254780742

254780742

hypothetical protein CLIBASIA_03145

GeneID in NCBI database:8209747Locus tag:CLIBASIA_03145
Protein GI in NCBI database:254780742Protein Accession:YP_003065155.1
Gene range:-(528606, 529865)Protein Length:419aa
Gene description:hypothetical protein
COG prediction:[E] Saccharopine dehydrogenase and related proteins
KEGG prediction:hypothetical protein
SEED prediction:Carboxynorspermidine dehydrogenase, putative (EC 1.1.1.-)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED4 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------42
MKKNVLIIGAGGVAHVVAHKCAQNNDILGDINIASRTLQKCSKIIDSIYKKKSLKIDGKLAIHQVDALNIKAVVELIKKTNSQIIINVGSSFLNMSVLRACIDSNVAYIDTAIHESPLKICESPPWYNNYEWSLLDECRTKSITAILGAGFDPGVVNAFARLAQDEYFDKITDIDIIDVNAGKHDKYFATNFDAEINLREFTGVVYSWQKNQWCVNKMFEISRTYDLPTVGQHKVYLSGHDEIHSLFKNIQGADIRFWMGFSDHYINVFTVLKNIGLLSEQPIRTAENIEIAPLKIVKAVLPDPSSLAPNYQGKTCIGCLINGIYHGETREIFLYNICDHQNAYQEIASQGISYTAGTPPVATAILIAQGIWDIGKMVNIEELPPKPFLGTLQRMGLATSLRTNHKEHQLQFDEKLINQ
ccccEEEEEccHHHHHHHHHHHHcccccccEEEEEccHHHHHHHHHHHHHccccccccccEEEEEccccHHHHHHHHHHccccEEEEcccccccHHHHHHHHHccccEEEcccccccccccccHHHHHHHHHHHHHHHHHcccEEEEcccccccHHHHHHHHHHHHHccccccEEEEEEEcccccccccccccHHHHHHHHccccEEEEccEEEEcccccccEEEcccccccEEEEEEccHHHHHHHHHccccEEEEEEEcccHHHHHHHHHHHcccccccccccccccEEEHHHHHHHHcccHHHcccccccEEEEEEEEEEEEccEEEEEEEEEEccHHHHHHHHcccEEEEEccHHHHHHHHHHHccccccccEEEHHHccHHHHHHHHHcccccEEEEEccccccccccHHHHcc
ccccEEEEcccHHHHHHHHHHHHccccccHEEEEcccHHHHHHHHHHHHHccccccccEEEEEEEccccHHHHHHHHHHccccEEEEcccccccHHHHHHHHHccccEEccccccccccccccccHHHHHHHHHHHHHHHccccEEEccccccHHHHHHHHHHHHHccccccEEEEEEEccccccccccccccccEEEEEEccccEEEEccEEEEccccccccEEcccccccccEEEcccHHHHHHHHHcccccEEEEccccHHHHHHHHHHHHccccccccEEEccccEEEHHHHHHHHcccccHccccccccEEEEEEEEEEEccccEEEEEEEcccHHHHHHHHcccEEEEHcccHHHHHHHHHHcccccccccccHHHcccHHHHHHHHHccccEEEEEccccccccccHHHHcc
MKKNVLIIGAGGVAHVVAHKcaqnndilgdiNIASRTLQKCSKIIDSIYkkkslkidgkLAIHQVDALNIKAVVELIKKTNSQIIINVGSSFLNMSVLRACIDSNVAYIDtaihesplkicesppwynnyewsllDECRTKSITAILGAGFDPGVVNAFARLAQDeyfdkitdidiidvnagkhdkyfatnfdaeiNLREFTGVVYSWQKNQWCVNKMFEisrtydlptvgqhkvyLSGHDEIHSLFKNIQGADIRFWMGFSDHYINVFTVLKNigllseqpirtaenieiaplkivkavlpdpsslapnyqgktcigclingiyhgeTREIFLYNICDHQNAYQEIASqgisytagtppVATAILIAQGIWdigkmvnieelppkpflgtlqRMGLATSLRTNHKEHQLQFDEKLINQ
MKKNVLIIGAGGVAHVVAHKCAQNNDILGDINIASRTLQKCSKIIDSIYKKKSLKIDGKLAIHQVDALNIKAVVELIKKTNSQIIINVGSSFLNMSVLRACIDSNVAYIDTAIHESPLKICESPPWYNNYEWSLLDECRTKSITAILGAGFDPGVVNAFARLAQDEYFDKITDIDIIDVNAGKHDKYFATNFDAEINLREFTGVVYSWQKNQWCVNKMFEISRTYDLPTVGQHKVYLSGHDEIHSLFKNIQGADIRFWMGFSDHYINVFTVLKNIGLLSEQPIRTAENIEIAPLKIVKAVLPDPSSLAPNYQGKTCIGCLINGIYHGETREIFLYNICDHQNAYQEIASQGISYTAGTPPVATAILIAQGIWDIGKMVNIEELPPKPFLGTLQRMGLATSLRTnhkehqlqfdeklinq
MKKNVLIIGAGGVAHVVAHKCAQNNDILGDINIASRTLQkcskiidsiykkkslkiDGKLAIHQVDALNIKAVVELIKKTNSQIIINVGSSFLNMSVLRACIDSNVAYIDTAIHESPLKICESPPWYNNYEWSLLDECRTKSITAILGAGFDPGVVNAFARLAQDEYFDKITDIDIIDVNAGKHDKYFATNFDAEINLREFTGVVYSWQKNQWCVNKMFEISRTYDLPTVGQHKVYLSGHDEIHSLFKNIQGADIRFWMGFSDHYINVFTVLKNIGLLSEQPIRTAENIEIAPLKIVKAVLPDPSSLAPNYQGKTCIGCLINGIYHGETREIFLYNICDHQNAYQEIASQGISYTAGTPPVATAILIAQGIWDIGKMVNIEELPPKPFLGTLQRMGLATSLRTNHKEHQLQFDEKLINQ
*KKNVLIIGAGGVAHVVAHKCAQNNDILGDINIASRTLQKCSKIIDSIYKKKSLKIDGKLAIHQVDALNIKAVVELIKKTNSQIIINVGSSFLNMSVLRACIDSNVAYIDTAIHESPLKICESPPWYNNYEWSLLDECRTKSITAILGAGFDPGVVNAFARLAQDEYFDKITDIDIIDVNAGKHDKYFATNFDAEINLREFTGVVYSWQKNQWCVNKMFEISRTYDLPTVGQHKVYLSGHDEIHSLFKNIQGADIRFWMGFSDHYINVFTVLKNIGLLSEQPIRTAENIEIAPLKIVKAVLPDPSSLAPNYQGKTCIGCLINGIYHGETREIFLYNICDHQNAYQEIASQGISYTAGTPPVATAILIAQGIWDIGKMVNIEELPPKPFLGTLQRMGLATSLRTNHK****QFD******
MKKNVLIIGAGGVAHVVAHKCAQNNDILGDINIASRTLQKCSKIIDSIYKKKSLKIDGKLAIHQVDALNIKAVVELIKKTNSQIIINVGSSFLNMSVLRACIDSNVAYIDTAIHESPLKICESPPWYNNYEWSLLDECRTKSITAILGAGFDPGVVNAFARLAQDEYFDKITDIDIIDVNAGKHDKYFATNFDAEINLREFTGVVYSWQKNQWCVNKMFEISRTYDLPTVGQHKVYLSGHDEIHSLFKNIQGADIRFWMGFSDHYINVFTVLKNIGLLSEQPIRTAENIEIAPLKIVKAVLPDPSSLAPNYQGKTCIGCLINGIYHGETREIFLYNICDHQNAYQEIASQGISYTAGTPPVATAILIAQGIWDIGKMVNIEELPPKPFLGTLQRMGLATSLRTNHKEHQLQFDEKLINQ
*KKNVLIIGAGGVAHVVAHKCAQNNDILGDINIASRTLQKCSKIIDSIYKKKSLKIDGKLAIHQVDALNIKAVVELIKKTNSQIIINVGSSFLNMSVLRACIDSNVAYIDTAIHESPLKICESPPWYNNYEWSLLDECRTKSITAILGAGFDPGVVNAFARLAQDEYFDKITDIDIIDVNAGKHDKYFATNFDAEINLREFTGVVYSWQKNQWCVNKMFEISRTYDLPTVGQHKVYLSGHDEIHSLFKNIQGADIRFWMGFSDHYINVFTVLKNIGLLSEQPIRTAENIEIAPLKIVKAVLPDPSSLAPNYQGKTCIGCLINGIYHGETREIFLYNICDHQNAYQEIASQGISYTAGTPPVATAILIAQGIWDIGKMVNIEELPPKPFLGTLQRMGLATSLRTNHKEHQLQFDEKLINQ
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKNVLIIGAGGVAHVVAHKCAQNNDILGDINIASRTLQKCSKIIDSIYKKKSLKIDGKLAIHQVDALNIKAVVELIKKTNSQIIINVGSSFLNMSVLRACIDSNVAYIDTAIHESPLKICESPPWYNNYEWSLLDECRTKSITAILGAGFDPGVVNAFARLAQDEYFDKITDIDIIDVNAGKHDKYFATNFDAEINLREFTGVVYSWQKNQWCVNKMFEISRTYDLPTVGQHKVYLSGHDEIHSLFKNIQGADIRFWMGFSDHYINVFTVLKNIGLLSEQPIRTAENIEIAPLKIVKAVLPDPSSLAPNYQGKTCIGCLINGIYHGETREIFLYNICDHQNAYQEIASQGISYTAGTPPVATAILIAQGIWDIGKMVNIEELPPKPFLGTLQRMGLATSLRTNHKEHQLQFDEKLINQ
MKKNVLIIGAGGVAHVVAHKCAQNNDILGDINIASRTLQKCSKIIDSIYKKKSLKIDGKLAIHQVDALNIKAVVELIKKTNSQIIINVGSSFLNMSVLRACIDSNVAYIDTAIHESPLKICESPPWYNNYEWSLLDECRTKSITAILGAGFDPGVVNAFARLAQDEYFDKITDIDIIDVNAGKHDKYFATNFDAEINLREFTGVVYSWQKNQWCVNKMFEISRTYDLPTVGQHKVYLSGHDEIHSLFKNIQGADIRFWMGFSDHYINVFTVLKNIGLLSEQPIRTAENIEIAPLKIVKAVLPDPSSLAPNYQGKTCIGCLINGIYHGETREIFLYNICDHQNAYQEIASQGISYTAGTPPVATAILIAQGIWDIGKMVNIEELPPKPFLGTLQRMGLATSLRTNHKEHQLQFDEKLINQ
MKKNVLIIGAGGVAHVVAHKCAQNNDILGDINIASRTLQKCSKIIDSIYKKKSLKIDGKLAIHQVDALNIKAVVELIKKTNSQIIINVGSSFLNMSVLRACIDSNVAYIDTAIHESPLKICESPPWYNNYEWSLLDECRTKSITAILGAGFDPGVVNAFARLAQDEYFDKITDIDIIDVNAGKHDKYFATNFDAEINLREFTGVVYSWQKNQWCVNKMFEISRTYDLPTVGQHKVYLSGHDEIHSLFKNIQGADIRFWMGFSDHYINVFTVLKNIGLLSEQPIRTAENIEIAPLKIVKAVLPDPSSLAPNYQGKTCIGCLINGIYHGETREIFLYNICDHQNAYQEIASQGISYTAGTPPVATAILIAQGIWDIGKMVNIEELPPKPFLGTLQRMGLATSLRTNHKEHQLQFDEKLINQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target419 hypothetical protein CLIBASIA_03145 [Candidatus Liberib
254780934374 hypothetical protein CLIBASIA_04165 [Candidatus Li 0.049
