31 (45%), Gaps = 2/31 (6%) Query: 14 EILVCPLTKGNLTLISEGTELLSKKASLAYP 44 ++L CP +G L+ G + +YP Sbjct: 242 DVLCCPACRGTLSFEDSGAA--CGACARSYP 270 >gi|15790009|ref|NP_279833.1| transcription initiation factor IIB [Halobacterium sp. NRC-1] gi|169235732|ref|YP_001688932.1| transcription initiation factor TFB [Halobacterium salinarum R1] gi|14195245|sp|Q9HR45|TF2B4_HALSA RecName: Full=Transcription initiation factor IIB 4; Short=TFIIB 4 gi|10580433|gb|AAG19313.1| transcription initiation factor IIB [Halobacterium sp. NRC-1] gi|167726798|emb|CAP13584.1| transcription initiation factor TFB [Halobacterium salinarum R1] Length = 328 Score = 35.2 bits (81), Expect = 2.9, Method: Composition-based stats. Identities = 7/32 (21%), Positives = 11/32 (34%), Gaps = 1/32 (3%) Query: 18 CPLTKGNLTLISEGTELLSKKASLAYPIRSGV 49 CP G+L + E + L G+ Sbjct: 32 CPECNGDLVTDEDRGETTCGECGLVVE-EDGI 62 >gi|289432237|ref|YP_003462110.1| primosomal protein N' [Dehalococcoides sp. GT] gi|288945957|gb|ADC73654.1| primosomal protein N' [Dehalococcoides sp. GT] Length = 815 Score = 35.2 bits (81), Expect = 3.0, Method: Composition-based stats. Identities = 6/27 (22%), Positives = 9/27 (33%) Query: 18 CPLTKGNLTLISEGTELLSKKASLAYP 44 C LT + L+ + YP Sbjct: 537 CKSCDTPLTYHPDQENLVCHQCGRHYP 563 >gi|73748187|ref|YP_307426.1| primosomal protein N' [Dehalococcoides sp. CBDB1] gi|73659903|emb|CAI82510.1| primosomal protein N' [Dehalococcoides sp. CBDB1] Length = 815 Score = 35.2 bits (81), Expect = 3.0, Method: Composition-based stats. Identities = 6/27 (22%), Positives = 9/27 (33%) Query: 18 CPLTKGNLTLISEGTELLSKKASLAYP 44 C LT + L+ + YP Sbjct: 537 CKSCDTPLTYHPDQENLVCHQCGRHYP 563 >gi|7705477|ref|NP_057488.1| tRNA methyltransferase 112 homolog [Homo sapiens] gi|114638303|ref|XP_522051.2| PREDICTED: similar to adrenal gland protein AD-001 isoform 2 [Pan troglodytes] gi|114638305|ref|XP_001164844.1| PREDICTED: similar to adrenal gland protein AD-001 isoform 1 [Pan troglodytes] gi|297688289|ref|XP_002821618.1| PREDICTED: tRNA methyltransferase 112 homolog [Pongo abelii] gi|47606219|sp|Q9UI30|TR112_HUMAN RecName: Full=tRNA methyltransferase 112 homolog; AltName: Full=TRM112-like protein gi|6523795|gb|AAF14857.1|AF110774_1 adrenal gland protein AD-001 [Homo sapiens] gi|6841526|gb|AAF29116.1|AF161501_1 HSPC152 [Homo sapiens] gi|8980669|gb|AAF82266.1|AF229068_1 HSPC170 protein [Homo sapiens] gi|16877890|gb|AAH17172.1| Hypothetical protein HSPC152 [Homo sapiens] gi|75991684|gb|AAI05295.1| Hypothetical protein HSPC152 [Homo sapiens] gi|119594657|gb|EAW74251.1| hypothetical protein HSPC152, isoform CRA_a [Homo sapiens] gi|119594658|gb|EAW74252.1| hypothetical protein HSPC152, isoform CRA_a [Homo sapiens] gi|123982892|gb|ABM83187.1| hypothetical protein HSPC152 [synthetic construct] gi|123997575|gb|ABM86389.1| hypothetical protein HSPC152 [synthetic construct] gi|189065263|dbj|BAG34986.1| unnamed protein product [Homo sapiens] Length = 125 Score = 35.2 bits (81), Expect = 3.1, Method: Composition-based stats. Identities = 10/32 (31%), Positives = 16/32 (50%) Query: 25 LTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + L ++ +PI G+P ML+SE Sbjct: 89 LEVEVIEGTLQCPESGRMFPISRGIPNMLLSE 120 >gi|195017114|ref|XP_001984541.1| GH16524 [Drosophila grimshawi] gi|195066251|ref|XP_001996788.1| GH12113 [Drosophila grimshawi] gi|193898023|gb|EDV96889.1| GH16524 [Drosophila grimshawi] gi|193899798|gb|EDV98664.1| GH12113 [Drosophila grimshawi] Length = 124 Score = 35.2 bits (81), Expect = 3.1, Method: Composition-based stats. Identities = 7/21 (33%), Positives = 12/21 (57%) Query: 36 SKKASLAYPIRSGVPIMLVSE 56 + +PI G+P ML++E Sbjct: 101 CPETGRIFPITDGIPNMLLNE 121 >gi|269215828|ref|ZP_06159682.1| conserved hypothetical protein [Slackia exigua ATCC 700122] gi|269130778|gb|EEZ61854.1| conserved hypothetical protein [Slackia exigua ATCC 700122] Length = 477 Score = 35.2 bits (81), Expect = 3.1, Method: Composition-based stats. Identities = 5/25 (20%), Positives = 7/25 (28%) Query: 18 CPLTKGNLTLISEGTELLSKKASLA 42 CP G + L+ A Sbjct: 10 CPSCGGTMRYDGASGRLVCDFCGTA 34 >gi|109105577|ref|XP_001114960.1| PREDICTED: tRNA methyltransferase 112 homolog [Macaca mulatta] Length = 125 Score = 35.2 bits (81), Expect = 3.2, Method: Composition-based stats. Identities = 10/32 (31%), Positives = 16/32 (50%) Query: 25 LTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + L ++ +PI G+P ML+SE Sbjct: 89 LEVEVIEGTLQCPESGRMFPISRGIPNMLLSE 120 >gi|254463822|ref|ZP_05077233.1| conserved hypothetical protein [Rhodobacterales bacterium Y4I] gi|206684730|gb|EDZ45212.1| conserved hypothetical protein [Rhodobacterales bacterium Y4I] Length = 373 Score = 35.2 bits (81), Expect = 3.3, Method: Composition-based stats. Identities = 6/31 (19%), Positives = 9/31 (29%) Query: 18 CPLTKGNLTLISEGTELLSKKASLAYPIRSG 48 CP + L+ +RSG Sbjct: 22 CPNCGADYRFDPNAGALICDHCGHREEVRSG 52 >gi|89268726|emb|CAJ83344.1| novel protein [Xenopus (Silurana) tropicalis] Length = 80 Score = 35.2 bits (81), Expect = 3.3, Method: Composition-based stats. Identities = 9/32 (28%), Positives = 16/32 (50%) Query: 25 LTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + L ++ +PI G+P ML++E Sbjct: 46 LEVEVIEGALKCPESGTEFPITRGIPNMLINE 77 >gi|547962|sp|P37000|MYRA_MICGR RecName: Full=Mycinamicin-resistance protein myrA gi|303645|dbj|BAA03674.1| myrA [Micromonospora griseorubida] Length = 295 Score = 35.2 bits (81), Expect = 3.3, Method: Composition-based stats. Identities = 12/44 (27%), Positives = 16/44 (36%), Gaps = 4/44 (9%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGT--ELLSKKASLAYPI-RSG 48 + P LL L CP+ L L A ++ I R G Sbjct: 1 MHPDLLPHLRCPVCGQPLHQADAAPPRALRCP-AGHSFDIARQG 43 >gi|255578059|ref|XP_002529900.1| isoamylase, putative [Ricinus communis] gi|223530627|gb|EEF32503.1| isoamylase, putative [Ricinus communis] Length = 795 Score = 35.2 bits (81), Expect = 3.4, Method: Composition-based stats. Identities = 6/22 (27%), Positives = 12/22 (54%) Query: 35 LSKKASLAYPIRSGVPIMLVSE 56 + + +P+ G+P ML+ E Sbjct: 770 VCPETGRKFPVNKGIPNMLLQE 791 >gi|322371186|ref|ZP_08045738.1| Transcription factor TFIIB cyclin-related protein [Haladaptatus paucihalophilus DX253] gi|320549176|gb|EFW90838.1| Transcription factor TFIIB cyclin-related protein [Haladaptatus paucihalophilus DX253] Length = 357 Score = 35.2 bits (81), Expect = 3.5, Method: Composition-based stats. Identities = 9/34 (26%), Positives = 14/34 (41%), Gaps = 3/34 (8%) Query: 17 VCPLTKGNLTLISEGTELLSKKASLAYPIR-SGV 49 CP G+L SE E + + L + G+ Sbjct: 50 RCPECGGSLVTDSEHAETVCSQCGLV--VEADGI 81 >gi|124027349|ref|YP_001012669.1| transcription initiation factor IIB [Hyperthermus butylicus DSM 5456] gi|123978043|gb|ABM80324.1| transcription initiation factor IIB [Hyperthermus butylicus DSM 5456] Length = 297 Score = 35.2 bits (81), Expect = 3.5, Method: Composition-based stats. Identities = 10/48 (20%), Positives = 19/48 (39%), Gaps = 5/48 (10%) Query: 18 CPLTKGNLTL--ISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 CP+ K L L +G++L+ + P+ E R ++ Sbjct: 12 CPVCKAPLKLYAKRDGSKLVCTNCGY---VIDDAPLDTGPEWRSYTEE 56 >gi|15789908|ref|NP_279732.1| transcription initiation factor IIB [Halobacterium sp. NRC-1] gi|169235629|ref|YP_001688829.1| transcription initiation factor TFB [Halobacterium salinarum R1] gi|14195246|sp|Q9HRE6|TF2B2_HALSA RecName: Full=Transcription initiation factor IIB 2; Short=TFIIB 2 gi|10580312|gb|AAG19212.1| transcription initiation factor IIB [Halobacterium sp. NRC-1] gi|167726695|emb|CAP13481.1| transcription initiation factor TFB [Halobacterium salinarum R1] Length = 325 Score = 35.2 bits (81), Expect = 3.5, Method: Composition-based stats. Identities = 7/29 (24%), Positives = 11/29 (37%) Query: 14 EILVCPLTKGNLTLISEGTELLSKKASLA 42 ++L CP G + E E + L Sbjct: 28 DVLTCPECGGQVIDDEEHGESVCVDCGLV 56 >gi|19113826|ref|NP_592914.1| tRNA (guanine-N2-)-methyltransferase regulatory subunit Trm112 (predicted) [Schizosaccharomyces pombe 972h-] gi|1175395|sp|Q09723|TR112_SCHPO RecName: Full=Multifunctional methyltransferase subunit trm112; AltName: Full=eRF1 methyltransferase subunit trm112; Short=eRF1 MTase subunit trm112; AltName: Full=tRNA methyltransferase 112 gi|914880|emb|CAA90460.1| tRNA (guanine-N2-)-methyltransferase regulatory subunit Trm112 (predicted) [Schizosaccharomyces pombe] Length = 126 Score = 34.8 bits (80), Expect = 3.6, Method: Composition-based stats. Identities = 10/32 (31%), Positives = 15/32 (46%) Query: 25 LTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L +++ YPI G+P ML+SE Sbjct: 92 LETEITEGKMVCGNCGHVYPIFEGIPNMLLSE 123 >gi|242398518|ref|YP_002993942.1| Transcription initiation factor IIB [Thermococcus sibiricus