Query         gi|254780743|ref|YP_003065156.1| putative uracil-DNA glycosylase [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 261
No_of_seqs    186 out of 1458
Neff          6.3 
Searched_HMMs 33803
Date          Wed Jun  1 14:16:47 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780743.hhm -d /home/congqian_1/database/mmdb/mmdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 >1ui0_A Uracil-DNA glycosylase 100.0       0       0  315.6  16.0  182   75-261     1-188 (205)
  2 >1vk2_A Uracil-DNA glycosylase 100.0       0       0  317.6  14.1  191   68-261    11-203 (204)
  3 >3ikb_A Uncharacterized conser 100.0       0       0  291.0   4.9  151  105-260     2-163 (165)
  4 >2d3y_A Uracil-DNA glycosylase 100.0       0       0  281.3  12.6  182   74-259    17-218 (219)
  5 >1wyw_A TDG, G/T mismatch-spec 100.0 2.2E-43       0  267.0  11.5  175   86-261     1-193 (199)
  6 >1oe4_A SMUG1, single-strand s 100.0 1.4E-45       0  280.1  -2.3  166   76-255    57-240 (247)
  7 >2c2q_A G/U mismatch-specific  100.0 2.7E-41 1.4E-45  255.1  11.2  174   84-261     2-190 (199)
  8 >1mug_A Protein (G:T/U specifi 100.0 3.2E-37 9.4E-42  231.9   9.6  154   99-259     1-167 (168)
  9 >3fci_A UDG, uracil-DNA glycos  93.6    0.49 1.4E-05   25.6   8.9  116  106-239    54-193 (223)
 10 >2j8x_A Uracil-DNA glycosylase  93.3    0.54 1.6E-05   25.3   9.8  114  107-238    11-147 (184)
 11 >4eug_A UDG, UNG, protein (gly  90.7     1.1 3.4E-05   23.5   8.4  116  107-240    11-150 (185)
 12 >3cxm_A Uracil-DNA glycosylase  89.7     1.4 4.1E-05   23.0   8.6  116  107-240    10-151 (186)
 13 >2boo_A UDG, uracil-DNA glycos  88.3     1.7 5.1E-05   22.5   8.3  117  105-239    72-212 (247)
 14 >1udg_A Uracil-DNA glycosylase  86.2     2.3 6.8E-05   21.8   7.9  116  107-241    10-149 (175)
 15 >1uok_A Oligo-1,6-glucosidase;  74.4       6 0.00018   19.4   5.3   18    9-26    107-124 (206)
 16 >2zhx_A UDG, uracil-DNA glycos  69.2       8 0.00024   18.7  12.1  120  103-240    66-209 (238)
 17 >2owr_A UDG, uracil-DNA glycos  67.9     8.5 0.00025   18.5  10.0   96  105-201    10-120 (171)
 18 >1y5e_A Molybdenum cofactor bi  60.2      12 0.00035   17.7   6.2   74  100-195     8-81  (169)
 19 >1em8_B DNA polymerase III PSI  59.0      13 0.00037   17.6   4.3   91  105-253     9-102 (112)
 20 >1mkz_A Molybdenum cofactor bi  38.0      28 0.00082   15.6   7.0   77   99-197     4-80  (172)
 21 >1nrp_R Receptor based peptide  33.2     4.8 0.00014   19.9  -1.7   17  235-251     5-22  (26)
 22 >3hki_C Proteinase-activated r  30.5     4.8 0.00014   19.9  -2.1   18  235-252     1-19  (26)
 23 >3jwp_A Transcriptional regula  30.1      37  0.0011   14.8   3.6   73   76-148   126-208 (213)
 24 >2b4y_A NAD-dependent deacetyl  27.8      41  0.0012   14.6   3.8   65   76-140   129-202 (203)
 25 >1r7a_A Sucrose phosphorylase;  23.1      51  0.0015   14.1   2.1  132    8-192    18-153 (219)
 26 >1g94_A Alpha-amylase; beta-al  22.3      50  0.0015   14.1   1.9   25    8-32     12-37  (277)
 27 >2jsx_A Protein NAPD; TAT, pro  21.2      56  0.0016   13.9   2.1   42   72-121    14-55  (95)
 28 >1g5a_A Amylosucrase; glycosyl  20.7      54  0.0016   13.9   1.8   14  108-121   246-259 (414)

No 1  
>>1ui0_A Uracil-DNA glycosylase; base excision repair, iron/sulfer cluster, thermophIle, riken structural genomics/proteomics initiative, RSGI; 1.50A {Thermus thermophilus} (A:)
Probab=100.00  E-value=0  Score=315.64  Aligned_cols=182  Identities=29%  Similarity=0.530  Sum_probs=173.5

