RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780739|ref|YP_003065152.1| hypothetical protein CLIBASIA_03130 [Candidatus Liberibacter asiaticus str. psy62] (64 letters) >gnl|CDD|183328 PRK11827, PRK11827, hypothetical protein; Provisional. Length = 60 Score = 50.0 bits (119), Expect = 1e-07 Identities = 23/51 (45%), Positives = 35/51 (68%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEAR 58 +D +LLEI+ CP+ G L E EL+ K +LA+P+R G+P++L +EAR Sbjct: 1 MDHRLLEIIACPVCNGKLWYNQEKQELICKLDNLAFPLRDGIPVLLETEAR 51 >gnl|CDD|152576 pfam12141, DUF3589, Protein of unknown function (DUF3589). This family of proteins is found in eukaryotes. Proteins in this family are typically between 541 and 717 amino acids in length. The function of this family is not known,. Length = 488 Score = 26.9 bits (60), Expect = 1.2 Identities = 15/50 (30%), Positives = 21/50 (42%), Gaps = 6/50 (12%) Query: 5 IFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSG---VPI 51 ++ P LEIL C L G+ + + L K P+R G V I Sbjct: 276 VYRWAP--LEILKCSLDSGDCDFVYKPEFQLKDKNK-VGPLRGGTNLVNI 322 >gnl|CDD|178953 PRK00274, ksgA, 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed. Length = 272 Score = 26.2 bits (59), Expect = 2.1 Identities = 9/21 (42%), Positives = 11/21 (52%) Query: 8 IDPQLLEILVCPLTKGNLTLI 28 ID L IL + NLT+I Sbjct: 72 IDRDLAPILAETFAEDNLTII 92 >gnl|CDD|183432 PRK12316, PRK12316, peptide synthase; Provisional. Length = 5163 Score = 24.9 bits (54), Expect = 5.0 Identities = 18/49 (36%), Positives = 23/49 (46%), Gaps = 3/49 (6%) Query: 6 FNIDPQLLEILVCPLTKGNLT---LISEGTELLSKKASLAYPIRSGVPI 51 F+IDP L E L + LT L+ +L + S IR GVPI Sbjct: 275 FSIDPALAEALRGTARRQGLTLFMLLLGAFNVLLHRYSGQTDIRVGVPI 323 >gnl|CDD|178106 PLN02488, PLN02488, probable pectinesterase/pectinesterase inhibitor. Length = 509 Score = 23.8 bits (51), Expect = 9.5 Identities = 11/30 (36%), Positives = 16/30 (53%) Query: 14 EILVCPLTKGNLTLISEGTELLSKKASLAY 43 EI+ TK NLTLI +G + +L+ Sbjct: 238 EIVRIGSTKPNLTLIGDGQDSTIITGNLSA 267 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.318 0.137 0.375 Gapped Lambda K H 0.267 0.0648 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 954,735 Number of extensions: 42095 Number of successful extensions: 65 Number of sequences better than 10.0: 1 Number of HSP's gapped: 65 Number of HSP's successfully gapped: 10 Length of query: 64 Length of database: 5,994,473 Length adjustment: 35 Effective length of query: 29 Effective length of database: 5,238,193 Effective search space: 151907597 Effective search space used: 151907597 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.2 bits)