MM 739] gi|242264911|gb|ACS89593.1| Transcription initiation factor IIB [Thermococcus sibiricus MM 739] Length = 299 Score = 34.8 bits (80), Expect = 3.7, Method: Composition-based stats. Identities = 7/40 (17%), Positives = 13/40 (32%), Gaps = 3/40 (7%) Query: 17 VCPLTKG-NLTLISEGTELLSKKASLAYPIRSGVPIMLVS 55 VCP+ E E++ + I+ + M Sbjct: 6 VCPVCGSDKFVYDPERGEIICANCG--FVIQENIIDMGPE 43 >gi|257893462|ref|ZP_05673115.1| conserved hypothetical protein [Enterococcus faecium 1,231,408] gi|257829841|gb|EEV56448.1| conserved hypothetical protein [Enterococcus faecium 1,231,408] Length = 387 Score = 34.8 bits (80), Expect = 3.8, Method: Composition-based stats. Identities = 9/35 (25%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Query: 11 QLLEIL--VCPLTKGNLTLISEGTELLSKKASLAY 43 QL+++L CP G LT + + + Y Sbjct: 2 QLMDVLTHKCPNCGGPLTFDPKDQKFHCEYCLNIY 36 >gi|305664204|ref|YP_003860492.1| protein of unknown function DUF343 [Ignisphaera aggregans DSM 17230] gi|304378773|gb|ADM28612.1| protein of unknown function DUF343 [Ignisphaera aggregans DSM 17230] Length = 142 Score = 34.8 bits (80), Expect = 3.8, Method: Composition-based stats. Identities = 10/25 (40%), Positives = 14/25 (56%) Query: 34 LLSKKASLAYPIRSGVPIMLVSEAR 58 L +K YPI SGVP++ + R Sbjct: 74 LFCEKCGRWYPIISGVPLLYPDDIR 98 >gi|66472212|ref|NP_001018588.1| hypothetical protein LOC553790 [Danio rerio] gi|63100714|gb|AAH95351.1| Zgc:110652 [Danio rerio] Length = 122 Score = 34.8 bits (80), Expect = 3.8, Method: Composition-based stats. Identities = 10/32 (31%), Positives = 16/32 (50%) Query: 25 LTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + L ++ +PI GVP ML++E Sbjct: 89 LEVEVIEGCLQCPESGREFPISKGVPNMLLNE 120 >gi|300711217|ref|YP_003737031.1| Transcription factor TFIIB cyclin-related protein [Halalkalicoccus jeotgali B3] gi|299124900|gb|ADJ15239.1| Transcription factor TFIIB cyclin-related protein [Halalkalicoccus jeotgali B3] Length = 335 Score = 34.8 bits (80), Expect = 3.9, Method: Composition-based stats. Identities = 7/25 (28%), Positives = 9/25 (36%) Query: 18 CPLTKGNLTLISEGTELLSKKASLA 42 CP G L +E E + L Sbjct: 31 CPECGGRLETDTEHGETVCSACGLV 55 >gi|296218657|ref|XP_002755521.1| PREDICTED: tRNA methyltransferase 112 homolog [Callithrix jacchus] Length = 125 Score = 34.8 bits (80), Expect = 3.9, Method: Composition-based stats. Identities = 10/32 (31%), Positives = 16/32 (50%) Query: 25 LTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + L ++ +PI G+P ML+SE Sbjct: 89 LEVEVVEGTLQCPESGRMFPISRGIPNMLLSE 120 >gi|312136694|ref|YP_004004031.1| transcription initiation factor iib (tfiib) [Methanothermus fervidus DSM 2088] gi|311224413|gb|ADP77269.1| Transcription initiation factor IIB (TFIIB) [Methanothermus fervidus DSM 2088] Length = 307 Score = 34.8 bits (80), Expect = 4.0, Method: Composition-based stats. Identities = 9/36 (25%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Query: 8 IDPQLLEILVCPLTKG-NLTLISEGTELLSKKASLA 42 + ++L+ VCP +L E E++ +K L Sbjct: 1 MKKKVLKGSVCPECGSEDLIEDHERAEIVCRKCGLV 36 >gi|315230862|ref|YP_004071298.1| transcription initiation factor B [Thermococcus barophilus MP] gi|315183890|gb|ADT84075.1| transcription initiation factor B [Thermococcus barophilus MP] Length = 299 Score = 34.8 bits (80), Expect = 4.1, Method: Composition-based stats. Identities = 8/40 (20%), Positives = 13/40 (32%), Gaps = 3/40 (7%) Query: 17 VCPLTKG-NLTLISEGTELLSKKASLAYPIRSGVPIMLVS 55 VCP+ E E++ K + I + M Sbjct: 6 VCPVCGSTEFIYDPEHGEIVCSKCG--FVIEENIVDMGPE 43 >gi|210621253|ref|ZP_03292559.1| hypothetical protein CLOHIR_00502 [Clostridium hiranonis DSM 13275] gi|210154864|gb|EEA85870.1| hypothetical protein CLOHIR_00502 [Clostridium hiranonis DSM 13275] Length = 362 Score = 34.8 bits (80), Expect = 4.2, Method: Composition-based stats. Identities = 6/30 (20%), Positives = 10/30 (33%) Query: 18 CPLTKGNLTLISEGTELLSKKASLAYPIRS 47 CP G++ S +L + I Sbjct: 9 CPNCGGSIEFDSSKQKLKCPYCDTVFDIDD 38 >gi|315925420|ref|ZP_07921631.1| acetyl-coA carboxylase carboxyl transferase subunit beta [Pseudoramibacter alactolyticus ATCC 23263] gi|315621321|gb|EFV01291.1| acetyl-coA carboxylase carboxyl transferase subunit beta [Pseudoramibacter alactolyticus ATCC 23263] Length = 289 Score = 34.8 bits (80), Expect = 4.4, Method: Composition-based stats. Identities = 8/28 (28%), Positives = 10/28 (35%) Query: 