Q ss_pred             CCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCEEE
Q ss_conf             99899999996003885200287722367888884899857898300112001207004899999986098622210000
Q gi|254780743|r   75 CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISM  154 (261)
Q Consensus        75 ~~l~~L~~~~~~~~~C~L~~~~~~~v~g~G~~~a~imiVgeaPg~~Ed~~G~pF~G~aG~lL~~mL~aigl~r~~vyitn  154 (261)
                      .+|++|++.+.+|..|+++..+.++|+|.|+++|+|||||++||.+|+++|.||+|++|++|++||.++||++++||+||
T Consensus         1 ~~l~~L~~~i~~C~~C~~~~~~~~~v~~~g~~~a~iliIg~~P~~~~~~~G~~f~g~aG~~L~~~l~~~gl~~~~vyit~   80 (205)
T 1ui0_A            1 MTLELLQAQAQNCTACRLMEGRTRVVFGEGNPDAKLMIVGEGPGEEEDKTGRPFVGKAGQLLNRILEAAGIPREEVYITN   80 (205)
T ss_dssp             -CHHHHHHHHTTCCSSGGGTTCSSCCCCEECTTCSEEEEESCCCHHHHHHSCSSCSHHHHHHHHHHHHHTCCGGGSEEEE
T ss_pred             CCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCHHHEEEEE
T ss_conf             98899999986688898987898855578999999999978214544444411153504368888998398899958861


Q ss_pred             EEECCCCCCCCCCHHHHHHHHH-HHHHHHHHCCCCEEEEECHHHHHHHHCCCCCCCHHCCCEEEEEECCCCCEEEEEEEC
Q ss_conf             0001225666677889999999-999986322976799525599999844653310110650576642897378999708
Q gi|254780743|r  155 ISPWHPPGNRNLSNIEMEICRP-IIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVH  233 (261)
Q Consensus       155 ~vkcrPp~nr~p~~~ei~~c~p-~L~~ei~li~Pk~ii~lG~~a~~~ll~~~~~~i~~~rG~~~~~~~~~~~i~~~pt~H  233 (261)
                      ++||+|++|+.|+..|+..|++ ||.+||++++|++||++|+.|.+++++.. .++.+.+|+|+++    .+++++++||
T Consensus        81 lvkc~p~~~~~~~~~ei~~c~~~~L~~ei~l~~P~~ii~lG~~a~~~ll~~~-~~~~~~~g~~~~~----~~~~~~~~~h  155 (205)
T 1ui0_A           81 IVKCRPPQNRAPLPDEAKICTDKWLLKQIELIAPQIIVPLGAVAAEFFLGEK-VSITKVRGKWYEW----HGIKVFPMFH  155 (205)
T ss_dssp             SCSSCCGGGCCCCHHHHHHHHHHTHHHHHHHHCCSEEEEBSHHHHHHHHTSC-CCHHHHTTCCEEE----TTEEECCBCC
T ss_pred             EEEECCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEEECCCHHEEHHHHCC-CCHHHHCCCEEEC----CCCEEEEECC
T ss_conf             4646033456798599999999999999985488489952501000113103-5201214834862----8977999828


Q ss_pred             HHHHHCC-----HHHHHHHHHHHHHHHHHHHCC
Q ss_conf             0388336-----598999999999999998609
Q gi|254780743|r  234 PQELIQY-----PLIKKNTWHALITLKKALKNL  261 (261)
Q Consensus       234 Ps~LLr~-----P~~K~~aW~DL~~l~~~L~~l  261 (261)
                      ||+|++|     |+.|+.+|+||+.+++.|+++
T Consensus       156 PS~l~~~~~~~~p~~~~~~~~~L~~~~~~l~~~  188 (205)
T 1ui0_A          156 PAYLLRNPSRAPGSPKHLTWLDIQEVKRALDAL  188 (205)
T ss_dssp             HHHHHHSCCCSTTCHHHHHHHHHHHHHHHHHHC
T ss_pred             CHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHCC
T ss_conf             689876925343046789999999999999726


No 2  
>>1vk2_A Uracil-DNA glycosylase TM0511; structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics, hydrolase; 1.90A {Thermotoga maritima} (A:)
Probab=100.00  E-value=0  Score=317.64  Aligned_cols=191  Identities=18%  Similarity=0.366  Sum_probs=180.2

