BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780740|ref|YP_003065153.1| peptidase S16 lon domain protein [Candidatus Liberibacter asiaticus str. psy62] (221 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780740|ref|YP_003065153.1| peptidase S16 lon domain protein [Candidatus Liberibacter asiaticus str. psy62] Length = 221 Score = 453 bits (1165), Expect = e-129, Method: Compositional matrix adjust. Identities = 221/221 (100%), Positives = 221/221 (100%) Query: 1 MKIGNTIYKNREDLPCLLPIFPLLGMLLLPGSRFSFSVFERRYIAMFDSVLAGDRLIGLV 60 MKIGNTIYKNREDLPCLLPIFPLLGMLLLPGSRFSFSVFERRYIAMFDSVLAGDRLIGLV Sbjct: 1 MKIGNTIYKNREDLPCLLPIFPLLGMLLLPGSRFSFSVFERRYIAMFDSVLAGDRLIGLV 60 Query: 61 QPAISGFLANSDNGLSQIGCIGRITSFVETDDGHYIMTVIGVCRFRLLEEAYQLNSWRCF 120 QPAISGFLANSDNGLSQIGCIGRITSFVETDDGHYIMTVIGVCRFRLLEEAYQLNSWRCF Sbjct: 61 QPAISGFLANSDNGLSQIGCIGRITSFVETDDGHYIMTVIGVCRFRLLEEAYQLNSWRCF 120 Query: 121 YIAPFISDLAGNDNDGVDRVALLEVFRNYLTVNNLDADWESIEEASNEILVNSLAMLSPF 180 YIAPFISDLAGNDNDGVDRVALLEVFRNYLTVNNLDADWESIEEASNEILVNSLAMLSPF Sbjct: 121 YIAPFISDLAGNDNDGVDRVALLEVFRNYLTVNNLDADWESIEEASNEILVNSLAMLSPF 180 Query: 181 SEEEKQALLEAPDFRARAQTLIAIMKIVLARAYTHCENRLQ 221 SEEEKQALLEAPDFRARAQTLIAIMKIVLARAYTHCENRLQ Sbjct: 181 SEEEKQALLEAPDFRARAQTLIAIMKIVLARAYTHCENRLQ 221 >gi|254780270|ref|YP_003064683.1| ATP-dependent protease La [Candidatus Liberibacter asiaticus str. psy62] Length = 820 Score = 28.5 bits (62), Expect = 0.11, Method: Compositional matrix adjust. Identities = 43/206 (20%), Positives = 81/206 (39%), Gaps = 30/206 (14%) Query: 17 LLPIFPLLGMLLLPGSRFSFSVFERRYIAMFDSVLAGDRLIGLVQPAISGFLANSDNGLS 76 + P+ PL +++ P V + + D + + I LV + +N +N ++ Sbjct: 27 IYPLLPLRDIVVFPYMIVPLFVGREKSVRALDEAMNSHKKIILV----TQMNSNDENPIA 82 Query: 77 ----QIGCIGRITSFVETDDGHYIMTVIGVCRFRLLEEAYQLNSWRCFYIAPFISDLAGN 132 +IG I I + DG + V G R R++E R ++ L Sbjct: 83 SSVYRIGTIVDIVQILRLPDGTVKILVEGSVRARIVEYI-----EREDFLEAITQVLPDP 137 Query: 133 DNDGVDRVAL----LEVFRNYLTVNN--------LDADWESIEEASNEILVNSLAMLSPF 180 D V+ AL + F NY+ +N + + E + ++ I N ++ Sbjct: 138 TEDPVELEALSRSVIAEFSNYIKLNKKISPEVIGITSQIEGFSKLADVIAANLSIKVA-- 195 Query: 181 SEEEKQALLEAPDFRARAQTLIAIMK 206 E+Q +LEA + R + L+ M+ Sbjct: 196 ---ERQKILEAVSVKERLEMLLVFME 218 >gi|254780866|ref|YP_003065279.1| NADH dehydrogenase subunit M [Candidatus Liberibacter asiaticus str. psy62] Length = 499 Score = 26.6 bits (57), Expect = 0.34, Method: Compositional matrix adjust. Identities = 15/50 (30%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Query: 128 DLAGNDNDGVDRVA-LLEVFRNYLTVNNLDADWESIEEASNEILVNSLAM 176 D + + GVD ++ LL V +LT + + W+SI+E E ++ L + Sbjct: 72 DYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVL 121 >gi|254780707|ref|YP_003065120.1| putative phosphate-binding periplasmic protein [Candidatus Liberibacter asiaticus str. psy62] Length = 346 Score = 24.6 bits (52), Expect = 1.4, Method: Compositional matrix adjust. Identities = 27/85 (31%), Positives = 41/85 (48%), Gaps = 12/85 (14%) Query: 3 IGNTIYKNREDLPCLLP---IFPLLGML---LLPGSRFSFSVFERRYIAMFDSVLAGDRL 56 +G + YKN D+ L+P I P +G + L P SR +R++ F+SVL L Sbjct: 248 VGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQH---FNSVLG---L 301 Query: 57 IGLVQPAISGFLANSDNGLSQIGCI 81 V ++S + D+ L Q G I Sbjct: 302 REYVSFSVSDEMMAPDSQLFQYGLI 326 >gi|254781169|ref|YP_003065582.1| ascorbate-specific PTS system enzyme IIC/IIB [Candidatus Liberibacter asiaticus str. psy62] Length = 461 Score = 23.9 bits (50), Expect = 2.4, Method: Compositional matrix adjust. Identities = 9/23 (39%), Positives = 14/23 (60%) Query: 113 QLNSWRCFYIAPFISDLAGNDND 135 Q+ SW + IAP++ D + N N Sbjct: 198 QVASWIAYKIAPYLGDRSENINS 220 >gi|254780504|ref|YP_003064917.1| glucose-6-phosphate 1-dehydrogenase [Candidatus Liberibacter asiaticus str. psy62] Length = 492 Score = 22.3 bits (46), Expect = 6.1, Method: Compositional matrix adjust. Identities = 6/15 (40%), Positives = 12/15 (80%) Query: 99 VIGVCRFRLLEEAYQ 113 +IG+CR ++ E+Y+ Sbjct: 47 IIGICRIKMTVESYR 61 >gi|254780569|ref|YP_003064982.1| phosphoribosylaminoimidazole synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 357 Score = 22.3 bits (46), Expect = 6.3, Method: Compositional matrix adjust. Identities = 9/26 (34%), Positives = 16/26 (61%) Query: 34 FSFSVFERRYIAMFDSVLAGDRLIGL 59 F+ ER+ + ++V AGD ++GL Sbjct: 162 FAVGAVERKELLSPENVCAGDLILGL 187 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.325 0.141 0.417 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 136,382 Number of Sequences: 1233 Number of extensions: 5268 Number of successful extensions: 16 Number of sequences better than 100.0: 8 Number of HSP's better than 100.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 11 Number of HSP's gapped (non-prelim): 8 length of query: 221 length of database: 328,796 effective HSP length: 71 effective length of query: 150 effective length of database: 241,253 effective search space: 36187950 effective search space used: 36187950 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 36 (18.5 bits)