>gi|254780934|ref|YP_003065347.1| hypothetical protein CLIBASIA_04165 [Candidatus Liberibacter asiaticus str. psy62] Length = 374 Back     alignment
 Score = 30.8 bits (68), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 37/80 (46%), Gaps = 4/80 (5%)

Query: 100 ACIDSNVAYIDTAI--HESPLKICESPPWYNNYEWSLLDECRTKSITAILGAGFDPGVVN 157
             +  N  Y  +AI  ++ PLK C   PWY N    ++    +  + +   A  D  +V 
Sbjct: 119 VVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVL 178

Query: 158 AFARLAQDEYFD-KITDIDI 176
             +R + + +FD  IT ID+
Sbjct: 179 DVSR-SMESFFDSSITKIDM 197

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target419 hypothetical protein CLIBASIA_03145 [Candidatus Liberib
315121905414 hypothetical protein CKC_00775 [Candidatus Liberibacter 1 0.0
16265297413 hypothetical protein SM_b21630 [Sinorhizobium meliloti 1 1e-177
307301481413 Saccharopine dehydrogenase [Sinorhizobium meliloti BL22 1 1e-177
15890808412 hypothetical protein Atu4170 [Agrobacterium tumefaciens 1 1e-176
150376299413 saccharopine dehydrogenase [Sinorhizobium medicae WSM41 1 1e-175
332716888412 saccharopine dehydrogenase [Agrobacterium sp. H13-3] Le 1 1e-175
306842398413 saccharopine dehydrogenase [Brucella sp. BO2] Length = 1 1e-172
222106821413 hypothetical protein Avi_5844 [Agrobacterium vitis S4] 1 1e-172
306844973413 saccharopine dehydrogenase [Brucella sp. BO1] Length = 1 1e-171
62289328413 hypothetical protein BruAb1_0361 [Brucella abortus bv. 1 1e-171
>gi|315121905|ref|YP_004062394.1| hypothetical protein CKC_00775 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 414 Back     alignment and organism information
 Score =  734 bits (1894), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/413 (84%), Positives = 389/413 (94%)

Query: 1   MKKNVLIIGAGGVAHVVAHKCAQNNDILGDINIASRTLQKCSKIIDSIYKKKSLKIDGKL 60
           MKKNVLIIGAGGVAHVVAHKCAQNN+ILG I+IASRTLQKCSKI+DSIY+KKSLK+   +
Sbjct: 1   MKKNVLIIGAGGVAHVVAHKCAQNNNILGKIHIASRTLQKCSKIVDSIYEKKSLKVSDNI 60

Query: 61  AIHQVDALNIKAVVELIKKTNSQIIINVGSSFLNMSVLRACIDSNVAYIDTAIHESPLKI 120
            IHQ+DALNI+++++LIK+T  QI+INVGSSFLNMSVLRACI+SNVAYIDTAIHE PLKI
Sbjct: 61  KIHQIDALNIESLIKLIKETKCQIVINVGSSFLNMSVLRACINSNVAYIDTAIHEDPLKI 120

Query: 121 CESPPWYNNYEWSLLDECRTKSITAILGAGFDPGVVNAFARLAQDEYFDKITDIDIIDVN 180
           CESPPWYNNYEW +LDEC  KSITAILGAGFDPGVVNAFARLA+DEYFD+ITDIDIIDVN
Sbjct: 121 CESPPWYNNYEWKMLDECYAKSITAILGAGFDPGVVNAFARLAKDEYFDQITDIDIIDVN 180

Query: 181 AGKHDKYFATNFDAEINLREFTGVVYSWQKNQWCVNKMFEISRTYDLPTVGQHKVYLSGH 240
           AGKH++YFATNFDAEIN REFTGVVYSWQK QWCVNKMFEISRTY+ P +GQHKVYLSGH
Sbjct: 181 AGKHNRYFATNFDAEINFREFTGVVYSWQKGQWCVNKMFEISRTYNFPVIGQHKVYLSGH 240

Query: 241 DEIHSLFKNIQGADIRFWMGFSDHYINVFTVLKNIGLLSEQPIRTAENIEIAPLKIVKAV 300
           DEIHSLFKNI+GADIRFWMGFSDHYINVFTVLKN+GLLSE+PI+TAENIE++PLKIVKAV
Sbjct: 241 DEIHSLFKNIEGADIRFWMGFSDHYINVFTVLKNLGLLSEKPIKTAENIEVSPLKIVKAV 300

Query: 301 LPDPSSLAPNYQGKTCIGCLINGIYHGETREIFLYNICDHQNAYQEIASQGISYTAGTPP 360
           LPDPSSLAPNY+GKTCI CLINGIYHGE REI LYN+CDHQ+AYQEIASQGISYTAGTPP
Sbjct: 301 LPDPSSLAPNYKGKTCISCLINGIYHGEKREILLYNLCDHQSAYQEIASQGISYTAGTPP 360

Query: 361 VATAILIAQGIWDIGKMVNIEELPPKPFLGTLQRMGLATSLRTNHKEHQLQFD 413
           VA AILIAQGIWD+GKMVNIEELPPKPFL TL ++GL+T LR N+KE+ LQF+
Sbjct: 361 VAAAILIAQGIWDVGKMVNIEELPPKPFLSTLHKIGLSTLLRENNKEYLLQFE 413


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|16265297|ref|NP_438089.1| hypothetical protein SM_b21630 [Sinorhizobium meliloti 1021] Length = 413 Back     alignment and organism information
>gi|307301481|ref|ZP_07581241.1| Saccharopine dehydrogenase [Sinorhizobium meliloti BL225C] Length = 413 Back     alignment and organism information
>gi|15890808|ref|NP_356480.1| hypothetical protein Atu4170 [Agrobacterium tumefaciens str. C58] Length = 412 Back     alignment and organism information
>gi|150376299|ref|YP_001312895.1| saccharopine dehydrogenase [Sinorhizobium medicae WSM419] Length = 413 Back     alignment and organism information
>gi|332716888|ref|YP_004444354.1| saccharopine dehydrogenase [Agrobacterium sp. H13-3] Length = 412 Back     alignment and organism information
>gi|306842398|ref|ZP_07475053.1| saccharopine dehydrogenase [Brucella sp. BO2] Length = 413 Back     alignment and organism information
>gi|222106821|ref|YP_002547612.1| hypothetical protein Avi_5844 [Agrobacterium vitis S4] Length = 413 Back     alignment and organism information
>gi|306844973|ref|ZP_07477554.1| saccharopine dehydrogenase [Brucella sp. BO1] Length = 413 Back     alignment and organism information
>gi|62289328|ref|YP_221121.1| hypothetical protein BruAb1_0361 [Brucella abortus bv. 1 str. 9-941] Length = 413 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target419 hypothetical protein CLIBASIA_03145 [Candidatus Liberib
pfam03435384 pfam03435, Saccharop_dh, Saccharopine dehydrogenase 5e-76
COG1748389 COG1748, LYS9, Saccharopine dehydrogenase and related p 1e-101
>gnl|CDD|146194 pfam03435, Saccharop_dh, Saccharopine dehydrogenase Back     alignment and domain information
>gnl|CDD|31934 COG1748, LYS9, Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 419 hypothetical protein CLIBASIA_03145 [Candidatus Liberib
COG1748389 LYS9 Saccharopine dehydrogenase and related proteins [A 100.0
pfam03435384 Saccharop_dh Saccharopine dehydrogenase. This family co 100.0
KOG0172445 consensus 100.0
KOG2733423 consensus 100.0
COG3268382 Uncharacterized conserved protein [Function unknown] 100.0
pfam06408471 consensus 99.56
COG5310481 Homospermidine synthase [Secondary metabolites biosynth 98.64
PRK13304265 L-aspartate dehydrogenase; Reviewed 98.92
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimat 98.9
COG0673342 MviM Predicted dehydrogenases and related proteins [Gen 98.85
PRK00258275 aroE shikimate 5-dehydrogenase; Reviewed 98.85
PRK11579346 putative oxidoreductase; Provisional 98.79
PRK13302271 putative L-aspartate dehydrogenase; Provisional 98.79
