HHsearch alignment of GI: 254780743 and MMDB domain: 4eug_A_45-229

>4eug_A (A:45-229) UDG, UNG, protein (glycosylase); 1.40A {Escherichia coli}
Probab=90.66  E-value=1.1  Score=23.50  Aligned_cols=116  Identities=17%  Similarity=0.203  Sum_probs=66.2

Q ss_pred             CCCEEEEECCCCCC-CCCCCCCCCCCCH-HH---HHHHHHHCC-----CC-----------CCCCCEEEEEECCCCCCCC
Q ss_conf             88489985789830-0112001207004-89---999998609-----86-----------2221000000012256666
Q gi|254780743|r  107 GQDLMIIGYTPSDS-DNISGKPFSGKTG-NM---LDKMLQSIE-----IM-----------RTQIHISMISPWHPPGNRN  165 (261)
Q Consensus       107 ~a~imiVgeaPg~~-Ed~~G~pF~G~aG-~l---L~~mL~aig-----l~-----------r~~vyitn~vkcrPp~nr~  165 (261)
                      +-||+|+|+-|-.. ++..|..|.-+.| ++   |.++++++.     +.           ++.|.+.|.+--.-.|. .
T Consensus        11 ~vkVVIlGQDPY~~~~~A~GlaFsv~~~~~~p~SL~NI~kel~~~~~~~~~p~~g~L~~Wa~QGVLLLN~~LTv~~~~-~   89 (185)
T 4eug_A           11 DVKVVILGQDPYHGPGQAHGLAFSVRPGIAIPPSLLNMYKELENTIPGFTRPNHGYLESWARQGVLLLNTVLTVRAGQ-A   89 (185)
T ss_dssp             GCCEEEEESSCCCSTTTCSSSTTCCCTTSCCCHHHHHHHHHHHHHSTTCCCCSCCCCHHHHTTTEEEEESSCCEETTB-T
T ss_pred             HCEEEEEECCCCCCCCCCCEEEECCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCHHHHHCCEEEEEEEEEEECCC-C
T ss_conf             857999954788655434402201358988882499999999987389977899854045416726774258997366-6


Q ss_pred             CCHHH--HHHHHHHHHHHHH-HCCCCEEEEECHHHHHHHHCCCCCCCHHCCCEEEEEECCCCCEEEEEEECHHHHHCC
Q ss_conf             77889--9999999999863-229767995255999998446533101106505766428973789997080388336
Q gi|254780743|r  166 LSNIE--MEICRPIIMRQIE-LISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQY  240 (261)
Q Consensus       166 p~~~e--i~~c~p~L~~ei~-li~Pk~ii~lG~~a~~~ll~~~~~~i~~~rG~~~~~~~~~~~i~~~pt~HPs~LLr~  240 (261)
                      -+...  -+.+..-+.+.|. -.++-+.++.|+.|.+.. .    .+..            ....++-+.|||.|-++
T Consensus        90 ~SH~~~gWe~ft~~ii~~i~~~~~~ivf~LwG~~A~~~~-~----~i~~------------~~~~vl~~~HPSPls~~  150 (185)
T 4eug_A           90 HSHASLGWETFTDKVISLINQHREGVVFLLWGSHAQKKG-A----IIDK------------QRHHVLKAPQPSPLSAH  150 (185)
T ss_dssp             TTTTTSSHHHHHHHHHHHHHHHCSSCEEEEESHHHHHHT-T----TSCT------------TTSEEEEECCSSTTTGG
T ss_pred             CCCCCHHHHHHHHHHHHHHHCCCCCEEEEEEEEHHHHHH-H----HHCC------------CCCEEEECCCCCCHHCC
T ss_conf             663101289999999999971788869998511167787-6----5046------------78659983899802047