18 CPLTKGNLTLISEGTELLSKKASLAYPI 45 CP LTL L + +PI Sbjct: 41 CPQCGHALTLDELEKNLHVCRCGYHFPI 68 >gi|119594659|gb|EAW74253.1| hypothetical protein HSPC152, isoform CRA_b [Homo sapiens] Length = 104 Score = 34.8 bits (80), Expect = 4.4, Method: Composition-based stats. Identities = 10/32 (31%), Positives = 16/32 (50%) Query: 25 LTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + L ++ +PI G+P ML+SE Sbjct: 68 LEVEVIEGTLQCPESGRMFPISRGIPNMLLSE 99 >gi|301095242|ref|XP_002896722.1| conserved hypothetical protein [Phytophthora infestans T30-4] gi|262108783|gb|EEY66835.1| conserved hypothetical protein [Phytophthora infestans T30-4] Length = 134 Score = 34.8 bits (80), Expect = 4.5, Method: Composition-based stats. Identities = 9/26 (34%), Positives = 13/26 (50%) Query: 31 GTELLSKKASLAYPIRSGVPIMLVSE 56 EL+ +Y I + VP ML+ E Sbjct: 106 EGELICNNCGRSYAITNAVPNMLLEE 131 >gi|257784672|ref|YP_003179889.1| primosomal protein N' [Atopobium parvulum DSM 20469] gi|257473179|gb|ACV51298.1| primosomal protein N' [Atopobium parvulum DSM 20469] Length = 770 Score = 34.8 bits (80), Expect = 4.5, Method: Composition-based stats. Identities = 8/32 (25%), Positives = 10/32 (31%), Gaps = 5/32 (15%) Query: 18 CPLTKGNLTLISEGTELLSKKAS-----LAYP 44 CP +LT L+ AYP Sbjct: 478 CPHCSTSLTYHERTHSLVCHSCGRQWSQRAYP 509 >gi|253747874|gb|EET02348.1| Hypothetical protein GL50581_388 [Giardia intestinalis ATCC 50581] Length = 124 Score = 34.8 bits (80), Expect = 4.5, Method: Composition-based stats. Identities = 10/27 (37%), Positives = 11/27 (40%), Gaps = 1/27 (3%) Query: 31 GTELLSKKASLAYPIRSGVPIM-LVSE 56 L L +PI GVP M L E Sbjct: 88 EGTLTCNSCGLVFPITEGVPRMRLPEE 114 >gi|315230585|ref|YP_004071021.1| transcription initiation factor B [Thermococcus barophilus MP] gi|315183613|gb|ADT83798.1| transcription initiation factor B [Thermococcus barophilus MP] Length = 306 Score = 34.8 bits (80), Expect = 4.5, Method: Composition-based stats. Identities = 6/33 (18%), Positives = 11/33 (33%), Gaps = 3/33 (9%) Query: 18 CPLTKG-NLTLISEGTELLSKKASLAYPIRSGV 49 CP+ L E E++ Y + + Sbjct: 10 CPVCGSVRLIYDPERGEIVCTACG--YVVAQNI 40 >gi|149173985|ref|ZP_01852613.1| hypothetical protein PM8797T_12388 [Planctomyces maris DSM 8797] gi|148846965|gb|EDL61300.1| hypothetical protein PM8797T_12388 [Planctomyces maris DSM 8797] Length = 546 Score = 34.4 bits (79), Expect = 4.6, Method: Composition-based stats. Identities = 14/52 (26%), Positives = 24/52 (46%), Gaps = 15/52 (28%) Query: 14 EILVCPLTKGNLTLISEGTE--LLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 E++ CPL + +L + E E L+S++ L EA+ VD + Sbjct: 21 EVVACPLCQMHLQVDPESNEPVLVSEED-------------LEEEAKTVDPE 59 >gi|332158150|ref|YP_004423429.1| replication factor A [Pyrococcus sp. NA2] gi|331033613|gb|AEC51425.1| replication factor A [Pyrococcus sp. NA2] Length = 362 Score = 34.4 bits (79), Expect = 4.7, Method: Composition-based stats. Identities = 6/30 (20%), Positives = 10/30 (33%) Query: 17 VCPLTKGNLTLISEGTELLSKKASLAYPIR 46 CP K + E + + PI+ Sbjct: 221 ACPECKKKVDYDEETGTWICPEHGEVEPIK 250 >gi|55378764|ref|YP_136614.1| transcription initiation factor IIB [Haloarcula marismortui ATCC 43049] gi|55231489|gb|AAV46908.1| transcription initiation factor IIB [Haloarcula marismortui ATCC 43049] Length = 339 Score = 34.4 bits (79), Expect = 4.7, Method: Composition-based stats. Identities = 6/26 (23%), Positives = 9/26 (34%) Query: 17 VCPLTKGNLTLISEGTELLSKKASLA 42 CP G+L E + + L Sbjct: 29 ACPDCGGSLVTDDSRGETVCESCGLV 54 >gi|281355490|ref|ZP_06241984.1| Zinc finger TFIIB-type domain protein [Victivallis vadensis ATCC BAA-548] gi|281318370|gb|EFB02390.1| Zinc finger TFIIB-type domain protein [Victivallis vadensis ATCC BAA-548] Length = 367 Score = 34.4 bits (79), Expect = 4.7, Method: Composition-based stats. Identities = 6/35 (17%), Positives = 8/35 (22%), Gaps = 4/35 (11%) Query: 18 CPLTKGNLTLISEGTELLSKKASLAY----PIRSG 48 CP L +L + P G Sbjct: 13 CPNCGHPLAFDPAHGKLSCASCGQTFESGEPAEDG 47 >gi|159109293|ref|XP_001704912.1| Hypothetical protein GL50803_19867 [Giardia lamblia ATCC 50803] gi|157432987|gb|EDO77238.1| hypothetical protein GL50803_19867 [Giardia lamblia ATCC 50803] Length = 129 Score = 34.4 bits (79), Expect = 4.8, Method: Composition-based stats. Identities = 8/27 (29%), Positives = 11/27 (40%), Gaps = 1/27 (3%) Query: 31 GTELLSKKASLAYPIRSGVPIM-LVSE 