COG1086588 Predicted nucleoside-diphosphate sugar epimerases [Cell 98.78
PRK12549284 shikimate 5-dehydrogenase; Reviewed 98.76
PRK13301267 putative L-aspartate dehydrogenase; Provisional 98.76
CHL00194319 ycf39 Ycf39; Provisional 98.72
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transport an 98.65
PRK10206345 putative dehydrogenase; Provisional 98.6
PRK13303265 L-aspartate dehydrogenase; Provisional 98.58
PRK12548289 shikimate 5-dehydrogenase; Provisional 98.51
COG1712255 Predicted dinucleotide-utilizing enzyme [General functi 98.49
TIGR00507286 aroE shikimate 5-dehydrogenase; InterPro: IPR011342 The 98.49
TIGR01921326 DAP-DH diaminopimelate dehydrogenase; InterPro: IPR0101 98.43
PRK12550272 shikimate 5-dehydrogenase; Reviewed 98.42
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 98.35
pfam03446163 NAD_binding_2 NAD binding domain of 6-phosphogluconate 98.22
COG0002349 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino 98.16
PRK11863314 N-acetyl-gamma-glutamyl-phosphate reductase; Provisiona 98.15
PRK11559295 garR tartronate semialdehyde reductase; Provisional 98.13
PRK08374316 homoserine dehydrogenase; Provisional 98.12
TIGR02853288 spore_dpaA dipicolinic acid synthetase, A subunit; Inte 98.11
PRK00048265 dihydrodipicolinate reductase; Provisional 98.08
PRK06349432 homoserine dehydrogenase; Provisional 98.05
COG3804350 Uncharacterized conserved protein related to dihydrodip 98.02
PRK06270342 homoserine dehydrogenase; Provisional 97.93
COG2084286 MmsB 3-hydroxyisobutyrate dehydrogenase and related bet 97.88
KOG2741351 consensus 97.85
COG4091438 Predicted homoserine dehydrogenase [Amino acid transpor 97.83
TIGR01830238 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reducta 97.79
PRK12490298 6-phosphogluconate dehydrogenase-like protein; Reviewed 97.79
TIGR00036281 dapB dihydrodipicolinate reductase; InterPro: IPR011770 97.73
TIGR02415258 23BDH acetoin reductases; InterPro: IPR014007 One membe 97.73
PRK05447379 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provis 97.73
COG0743385 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Li 97.71
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Reviewed 97.69
PRK06813341 homoserine dehydrogenase; Validated 97.66
COG0460333 ThrA Homoserine dehydrogenase [Amino acid transport and 97.61
COG0289266 DapB Dihydrodipicolinate reductase [Amino acid transpor 97.59
PRK00436345 argC N-acetyl-gamma-glutamyl-phosphate reductase; Valid 97.58
PRK06392326 homoserine dehydrogenase; Provisional 97.54
TIGR01915233 npdG NADPH-dependent F420 reductase; InterPro: IPR01018 97.42
TIGR03366280 HpnZ_proposed putative phosphonate catabolism associate 97.38
PRK04207338 glyceraldehyde-3-phosphate dehydrogenase; Provisional 97.09
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucin 96.95
PRK03562615 glutathione-regulated potassium-efflux system protein K 96.92
PRK06728347 aspartate-semialdehyde dehydrogenase; Provisional 96.92
PRK12464392 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provis 96.88
TIGR01692290 HIBADH 3-hydroxyisobutyrate dehydrogenase; InterPro: IP 96.72
pfam02056183 Glyco_hydro_4 Family 4 glycosyl hydrolase. 96.72
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelop 96.6
PRK08300298 acetaldehyde dehydrogenase; Validated 96.57
PRK08040337 putative semialdehyde dehydrogenase; Provisional 96.55
cd05313254 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate de 96.55
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelat 96.38
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisio 96.16
PRK05562222 precorrin-2 dehydrogenase; Provisional 96.1
COG0677436 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Ce 96.04
TIGR03215285 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating). 95.89
PRK07024256 short chain dehydrogenase; Provisional 98.89
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 98.8
PRK08251248 short chain dehydrogenase; Provisional 98.79
PRK06482276 short chain dehydrogenase; Provisional 98.75
PRK08643256 acetoin reductase; Validated 98.74
PRK07454241 short chain dehydrogenase; Provisional 98.71
COG0300265 DltE Short-chain dehydrogenases of various substrate sp 98.71
PRK07775275 short chain dehydrogenase; Provisional 98.69
PRK08263275 short chain dehydrogenase; Provisional 98.68
PRK07832272 short chain dehydrogenase; Provisional 98.66
PRK06181263 short chain dehydrogenase; Provisional 98.66
PRK06940277 short chain dehydrogenase; Provisional 98.65
TIGR02356210 adenyl_thiF thiazole biosynthesis adenylyltransferase T 98.63
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Valid 98.62
PRK05872296 short chain dehydrogenase; Provisional 98.62
PRK05866290 short chain dehydrogenase; Provisional 98.61
PRK07062265 short chain dehydrogenase; Provisional 98.61
PRK09072262 short chain dehydrogenase; Provisional 98.61
PRK07326235 short chain dehydrogenase; Provisional 98.61
PRK08277278 D-mannonate oxidoreductase; Provisional 98.61
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogena 98.61
PRK05867253 short chain dehydrogenase; Provisional 98.6
TIGR01035436 hemA glutamyl-tRNA reductase; InterPro: IPR000343 Tetra 98.59
TIGR02632709 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol 98.59
PRK06139324 short chain dehydrogenase; Provisional 98.58
PRK05993277 short chain dehydrogenase; Provisional 98.58
pfam05368232 NmrA NmrA-like family. NmrA is a negative transcription 98.58
PRK07201 663 short chain dehydrogenase; Provisional 98.58
PRK08762379 molybdopterin biosynthesis protein MoeB; Validated 98.58
PRK08223287 hypothetical protein; Validated 98.58
PRK12826253 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed 98.58
PRK12939250 short chain dehydrogenase; Provisional 98.57
PRK09186255 flagellin modification protein A; Provisional 98.57
PRK07774250 short chain dehydrogenase; Provisional 98.57
PRK07666238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 98.57
