HHsearch alignment of GI: 254780743 and MMDB domain: 1mug_A_

>1mug_A (A:) Protein (G:T/U specific DNA glycosylase); hydrolase; 1.80A {Escherichia coli}
Probab=100.00  E-value=3.2e-37  Score=231.89  Aligned_cols=154  Identities=12%  Similarity=0.125  Sum_probs=136.8

Q ss_pred             CCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCC-------------CCCEEEEEECCCCCCCC
Q ss_conf             22367888884899857898300112001207004899999986098622-------------21000000012256666
Q gi|254780743|r   99 TICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRT-------------QIHISMISPWHPPGNRN  165 (261)
Q Consensus        99 ~v~g~G~~~a~imiVgeaPg~~Ed~~G~pF~G~aG~lL~~mL~aigl~r~-------------~vyitn~vkcrPp~nr~  165 (261)
                      +|+|.|+.+|+|||||++||.+|+++|+||+|+.+ +|++||.++|++++             ++|+||+++|+|+.||.
T Consensus         1 ~v~g~g~~~a~ilivG~~Pg~~~~~~g~~f~g~g~-~l~~~l~~~~~~~~~~~~~~~~~l~~~~i~~~~~v~~~~~~~~~   79 (168)
T 1mug_A            1 MVEDILAPGLRVVFCGINPGLSSAGTGFPFAHPAN-RFWKVIYQAGFTDRQLKPQEAQHLLDYRCGVTKLVDRPTVQANE   79 (168)
T ss_dssp             CCCCBCCTTCSEEEEESSCCHHHHHHSSTTCSTTC-CHHHHHHHTTSSSSCCCGGGGGGGGGGTEEEEESCCCCCSSGGG
T ss_pred             CCCCCCCCCCCEEEEECCCCHHHHHCCCCCCCCHH-HHHHHHHHHCCCCCCCCHHHHHHHHHCCEEEECCCCCCCCCCCC
T ss_conf             98876599998899827989658855998778618-89999999659986556777655332366772376778888899


Q ss_pred             CCHHHHHHHHHHHHHHHHHCCCCEEEEECHHHHHHHHCCCCCCCHHCCCEEEEEECCCCCEEEEEEECHHHHHCCHHHHH
Q ss_conf             77889999999999986322976799525599999844653310110650576642897378999708038833659899
Q gi|254780743|r  166 LSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKK  245 (261)
Q Consensus       166 p~~~ei~~c~p~L~~ei~li~Pk~ii~lG~~a~~~ll~~~~~~i~~~rG~~~~~~~~~~~i~~~pt~HPs~LLr~P~~K~  245 (261)
                      |+..|+..|++||.+||++++|++||++|+.|.+++++.. ..+.+.+|+++.    +.++.++|+|||++++++|+. +
T Consensus        80 ~~~~e~~~c~~~l~~ei~~~~P~iiv~lG~~a~~~~~~~~-~~~~~~~~~~~~----~~~~~~lP~~sp~~~~~~~~~-~  153 (168)
T 1mug_A           80 VSKQELHAGGRKLIEKIEDYQPQALAILGKQAYEQGFSQR-GAQWGKQTLTIG----STQIWVLPNPSGLSRVSLEKL-V  153 (168)
T ss_dssp             SCHHHHHHHHHHHHHHHHHHCCSEEEEECHHHHHHHHTCC-SCCSEEEEEEET----TEEEEEECCCSTTSCCCHHHH-H
T ss_pred             CCHHHHHHHHHHHHHHHHHHCCCEEEECCHHHHHHHHCCC-CCCCCCEEECCC----CCCEEEECCCCHHHHCCHHHH-H
T ss_conf             8999999989999999998098889985959999984777-664454000258----977799318987782899999-9


Q ss_pred             HHHHHHHHHHHHHH
Q ss_conf             99999999999986
Q gi|254780743|r  246 NTWHALITLKKALK  259 (261)
Q Consensus       246 ~aW~DL~~l~~~L~  259 (261)
                      .+|++|+.+++.+.
T Consensus       154 ~~~~~l~~~l~~l~  167 (168)
T 1mug_A          154 EAYRELDQALVVRG  167 (168)
T ss_dssp             HHHHHHHHHSCC--
T ss_pred             HHHHHHHHHHHHCC
T ss_conf             99999999998645