56 + L +PI G+P M L E Sbjct: 95 EGSITCNSCGLVFPITEGIPRMRLPEE 121 >gi|125559218|gb|EAZ04754.1| hypothetical protein OsI_26918 [Oryza sativa Indica Group] Length = 133 Score = 34.4 bits (79), Expect = 4.9, Method: Composition-based stats. Identities = 12/36 (33%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Query: 25 LTLISEGTELLSKKASLAYPIRSGVPIML--VSEAR 58 L + E L+ +PI GVP ML E R Sbjct: 97 LEIHIEEGALVCPDTDRCFPISRGVPNMLLHEDEVR 132 >gi|115473441|ref|NP_001060319.1| Os07g0623000 [Oryza sativa Japonica Group] gi|22535669|dbj|BAC10843.1| unknown protein [Oryza sativa Japonica Group] gi|113611855|dbj|BAF22233.1| Os07g0623000 [Oryza sativa Japonica Group] gi|125601129|gb|EAZ40705.1| hypothetical protein OsJ_25175 [Oryza sativa Japonica Group] gi|215686576|dbj|BAG88829.1| unnamed protein product [Oryza sativa Japonica Group] Length = 133 Score = 34.4 bits (79), Expect = 4.9, Method: Composition-based stats. Identities = 12/36 (33%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Query: 25 LTLISEGTELLSKKASLAYPIRSGVPIML--VSEAR 58 L + E L+ +PI GVP ML E R Sbjct: 97 LEIHIEEGALVCPDTDRCFPISRGVPNMLLHEDEVR 132 >gi|257051172|ref|YP_003129005.1| Transcription factor TFIIB cyclin-related [Halorhabdus utahensis DSM 12940] gi|256689935|gb|ACV10272.1| Transcription factor TFIIB cyclin-related [Halorhabdus utahensis DSM 12940] Length = 323 Score = 34.4 bits (79), Expect = 5.1, Method: Composition-based stats. Identities = 9/26 (34%), Positives = 11/26 (42%) Query: 17 VCPLTKGNLTLISEGTELLSKKASLA 42 VCP G L SE E + + L Sbjct: 27 VCPECGGGLVTDSERGETVCGECGLV 52 >gi|114051644|ref|NP_001039446.1| tRNA methyltransferase 112 homolog [Bos taurus] gi|110816446|sp|Q2KIA2|TR112_BOVIN RecName: Full=tRNA methyltransferase 112 homolog; AltName: Full=TRM112-like protein gi|86438346|gb|AAI12714.1| TRM112-like [Bos taurus] gi|296471591|gb|DAA13706.1| tRNA methyltransferase 112 homolog [Bos taurus] Length = 125 Score = 34.4 bits (79), Expect = 5.1, Method: Composition-based stats. Identities = 9/32 (28%), Positives = 16/32 (50%) Query: 25 LTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + L ++ +PI G+P ML+S+ Sbjct: 89 LEVEVLEGTLQCPESGRVFPISRGIPNMLLSD 120 >gi|160881791|ref|YP_001560759.1| hypothetical protein Cphy_3673 [Clostridium phytofermentans ISDg] gi|160430457|gb|ABX44020.1| conserved hypothetical protein [Clostridium phytofermentans ISDg] Length = 398 Score = 34.4 bits (79), Expect = 5.2, Method: Composition-based stats. Identities = 9/37 (24%), Positives = 13/37 (35%), Gaps = 4/37 (10%) Query: 18 CPLTKGNLTLISEGTELLSKKASLAYPIRS----GVP 50 CP +LT + +L Y I S +P Sbjct: 29 CPSCGADLTFDTTSKKLHCASCGSYYSIDSMPPPDIP 65 >gi|302335856|ref|YP_003801063.1| replication restart DNA helicase PriA [Olsenella uli DSM 7084] gi|301319696|gb|ADK68183.1| replication restart DNA helicase PriA [Olsenella uli DSM 7084] Length = 769 Score = 34.4 bits (79), Expect = 5.3, Method: Composition-based stats. Identities = 8/29 (27%), Positives = 11/29 (37%) Query: 18 CPLTKGNLTLISEGTELLSKKASLAYPIR 46 CP LT G L+ ++P R Sbjct: 476 CPHCSCALTYHERGHVLMCHSCGRSWPAR 504 >gi|259089115|ref|NP_001158594.1| TRM112-like protein [Oncorhynchus mykiss] gi|225705118|gb|ACO08405.1| TRM112-like protein [Oncorhynchus mykiss] Length = 123 Score = 34.4 bits (79), Expect = 5.4, Method: Composition-based stats. Identities = 11/35 (31%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Query: 25 LTLISEGTELLSKKASLAYPIRSGVPIML--VSEA 57 L + L ++ +PI GVP ML EA Sbjct: 89 LEVEVLEGCLQCPESGREFPISRGVPNMLLNEDEA 123 >gi|115374436|ref|ZP_01461718.1| hypothetical protein STIAU_6944 [Stigmatella aurantiaca DW4/3-1] gi|310821942|ref|YP_003954300.1| hypothetical protein STAUR_4693 [Stigmatella aurantiaca DW4/3-1] gi|115368528|gb|EAU67481.1| hypothetical protein STIAU_6944 [Stigmatella aurantiaca DW4/3-1] gi|309395014|gb|ADO72473.1| conserved uncharacterized protein [Stigmatella aurantiaca DW4/3-1] Length = 290 Score = 34.4 bits (79), Expect = 5.5, Method: Composition-based stats. Identities = 10/47 (21%), Positives = 19/47 (40%), Gaps = 7/47 (14%) Query: 13 LEILVCPLTKGNLTLIS-------EGTELLSKKASLAYPIRSGVPIM 52 L +VCP + L L ++ S+ +P+ G+P + Sbjct: 6 LSQIVCPDCRSGLAWNGRLSQGHLSRGTLTCERCSMRWPVAEGLPRL 52 >gi|300712884|ref|YP_003738696.1| Transcription factor TFIIB cyclin-related protein [Halalkalicoccus jeotgali