PRK07109338 short chain dehydrogenase; Provisional 98.56
PRK05875277 short chain dehydrogenase; Provisional 98.56
PRK07102243 short chain dehydrogenase; Provisional 98.56
PRK12824245 acetoacetyl-CoA reductase; Provisional 98.55
PRK08267258 short chain dehydrogenase; Provisional 98.55
PRK08324676 short chain dehydrogenase; Validated 98.55
PRK07063259 short chain dehydrogenase; Provisional 98.55
PRK06125259 short chain dehydrogenase; Provisional 98.55
PRK12743253 acetoin dehydrogenase; Provisional 98.55
PRK07479252 consensus 98.55
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 98.55
PRK05690245 molybdopterin biosynthesis protein MoeB; Provisional 98.55
PRK07576260 short chain dehydrogenase; Provisional 98.54
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1-like 98.54
PRK06949258 short chain dehydrogenase; Provisional 98.54
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 98.54
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 98.54
PRK05650270 short chain dehydrogenase; Provisional 98.54
PRK05855582 short chain dehydrogenase; Validated 98.54
PRK07814263 short chain dehydrogenase; Provisional 98.54
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like prot 98.53
PRK08340259 glucose-1-dehydrogenase; Provisional 98.53
PRK06194301 hypothetical protein; Provisional 98.53
pfam01488134 Shikimate_DH Shikimate / quinate 5-dehydrogenase. This 98.52
PRK08213259 gluconate 5-dehydrogenase; Provisional 98.52
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 98.52
PRK07890258 short chain dehydrogenase; Provisional 98.52
PRK07231250 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 98.52
PRK07478254 short chain dehydrogenase; Provisional 98.51
PRK00045429 hemA glutamyl-tRNA reductase; Reviewed 98.51
PRK07825273 short chain dehydrogenase; Provisional 98.51
PRK07067256 sorbitol dehydrogenase; Provisional 98.5
PRK09291257 short chain dehydrogenase; Provisional 98.5
PRK12475337 thiamine/molybdopterin biosynthesis MoeB-like protein; 98.5
PRK06124259 gluconate 5-dehydrogenase; Provisional 98.5
PRK07677254 short chain dehydrogenase; Provisional 98.5
PRK06914280 short chain dehydrogenase; Provisional 98.5
PRK06346251 consensus 98.5
PRK06138252 short chain dehydrogenase; Provisional 98.5
PRK08085254 gluconate 5-dehydrogenase; Provisional 98.49
PRK07523251 gluconate 5-dehydrogenase; Provisional 98.49
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase 98.49
COG4221246 Short-chain alcohol dehydrogenase of unknown specificit 98.49
PRK08017256 short chain dehydrogenase; Provisional 98.48
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 98.48
PRK10538248 3-hydroxy acid dehydrogenase; Provisional 98.48
PRK06180277 short chain dehydrogenase; Provisional 98.47
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of gl 98.47
PRK06172253 short chain dehydrogenase; Provisional 98.47
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 98.47
PRK07035252 short chain dehydrogenase; Provisional 98.47
PRK07097265 gluconate 5-dehydrogenase; Provisional 98.47
PRK12829264 short chain dehydrogenase; Provisional 98.47
PRK12828239 short chain dehydrogenase; Provisional 98.46
PRK08219226 short chain dehydrogenase; Provisional 98.45
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Revie 98.45
PRK08265261 short chain dehydrogenase; Provisional 98.45
PRK06500249 short chain dehydrogenase; Provisional 98.45
PRK05854314 short chain dehydrogenase; Provisional 98.45
PRK06182273 short chain dehydrogenase; Validated 98.44
PRK05600370 thiamine biosynthesis protein ThiF; Validated 98.44
PRK06057255 short chain dehydrogenase; Provisional 98.43
PRK06720169 hypothetical protein; Provisional 98.43
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 98.43
PRK09242258 tropinone reductase; Provisional 98.42
PRK07878392 molybdopterin biosynthesis-like protein MoeZ; Validated 98.42
PRK08339263 short chain dehydrogenase; Provisional 98.42
PRK06196316 oxidoreductase; Provisional 98.41
PRK07041240 short chain dehydrogenase; Provisional 98.4
PRK05876275 short chain dehydrogenase; Provisional 98.4
PRK05717255 oxidoreductase; Validated 98.4
PRK05693274 short chain dehydrogenase; Provisional 98.39
PRK06483236 short chain dehydrogenase; Provisional 98.39
PRK06197306 short chain dehydrogenase; Provisional 98.39
PRK06227256 consensus 98.39
PRK07074256 short chain dehydrogenase; Provisional 98.39
PRK08644209 thiamine biosynthesis protein ThiF; Provisional 98.39
PRK07707239 consensus 98.38
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 98.38
PRK12825250 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 98.38
PRK08862227 short chain dehydrogenase; Provisional 98.37
PRK06198268 short chain dehydrogenase; Provisional 98.36
PRK07411390 hypothetical protein; Validated 98.36
PRK05599246 hypothetical protein; Provisional 98.36
PRK09134256 short chain dehydrogenase; Provisional 98.36
PRK08328230 hypothetical protein; Provisional 98.36
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisional 98.35
PRK07831261 short chain dehydrogenase; Provisional 98.35
PRK06841255 short chain dehydrogenase; Provisional 98.35
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene tetr 98.35
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenas 98.35
PRK11908347 NAD-dependent epimerase/dehydratase family protein; Pro 98.34
PRK06484 530 short chain dehydrogenase; Validated 98.34
PRK07776252 consensus 98.33
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-li 98.33
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequences 98.32
PRK08226263 short chain dehydrogenase; Provisional 98.32
PRK08945245 short chain dehydrogenase; Provisional 98.32
PRK06484530 short chain dehydrogenase; Validated 98.32
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily of act 98.31
PRK06101241 short chain dehydrogenase; Provisional 98.31
PRK07453322 protochlorophyllide oxidoreductase; Validated 98.31
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 98.31