B3] gi|299126568|gb|ADJ16905.1| Transcription factor TFIIB cyclin-related protein [Halalkalicoccus jeotgali B3] Length = 340 Score = 34.4 bits (79), Expect = 5.6, Method: Composition-based stats. Identities = 8/26 (30%), Positives = 10/26 (38%) Query: 17 VCPLTKGNLTLISEGTELLSKKASLA 42 VCP G L +E E + L Sbjct: 32 VCPECGGRLVNDAEHGETTCAECGLV 57 >gi|124486326|ref|YP_001030942.1| transcription initiation factor IIB [Methanocorpusculum labreanum Z] gi|124363867|gb|ABN07675.1| Transcription initiation factor IIB (TFIIB) [Methanocorpusculum labreanum Z] Length = 340 Score = 34.4 bits (79), Expect = 5.7, Method: Composition-based stats. Identities = 8/27 (29%), Positives = 10/27 (37%), Gaps = 1/27 (3%) Query: 17 VCPLTKGN-LTLISEGTELLSKKASLA 42 VCP L E EL+ + L Sbjct: 43 VCPECGSKQLVHDYERAELVCQHCGLV 69 >gi|41615067|ref|NP_963565.1| hypothetical protein NEQ276 [Nanoarchaeum equitans Kin4-M] gi|40068791|gb|AAR39126.1| NEQ276 [Nanoarchaeum equitans Kin4-M] Length = 315 Score = 34.4 bits (79), Expect = 5.8, Method: Composition-based stats. Identities = 13/59 (22%), Positives = 19/59 (32%), Gaps = 7/59 (11%) Query: 6 FNIDPQLLEILVCPLTKGN-LTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 + + E LVCP + + E + K I L E R DD+ Sbjct: 1 MVLKKK--EKLVCPNCGSENIIYDPKTGEYICKDCGYVIKIEFD----LGPEWRHFDDE 53 >gi|220928372|ref|YP_002505281.1| acetyl-CoA carboxylase, carboxyl transferase, beta subunit [Clostridium cellulolyticum H10] gi|281312048|sp|B8I941|ACCD_CLOCE RecName: Full=Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta; Short=ACCase subunit beta; Short=Acetyl-CoA carboxylase carboxyltransferase subunit beta gi|219998700|gb|ACL75301.1| acetyl-CoA carboxylase, carboxyl transferase, beta subunit [Clostridium cellulolyticum H10] Length = 288 Score = 34.4 bits (79), Expect = 5.8, Method: Composition-based stats. Identities = 9/37 (24%), Positives = 15/37 (40%), Gaps = 3/37 (8%) Query: 10 PQLLEILVCPLTKGNLTLISEGTEL-LSKKASLAYPI 45 +LL L+CP K L L + ++ + I Sbjct: 30 KELL--LICPKCKKTLLKSELADNLDVCRECGYHFRI 64 >gi|84490148|ref|YP_448380.1| transcription initiation factor IIB [Methanosphaera stadtmanae DSM 3091] gi|121731831|sp|Q2NEL6|TF2B_METST RecName: Full=Transcription initiation factor IIB; Short=TFIIB gi|84373467|gb|ABC57737.1| transcription initiation factor IIB (TFIIB) [Methanosphaera stadtmanae DSM 3091] Length = 311 Score = 34.4 bits (79), Expect = 5.8, Method: Composition-based stats. Identities = 10/56 (17%), Positives = 19/56 (33%), Gaps = 6/56 (10%) Query: 1 MRETIFNIDPQLLEILVCPLTKG-NLTLISEGTELLSKKASLAYPIRSGVPIMLVS 55 M+E + ++ + + CP L E E++ L I + M Sbjct: 1 MKEDVAEMEKKETK---CPECGSTKLINDHERGEVVCGACGLV--IDDNIVDMGPE 51 >gi|284989901|ref|YP_003408455.1| type 11 methyltransferase [Geodermatophilus obscurus DSM 43160] gi|284063146|gb|ADB74084.1| Methyltransferase type 11 [Geodermatophilus obscurus DSM 43160] Length = 287 Score = 34.4 bits (79), Expect = 5.9, Method: Composition-based stats. Identities = 5/26 (19%), Positives = 8/26 (30%) Query: 15 ILVCPLTKGNLTLISEGTELLSKKAS 40 +L CP+ L + L Sbjct: 13 LLACPVCGAPLAARPDDAGLRCPAGH 38 >gi|157833471|pdb|1PFT|A Chain A, N-Terminal Domain Of Tfiib, Nmr Length = 50 Score = 34.4 bits (79), Expect = 5.9, Method: Composition-based stats. Identities = 10/40 (25%), Positives = 14/40 (35%), Gaps = 3/40 (7%) Query: 17 VCPLTK-GNLTLISEGTELLSKKASLAYPIRSGVPIMLVS 55 VCP + L E E++ K Y I + M Sbjct: 7 VCPACESAELIYDPERGEIVCAKCG--YVIEENIIDMGPE 44 >gi|311247389|ref|XP_003122620.1| PREDICTED: tRNA methyltransferase 112 homolog [Sus scrofa] Length = 81 Score = 34.4 bits (79), Expect = 5.9, Method: Composition-based stats. Identities = 8/29 (27%), Positives = 13/29 (44%) Query: 25 LTLISEGTELLSKKASLAYPIRSGVPIML 53 L + L ++ +PI G+P ML Sbjct: 45 LEVDVLEGTLQCPESGRLFPISRGIPNML 73 >gi|20094057|ref|NP_613904.1| transcription initiation factor IIB [Methanopyrus kandleri AV19] gi|19887040|gb|AAM01834.1| Transcription initiation factor IIB [Methanopyrus kandleri AV19] Length = 341 Score = 34.4 bits (79), Expect = 5.9, Method: Composition-based stats. Identities = 6/25 (24%), Positives = 9/25 (36%), Gaps = 1/25 (4%) Query: 17 VCPLTKGN-LTLISEGTELLSKKAS 40 VCP L + EL+ + Sbjct: 10 VCPKCGSTNLERDEKHGELVCRDCG 34 >gi|72391622|ref|XP_846105.1| hypothetical protein [Trypanosoma brucei TREU927] gi|62175639|gb|AAX69771.1| hypothetical protein, conserved [Trypanosoma brucei] gi|70802641|gb|AAZ12546.1| hypothetical protein, conserved [Trypanosoma brucei brucei strain 927/4 GUTat10.1] gi|261329657|emb|CBH12639.1| hypothetical protein, conserved [Trypanosoma brucei gambiense DAL972] Length = 127 Score = 34.1 bits (78), Expect = 6.0, Method: Composition-based stats. Identities = 8/26 (30%), Positives = 12/26 (46%) Query: 31 GTELLSKKASLAYPIRSGVPIMLVSE 56 L + YPIR +P M+ +E Sbjct: 101 EGALRCPQCKREYPIREFIPDMIAAE 126 >gi|257051641|ref|YP_003129474.1| Transcription factor TFIIB cyclin-related [Halorhabdus utahensis DSM 12940] gi|256690404|gb|ACV10741.1| Transcription factor TFIIB cyclin-related [Halorhabdus utahensis DSM 12940] Length = 330 Score = 34.1 bits (78), Expect = 6.6, Method: Composition-based stats. Identities = 9/26 (34%), Positives = 11/26 (42%) Query: 17 VCPLTKGNLTLISEGTELLSKKASLA 42 VCP G L SE E + + L Sbjct: 32 VCPECGGGLVTDSERGETVCGECGLV 57 >gi|257052295|ref|YP_003130128.1| Transcription factor TFIIB cyclin-related [Halorhabdus utahensis DSM 12940] gi|256691058|gb|ACV11395.1| Transcription factor TFIIB cyclin-related [Halorhabdus utahensis DSM 12940] Length = 321 Score = 34.1 bits (78), Expect = 6.7, Method: Composition-based stats. Identities = 7/32 (21%), Positives = 13/32 (40%), Gaps = 3/32 (9%) Query: 18 CPLTKGN-LTLISEGTELLSKKASLAYPIRSG 48 CP + L ++ EL+ + L + G Sbjct: 27 CPECGSDSLVKDADRGELICEDCGLV--VEEG 56 >gi|312088869|ref|XP_003146029.1| hypothetical protein LOAG_10457 [Loa loa] gi|307758807|gb|EFO18041.1| hypothetical protein LOAG_10457 [Loa loa] Length = 642 Score = 34.1 bits (78), Expect = 6.8, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Query: 14 EI-LVCPLTKGNLTLISEGTELLSKKASLAYPIRSGV 49 EI L CP T E ++ + AY IR G+ Sbjct: 18 EIELHCPATGAPGVYGEVKWEKVNDELPYAYSIRQGI 54 >gi|261366628|ref|ZP_05979511.1| ribosomal RNA large subunit methyltransferase A [Subdoligranulum variabile DSM 15176] gi|282571448|gb|EFB76983.1| ribosomal RNA large subunit methyltransferase A [Subdoligranulum variabile DSM 15176] Length = 231 Score = 34.1 bits (78), Expect = 6.9, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKAS 40 + P L + L CP+ G L L+ G L KA Sbjct: 1 MTPALAQALRCPVCGGPLLLV--GRSLRCPKAH 31 >gi|284164125|ref|YP_003402404.1| transcription factor TFIIB cyclin-related protein [Haloterrigena turkmenica DSM 5511] gi|284013780|gb|ADB59731.1| Transcription factor TFIIB cyclin-related protein [Haloterrigena turkmenica DSM 5511] Length = 329 Score = 34.1 bits (78), Expect = 7.3, Method: Composition-based stats. Identities = 9/27 (33%), Positives = 12/27 (44%) Query: 16 LVCPLTKGNLTLISEGTELLSKKASLA 42 L CP GNL + E E + + L Sbjct: 32 LDCPECAGNLVVDDEHGETVCEDCGLV 58 >gi|325267055|ref|ZP_08133725.1| alkylphosphonate utilization operon protein PhnA [Kingella denitrificans ATCC 33394] gi|324981555|gb|EGC17197.1| alkylphosphonate utilization operon protein PhnA [Kingella denitrificans ATCC 33394] Length = 111 Score = 34.1 bits (78), Expect = 7.4, Method: Composition-based stats. Identities = 6/27 (22%), Positives = 12/27 (44%), Gaps = 1/27 (3%) Query: 18 CPLTKGNLTLISEGTELLSKKASLAYP 44 CP + +LT L+ + + +P Sbjct: 6 CPQCQSSLTYHDGTQ-LVCPECAHEWP 31 >gi|18976721|ref|NP_578078.1| hypothetical protein PF0349 [Pyrococcus furiosus DSM 3638] gi|18892305|gb|AAL80473.1| hypothetical protein PF0349 [Pyrococcus furiosus DSM 3638] Length = 224 Score = 34.1 bits (78), Expect = 7.6, Method: Composition-based stats. Identities = 11/40 (27%), Positives = 17/40 (42%), Gaps = 4/40 (10%) Query: 1 MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKAS 40 M++ I D L E CP+ L EG+ L+ + Sbjct: 166 MKDEI--FDSLLREEYRCPVCFSPLR--REGSALVCDRCG 201 >gi|258511988|ref|YP_003185422.1| Methyltransferase type 11 [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446] gi|257478714|gb|ACV59033.1| Methyltransferase type 11 [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446] Length = 268 Score = 33.7 bits (77), Expect = 7.9, Method: Composition-based stats. Identities = 12/51 (23%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Query: 8 IDPQLLEILVCPLTKGNLTLIS-EGTELLSKKASLAYPIRSGVPIMLVSEA 57 + + L +L P+ L ++ L S YP+ G+PI A Sbjct: 1 MRRETLALLCDPVHGEPLEFVAYPRPALRSIANGSEYPMVHGIPIFAAQAA 51 >gi|171912325|ref|ZP_02927795.1| hypothetical protein VspiD_14135 [Verrucomicrobium spinosum DSM 4136] Length = 62 Score = 33.7 bits (77), Expect = 8.1, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 24/55 (43%), Gaps = 11/55 (20%) Query: 12 LLEILVCPLTKGNLTLI-----------SEGTELLSKKASLAYPIRSGVPIMLVS 55 ++ +L CP TK L L ++ L ++ S Y + +P++L S Sbjct: 1 MIALLRCPNTKQPLRLATEAEKSAHGIPADEEALATEDGSRIYRTVNEMPVLLAS 55 >gi|225024911|ref|ZP_03714103.1| hypothetical protein EIKCOROL_01799 [Eikenella corrodens ATCC 23834] gi|224942315|gb|EEG23524.1| hypothetical protein EIKCOROL_01799 [Eikenella corrodens ATCC 23834] Length = 733 Score = 33.7 bits (77), Expect = 8.4, Method: Composition-based stats. Identities = 9/28 (32%), Positives = 10/28 (35%) Query: 18 CPLTKGNLTLISEGTELLSKKASLAYPI 45 CP L L +L LA PI Sbjct: 439 CPHCSAKLVLHQLAHQLRCHHCGLAAPI 466 >gi|225716880|gb|ACO14286.1| TRM112-like protein [Esox lucius] Length = 123 Score = 33.7 bits (77), Expect = 8.6, Method: Composition-based stats. Identities = 10/32 (31%), Positives = 16/32 (50%) Query: 25 LTLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 L + L ++ +PI GVP ML++E Sbjct: 89 LEVEVLEGCLQCPESGREFPITRGVPNMLLNE 120 >gi|320100364|ref|YP_004175956.1| hypothetical protein Desmu_0155 [Desulfurococcus mucosus DSM 2162] gi|319752716|gb|ADV64474.1| protein of unknown function DUF343 [Desulfurococcus mucosus DSM 2162] Length = 143 Score = 33.7 bits (77), Expect = 8.9, Method: Composition-based stats. Identities = 10/38 (26%), Positives = 13/38 (34%) Query: 21 TKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEAR 58 + L L YPI++GV ML R Sbjct: 61 CRECLRKGIRTGVLYCPNCGRWYPIKNGVVYMLTDNRR 98 >gi|313127155|ref|YP_004037425.1| transcription initiation factor iib (tfiib) [Halogeometricum borinquense DSM 11551] gi|312293520|gb|ADQ67980.1| Transcription initiation factor IIB (TFIIB) [Halogeometricum borinquense DSM 11551] Length = 321 Score = 33.7 bits (77), Expect = 8.9, Method: Composition-based stats. Identities = 8/27 (29%), Positives = 11/27 (40%) Query: 16 LVCPLTKGNLTLISEGTELLSKKASLA 42 L CP GN+ + E E + L Sbjct: 24 LTCPECGGNVVVDDEHGETVCADCGLV 50 >gi|294950515|ref|XP_002786668.1| Protein trm-112, putative [Perkinsus marinus ATCC 50983] gi|239900960|gb|EER18464.1| Protein trm-112, putative [Perkinsus marinus ATCC 50983] Length = 149 Score = 33.7 bits (77), Expect = 9.2, Method: Composition-based stats. Identities = 9/26 (34%), Positives = 13/26 (50%) Query: 31 GTELLSKKASLAYPIRSGVPIMLVSE 56 +L K YPI G+P ML+ + Sbjct: 121 EADLKCPKCDRVYPITKGIPNMLLQD 146 >gi|290985915|ref|XP_002675670.1| predicted protein [Naegleria gruberi] gi|284089268|gb|EFC42926.1| predicted protein [Naegleria gruberi] Length = 118 Score = 33.7 bits (77), Expect = 9.7, Method: Composition-based stats. Identities = 8/31 (25%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Query: 25 LTLISEGTELLS--KKASLAYPIRSGVPIML 53 L L + +L+ + YPI+ +P M+ Sbjct: 77 LELQVKNGDLVCTNPQCGRRYPIKDRIPNMV 107 >gi|163846323|ref|YP_001634367.1| type 11 methyltransferase [Chloroflexus aurantiacus J-10-fl] gi|222524087|ref|YP_002568558.1| type 11 methyltransferase [Chloroflexus sp. Y-400-fl] gi|163667612|gb|ABY33978.1| Methyltransferase type 11 [Chloroflexus aurantiacus J-10-fl] gi|222447966|gb|ACM52232.1| Methyltransferase type 11 [Chloroflexus sp. Y-400-fl] Length = 355 Score = 33.7 bits (77), Expect = 10.0, Method: Composition-based stats. Identities = 9/43 (20%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Query: 7 NIDPQLLEILVCPLTK-GNLTLISEGTELLSKKASLAYPIRSG 48 I+ ++ +L CP + L + E + + YP G Sbjct: 1 MINQRIFSLLQCPTCRVRPLVV--EANGVRCPRCQTLYPFCDG 41 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.315 0.202 0.775 Lambda K H 0.267 0.0617 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,192,201,722 Number of Sequences: 14124377 Number of extensions: 68417719 Number of successful extensions: 146188 Number of sequences better than 10.0: 1297 Number of HSP's better than 10.0 without gapping: 1150 Number of HSP's successfully gapped in prelim test: 147 Number of HSP's that attempted gapping in prelim test: 144675 Number of HSP's gapped (non-prelim): 1352 length of query: 64 length of database: 4,842,793,630 effective HSP length: 36 effective length of query: 28 effective length of database: 4,334,316,058 effective search space: 121360849624 effective search space used: 121360849624 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (20.9 bits) S2: 77 (33.7 bits)