PRK07060245 short chain dehydrogenase; Provisional 98.31
pfam00899134 ThiF ThiF family. This family contains a repeated domai 98.3
PRK08589272 short chain dehydrogenase; Validated 98.29
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Valid 98.29
PRK13940414 glutamyl-tRNA reductase; Provisional 98.28
PRK09135249 pteridine reductase; Provisional 98.27
TIGR01181340 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase; InterPro: 98.27
cd01483143 E1_enzyme_family Superfamily of activating enzymes (E1) 98.27
PRK12746254 short chain dehydrogenase; Provisional 98.27
PRK06123249 short chain dehydrogenase; Provisional 98.26
PRK06947252 glucose-1-dehydrogenase; Provisional 98.26
PRK10217355 dTDP-glucose 4,6-dehydratase; Provisional 98.26
KOG1205282 consensus 98.25
PRK10675338 UDP-galactose-4-epimerase; Provisional 98.25
PRK08177225 short chain dehydrogenase; Provisional 98.25
PRK07806248 short chain dehydrogenase; Provisional 98.25
PRK06114262 short chain dehydrogenase; Provisional 98.24
PRK08278273 short chain dehydrogenase; Provisional 98.24
PRK12827251 short chain dehydrogenase; Provisional 98.24
PRK06179270 short chain dehydrogenase; Provisional 98.24
PRK12745259 3-ketoacyl-(acyl-carrier-protein) reductase; Provisiona 98.23
PRK12935247 acetoacetyl-CoA reductase; Provisional 98.23
PRK10084352 dTDP-glucose 4,6 dehydratase; Provisional 98.22
pfam00106167 adh_short short chain dehydrogenase. This family contai 98.21
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 98.19
pfam02719280 Polysacc_synt_2 Polysaccharide biosynthesis protein. Th 98.19
COG0569225 TrkA K+ transport systems, NAD-binding component [Inorg 98.19
pfam01370235 Epimerase NAD dependent epimerase/dehydratase family. T 98.19
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This enzy 98.19
KOG1208314 consensus 98.18
PRK08220253 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 98.18
PRK12744257 short chain dehydrogenase; Provisional 98.17
pfam08659181 KR KR domain. This enzymatic domain is part of bacteria 98.16
PRK08936261 glucose-1-dehydrogenase; Provisional 98.16
PRK08703239 short chain dehydrogenase; Provisional 98.14
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate deh 98.14
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 98.13
cd01489312 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 98.12
PRK07791285 short chain dehydrogenase; Provisional 98.12
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisional 98.11
PRK12859257 3-ketoacyl-(acyl-carrier-protein) reductase; Provisiona 98.11
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 98.1
PRK06077249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 98.09
TIGR01214317 rmlD dTDP-4-dehydrorhamnose reductase; InterPro: IPR005 98.09
PRK12937245 short chain dehydrogenase; Provisional 98.09
PRK08628258 short chain dehydrogenase; Provisional 98.06
TIGR01963258 PHB_DH 3-hydroxybutyrate dehydrogenase; InterPro: IPR01 98.05
PRK08664350 aspartate-semialdehyde dehydrogenase; Reviewed 98.05
PRK09496455 trkA potassium transporter peripheral membrane componen 98.04
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope bi 98.03
KOG1502327 consensus 98.03
KOG1014312 consensus 98.03
PRK06701289 short chain dehydrogenase; Provisional 98.02
PRK06463254 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 98.02
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisional 98.02
PTZ00142474 6-phosphogluconate dehydrogenase; Provisional 98.0
KOG1201300 consensus 98.0
PRK09496455 trkA potassium transporter peripheral membrane componen 98.0
PRK09730247 hypothetical protein; Provisional 98.0
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 97.99
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisional 97.97
PRK06128300 oxidoreductase; Provisional 97.96
pfam04321284 RmlD_sub_bind RmlD substrate binding domain. L-rhamnose 97.96
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 97.96
PRK08642254 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 97.95
PRK07904253 short chain dehydrogenase; Provisional 97.95
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 97.95
pfam01073280 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase 97.94
PRK08264235 short chain dehydrogenase; Validated 97.94
PRK12748257 3-ketoacyl-(acyl-carrier-protein) reductase; Provisiona 97.93
PRK07792303 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 97.93
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisional 97.93
PRK12938246 acetyacetyl-CoA reductase; Provisional 97.92
KOG1200256 consensus 97.91
smart00822180 PKS_KR This enzymatic domain is part of bacterial polyk 97.9
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisional 97.9
PRK07856254 short chain dehydrogenase; Provisional 97.9
PRK08594256 enoyl-(acyl carrier protein) reductase; Provisional 97.89
pfam01210159 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehyd 97.88
PRK08655441 prephenate dehydrogenase; Provisional 97.88
PRK07985294 oxidoreductase; Provisional 97.88
PRK05884223 short chain dehydrogenase; Provisional 97.88
PRK06199379 ornithine cyclodeaminase; Validated 97.88
PRK07533254 enoyl-(acyl carrier protein) reductase; Provisional 97.88
PRK08303305 short chain dehydrogenase; Provisional 97.87
TIGR01289321 LPOR light-dependent protochlorophyllide reductase; Int 97.87
PRK06953222 short chain dehydrogenase; Provisional 97.87
PRK08057241 cobalt-precorrin-6x reductase; Reviewed 97.86
PRK06398256 aldose dehydrogenase; Validated 97.85
PRK07069251 short chain dehydrogenase; Validated 97.85
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 97.84
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisional 97.84
KOG0725270 consensus 97.81
PRK07578199 short chain dehydrogenase; Provisional 97.8
COG2099257 CobK Precorrin-6x reductase [Coenzyme metabolism] 97.79
TIGR01179341 galE UDP-glucose 4-epimerase; InterPro: IPR005886 Synon 97.79
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 97.79
PRK07370259 enoyl-(acyl carrier protein) reductase; Validated 97.78
PRK06523260 short chain dehydrogenase; Provisional 97.77
TIGR01829244 AcAcCoA_reduct acetoacetyl-CoA reductase; InterPro: IPR 97.77
pfam02571246 CbiJ Precorrin-6x reductase CbiJ/CobK. This family cons 97.77
pfam01262150 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domai 97.75
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 97.74
PRK12747252 short chain dehydrogenase; Provisional 97.73
KOG0409327 consensus 97.73
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-lactate 97.72
COG1088340 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biog 97.71
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogena 97.7
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G 97.7
PRK12742237 oxidoreductase; Provisional 97.7
COG2910211 Putative NADH-flavin reductase [General function predic 97.69
PRK06550237 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 97.69
pfam01118121 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding 97.68
PRK06924251 short chain dehydrogenase; Provisional 97.65
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisional 97.65
PRK06928275 pyrroline-5-carboxylate reductase; Reviewed 97.63
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 97.63
KOG1371343 consensus 97.62
COG1179263 Dinucleotide-utilizing enzymes involved in molybdopteri 97.62
COG3967245 DltE Short-chain dehydrogenase involved in D-alanine es 97.62
PTZ00117313 malate dehydrogenase; Provisional 97.62
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-lactate 97.61
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases and s 97.61
PRK09009235 C factor cell-cell signaling protein; Provisional 97.59
PRK06476255 pyrroline-5-carboxylate reductase; Reviewed 97.58
pfam0380793 F420_oxidored NADP oxidoreductase coenzyme F420-depende 97.56
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisional 97.56
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-lactate 97.54
KOG1198347 consensus 97.54
COG0345266 ProC Pyrroline-5-carboxylate reductase [Amino acid tran 97.53
PRK07502307 cyclohexadienyl dehydrogenase; Validated 97.52
TIGR00715260 precor6x_red precorrin-6x reductase; InterPro: IPR00372 97.52
PRK12428261 3-alpha-hydroxysteroid dehydrogenase; Provisional 97.51
COG1028251 FabG Dehydrogenases with different specificities (relat 97.5
PRK00141476 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 97.49
COG0702275 Predicted nucleoside-diphosphate-sugar epimerases [Cell 97.48
PTZ00082322 L-lactate dehydrogenase; Provisional 97.48
KOG1209289 consensus 97.46
KOG1478341 consensus 97.44
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General funct 97.43
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisional 97.43
PRK07577234 short chain dehydrogenase; Provisional 97.42
COG1087329 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, 97.38
PRK07680273 late competence protein ComER; Validated 97.38
PRK12439340 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; P 97.36
COG0476254 ThiF Dinucleotide-utilizing enzymes involved in molybdo 97.36
PRK06223312 malate dehydrogenase; Reviewed 97.35
KOG2018430 consensus 97.35
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase; Int 97.34
PRK08125660 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-am 97.31
PRK07531489 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioestera 97.31
PRK05671336 aspartate-semialdehyde dehydrogenase; Reviewed 97.28
TIGR00872341 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylati 97.27
PRK03369487 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 97.26
PRK08229341 2-dehydropantoate 2-reductase; Provisional 97.25
PRK06395435 phosphoribosylamine--glycine ligase; Provisional 97.25
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB; InterPro: 97.23
PRK05472211 redox-sensing transcriptional repressor Rex; Provisiona 97.22
pfam00056142 Ldh_1_N lactate/malate dehydrogenase, NAD binding domai 97.2
COG1063350 Tdh Threonine dehydrogenase and related Zn-dependent de 97.18
PRK13789426 phosphoribosylamine--glycine ligase; Provisional 97.18
cd00300300 LDH_like L-lactate dehydrogenase-like enzymes. Members 97.17
COG2085211 Predicted dinucleotide-binding enzymes [General functio 97.16
PRK05708305 2-dehydropantoate 2-reductase; Provisional 97.16
PRK07023243 short chain dehydrogenase; Provisional 97.13
PTZ00325313 malate dehydrogenase; Provisional 97.09
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 97.08
cd01491286 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1 97.07
KOG1611249 consensus 97.07
TIGR01771302 L-LDH-NAD L-lactate dehydrogenase; InterPro: IPR011304 97.06
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 97.05
KOG4169261 consensus 97.04
PRK00885424 phosphoribosylamine--glycine ligase; Provisional 97.04
KOG2013 603 consensus 97.02
smart00829288 PKS_ER Enoylreductase. Enoylreductase in Polyketide syn 97.02
KOG1430361 consensus 97.01
TIGR01809291 Shik-DH-AROM shikimate-5-dehydrogenase; InterPro: IPR01 97.0
KOG2017427 consensus 97.0
COG0240329 GpsA Glycerol-3-phosphate dehydrogenase [Energy product 96.99
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transport and 96.99
pfam02670129 DXP_reductoisom 1-deoxy-D-xylulose 5-phosphate reductoi 96.98
COG0604326 Qor NADPH:quinone reductase and related Zn-dependent ox 96.98
PRK02472450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 96.96
pfam07993245 NAD_binding_4 Male sterility protein. This family repre 96.95
pfam0262996 CoA_binding CoA binding domain. This domain has a Rossm 96.89
COG0451314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell enve 96.88
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate dehydr 96.87
PRK06545357 prephenate dehydrogenase; Validated 96.83
COG1023300 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohy 96.83
PRK03659602 glutathione-regulated potassium-efflux system protein K 96.81
cd01337310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochond 96.8
PRK04308445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 96.76
PRK01438481 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 96.74
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding 96.72
pfam0284499 GARS_N Phosphoribosylglycinamide synthetase, N domain. 96.68
PRK06522307 2-dehydropantoate 2-reductase; Reviewed 96.67
PRK03806438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 96.64
COG2344211 AT-rich DNA-binding protein [General function predictio 96.63
PRK07417280 arogenate dehydrogenase; Reviewed 96.63
KOG2865391 consensus 96.61
PRK08268503 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.6
KOG1610322 consensus 96.58
PRK00683418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 96.57
cd05294309 LDH-like_MDH_nadp A lactate dehydrogenases-like structu 96.56
COG0039313 Mdh Malate/lactate dehydrogenases [Energy production an 96.52
PRK01710458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 96.5
PRK08309182 short chain dehydrogenase; Provisional 96.48
PRK08507275 prephenate dehydrogenase; Validated 96.47
PRK02318381 mannitol-1-phosphate 5-dehydrogenase; Provisional 96.41
PRK01390457 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 96.4
PRK00421459 murC UDP-N-acetylmuramate--L-alanine ligase; Provisiona 96.38
PRK02705459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 96.36
PRK13790415 phosphoribosylamine--glycine ligase; Provisional 96.36
PRK05086312 malate dehydrogenase; Provisional 96.35
PRK09287459 6-phosphogluconate dehydrogenase; Validated 96.34
COG0136334 Asd Aspartate-semialdehyde dehydrogenase [Amino acid tr 96.32
PRK04663438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 96.31
TIGR03376342 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+ 96.31
PRK09288395 purT phosphoribosylglycinamide formyltransferase 2; Val 96.29
KOG0024354 consensus 96.28
PRK05784485 phosphoribosylamine--glycine ligase; Provisional 96.25
KOG1203411 consensus 96.25
KOG1210331 consensus 96.24
), forming GARS-AIRS-GART.; GO: 0004637 phosphoribosylamine-glycine ligase activity, 0009113 purine base biosynthetic process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00877">TIGR00877459 purD phosphoribosylamine--glycine ligase; InterPro: IPR 96.24
PRK01368450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 96.23
cd01490435 Ube1_repeat2 Ubiquitin activating enzyme (E1), repeat 2 96.22
cd01493425 APPBP1_RUB Ubiquitin activating enzyme (E1) subunit APP 96.16
TIGR02824334 quinone_pig3 putative NAD(P)H quinone oxidoreductase, P 96.14
pfam01564240 Spermine_synth Spermine/spermidine synthase. Spermine a 96.11
TIGR00978358 asd_EA aspartate-semialdehyde dehydrogenase; InterPro: 96.09
PRK00811283 spermidine synthase; Provisional 96.07
TIGR01763308 MalateDH_bact malate dehydrogenase, NAD-dependent; Inte 96.01
pfam02558150 ApbA Ketopantoate reductase PanE/ApbA. This is a family 96.0
PRK05225489 ketol-acid reductoisomerase; Validated 95.98
PRK07729343 glyceraldehyde-3-phosphate dehydrogenase; Validated 95.96
TIGR02817338 adh_fam_1 zinc-binding alcohol dehydrogenase family pro 95.93
PRK04690468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.88
PRK12921306 2-dehydropantoate 2-reductase; Provisional 95.87
pfam01408120 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossman 98.67
cd00755231 YgdL_like Family of activating enzymes (E1) of ubiquiti 98.26
pfam03447116 NAD_binding_3 Homoserine dehydrogenase, NAD binding dom 98.0
PRK06598348 aspartate-semialdehyde dehydrogenase; Reviewed 97.92
pfam02254115 TrkA_N TrkA-N domain. This domain is found in a wide va 97.77
pfam01113122 DapB_N Dihydrodipicolinate reductase, N-terminus. Dihyd 97.55
PRK10669558 putative cation:proton antiport protein; Provisional 97.05
cd05298437 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; GlvA- 97.03
cd05297423 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolase 96.85
cd05197425 GH4_glycoside_hydrolases Glycoside Hydrases Family 4. G 96.69
cd05296419 GH4_P_beta_glucosidase Glycoside Hydrolases Family 4; P 96.05
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/shikima 98.47
TIGR01850361 argC N-acetyl-gamma-glutamyl-phosphate reductase; Inter 98.38
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All of the 97.27
pfam03721185 UDPG_MGDP_dh_N UDP-glucose/GDP-mannose dehydrogenase fa 97.17
cd01484234 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-li 98.11
PRK08306296 dipicolinate synthase subunit A; Reviewed 98.06
PRK08261447 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 97.67
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrog 97.61
PRK09260289 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.6
PRK05396341 tdh L-threonine 3-dehydrogenase; Validated 97.52
cd01488291 Uba3_RUB Ubiquitin activating enzyme (E1) subunit UBA3. 97.47
PRK06130310 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.4
PRK08293288 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.33
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.11
PRK07660283 consensus 97.02
PRK09117282 consensus 96.9
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.89
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 96.86
pfam02737180 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding do 96.84
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 96.84
PRK07819284 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.82
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.76
PRK10754327 quinone oxidoreductase, NADPH-dependent; Provisional 96.44
PRK02006501 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 96.31
PRK11259377 solA N-methyltryptophan oxidase; Provisional 96.3
COG1250307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] 96.24
PRK11730715 fadB multifunctional fatty acid oxidation complex subun 96.09
cd01486307 Apg7 Apg7 is an E1-like protein, that activates two dif 95.98
PRK08291330 ornithine cyclodeaminase; Validated 98.01
PRK07589346 ornithine cyclodeaminase; Validated 97.99
pfam02423312 OCD_Mu_crystall Ornithine cyclodeaminase/mu-crystallin 97.95
PRK08618325 ornithine cyclodeaminase; Validated 97.95
COG2423330 Predicted ornithine cyclodeaminase, mu-crystallin homol 97.87
PRK06407302 ornithine cyclodeaminase; Provisional 97.79
PRK07340304 ornithine cyclodeaminase; Validated 97.76
PRK06046326 alanine dehydrogenase; Validated 97.74
PRK06141313 ornithine cyclodeaminase; Validated 97.71
PRK06823315 ornithine cyclodeaminase; Validated 97.6
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 97.45
PRK09880343 L-idonate 5-dehydrogenase; Provisional 97.12
PRK10083339 putative dehydrogenase; Provisional 97.06
PRK09422338 alcohol dehydrogenase; Provisional 96.8
KOG0069336 consensus 96.51
COG0686371 Ald Alanine dehydrogenase [Amino acid transport and met 96.42
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>pfam03435 Saccharop_dh Saccharopine dehydrogenase Back     alignment and domain information
>KOG0172 consensus Back     alignment and domain information
>KOG2733 consensus Back     alignment and domain information
>COG3268 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>pfam06408 consensus Back     alignment and domain information
>COG5310 Homospermidine synthase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK11579 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK13301 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10206 putative dehydrogenase; Provisional Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase; InterPro: IPR011342 The shikimate pathway links the metabolism of carbohydrates to the biosynthesis of aromatic compounds and is essential for the biosynthesis of aromatic amino acids and other aromatic compounds in bacteria, eukaryotic microorganisms and plants Back     alignment and domain information
>TIGR01921 DAP-DH diaminopimelate dehydrogenase; InterPro: IPR010190 This entry represents the diaminopimelate dehydrogenase enzyme which provides an alternate (shortcut) route of lysine biosynthesis in Corynebacterium, Bacterioides, Porphyromonas and other species Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>pfam03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase Back     alignment and domain information
>COG0002 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11863 N-acetyl-gamma-glutamyl-phosphate reductase; Provisional Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK08374 homoserine dehydrogenase; Provisional Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit; InterPro: IPR014215 This predicted Rossman fold-containing protein is the A subunit of dipicolinic acid synthetase as found in most, though not all, endospore-forming low-GC Gram-positive bacteria; it is absent in Clostridium Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>PRK06349 homoserine dehydrogenase; Provisional Back     alignment and domain information
>COG3804 Uncharacterized conserved protein related to dihydrodipicolinate reductase [Function unknown] Back     alignment and domain information
>PRK06270 homoserine dehydrogenase; Provisional Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>KOG2741 consensus Back     alignment and domain information
>COG4091 Predicted homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase; InterPro: IPR011284 This entry represents 3-oxoacyl-[ACP] reductase, also called 3-ketoacyl-acyl carrier protein reductase, an enzyme of fatty acid biosynthesis found in many plant and bacterial species Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase; InterPro: IPR011770 Dihydrodipicolinate reductase is an enzyme found in bacteria and higher plants which is involved in the biosynthesis of diaminopimelic acid, a component of bacterial cell walls, and the essential amino acid L-lysine Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases; InterPro: IPR014007 One member of this family, as characterised in Klebsiella terrigena , is able to interconvert acetoin + NADH with meso-2,3-butanediol + NAD(+) Back     alignment and domain information
>PRK05447 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional Back     alignment and domain information
>COG0743 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Lipid metabolism] Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK06813 homoserine dehydrogenase; Validated Back     alignment and domain information
>COG0460 ThrA Homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>PRK06392 homoserine dehydrogenase; Provisional Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase; InterPro: IPR010185 Members of this family are found only in species with evidence of coenzyme F420 Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>PRK06728 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK12464 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional Back     alignment and domain information
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase; InterPro: IPR011548 3-hydroxyisobutyrate dehydrogenase is an enzyme that catalyzes the NAD+-dependent oxidation of 3-hydroxyisobutyrate to methylmalonate semialdehyde of the valine catabolism pathway Back     alignment and domain information
>pfam02056 Glyco_hydro_4 Family 4 glycosyl hydrolase Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK08300 acetaldehyde dehydrogenase; Validated Back     alignment and domain information
>PRK08040 putative semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>COG0677 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF; InterPro: IPR012731 Members of the HesA/MoeB/ThiF family of proteins (IPR000594 from INTERPRO) include a number of members encoded in the midst of thiamine biosynthetic operons Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase; InterPro: IPR000343 Tetrapyrroles are la