Q ss_pred             HHHCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCC
Q ss_conf             23002469989999999600388520028772236788888489985789830011200120700489999998609862
Q gi|254780743|r   68 DSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR  147 (261)
Q Consensus        68 ~~~a~~~~~l~~L~~~~~~~~~C~L~~~~~~~v~g~G~~~a~imiVgeaPg~~Ed~~G~pF~G~aG~lL~~mL~aigl~r  147 (261)
                      ...+....++++|++.+.+|..|+++..++++++|.|+++|+|||||++||.+|+++|++|+|++|++|++||.++||++
T Consensus        11 ~~~~~~~~~~~~L~~~i~~c~~c~l~~~~~~~~~~~g~~~a~il~ig~~Pg~~~~~~G~~f~g~sG~~L~~~L~~~gl~~   90 (204)
T 1vk2_A           11 HHXYTREELXEIVSERVKKCTACPLHLNRTNVVVGEGNLDTRIVFVGEGPGEEEDKTGRPFVGRAGXLLTELLRESGIRR   90 (204)
T ss_dssp             --CCCHHHHHHHHHHHHHHCCSSGGGGTCSSCCCCEECTTCSEEEEESCCCHHHHHHTCSSCSHHHHHHHHHHHHTTCCG
T ss_pred             HHCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCEEEEECCHHHHHHHHCCEEHHHHHHHHHHHHHHHCCCC
T ss_conf             31267999999999999707789798899887788899987889995433566787487606636889999987620230


Q ss_pred             CCCCEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEECHHHHHHHHCCCCCCCHHCCCEEEEEECCCCCEE
Q ss_conf             22100000001225666677889999999999986322976799525599999844653310110650576642897378
Q gi|254780743|r  148 TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIP  227 (261)
Q Consensus       148 ~~vyitn~vkcrPp~nr~p~~~ei~~c~p~L~~ei~li~Pk~ii~lG~~a~~~ll~~~~~~i~~~rG~~~~~~~~~~~i~  227 (261)
                      +++|+||++||+|++||.|+..|+..|++||.+||++++|++||+||..|++++++....++...||+|+++.   .+++
T Consensus        91 ~~~~itn~vk~~~~~~~~~~~~e~~~c~~~L~~ei~~i~P~~iv~lG~~a~~~~l~~~~~~~~~~~G~~~~~~---~~~~  167 (204)
T 1vk2_A           91 EDVYICNVVKCRPPNNRTPTPEEQAACGHFLLAQIEIINPDVIVALGATALSFFVDGKKVSITKVRGNPIDWL---GGKK  167 (204)
T ss_dssp             GGSEEEESCSSCCGGGCCCCHHHHHHHHHHHHHHHHHHCCSEEEEESHHHHHHTTTTCCCCHHHHTTCCEECG---GGCE
T ss_pred             CCEEEEEEECCCCCCCCCCCHHHHHHHCHHHHHHHHCCCCCEEEECCHHHHHHHHCCCCCCCCCCCCCEEECC---CCCE
T ss_conf             3647864431447644456709999745223555540487317730658899986245665431367358868---9987


Q ss_pred             EEEEECHHHHHCCH--HHHHHHHHHHHHHHHHHHCC
Q ss_conf             99970803883365--98999999999999998609
Q gi|254780743|r  228 TLATVHPQELIQYP--LIKKNTWHALITLKKALKNL  261 (261)
Q Consensus       228 ~~pt~HPs~LLr~P--~~K~~aW~DL~~l~~~L~~l  261 (261)
                      +++|||||+++++|  ..|+.+|+||+.+++.|+++
T Consensus       168 v~~~~hPs~l~~~~~~~~k~~~~~~l~~~~~~l~~~  203 (204)
T 1vk2_A          168 VIPTFHPSYLLRNRSNELRRIVLEDIEKAKSFIKKE  203 (204)
T ss_dssp             EEEECCHHHHHHCCCHHHHHHHHHHHHHHHTTSCC-
T ss_pred             EEEEECCHHHHHCCCHHHHHHHHHHHHHHHHHHHHC
T ss_conf             999849779877938788999999999999999853


No 3  
>>3ikb_A Uncharacterized conserved protein; APC63946, streptococcus mutans UA159, structural genomics, PSI-2, protein structure initiative; HET: FLC; 1.67A {Streptococcus mutans} (A:34-198)
Probab=100.00  E-value=0  Score=290.99  Aligned_cols=151  Identities=13%  Similarity=0.159  Sum_probs=139.6

Q ss_pred             CCCCCEEEEECCCCCCCCCCCCCCCCCCHHHHHHH---HHHCCCCCCCCCEEEEEECCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             88884899857898300112001207004899999---986098622210000000122566667788999999999998
Q gi|254780743|r  105 TEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKM---LQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQ  181 (261)
Q Consensus       105 ~~~a~imiVgeaPg~~Ed~~G~pF~G~aG~lL~~m---L~aigl~r~~vyitn~vkcrPp~nr~p~~~ei~~c~p~L~~e  181 (261)
                      +++|+||||||+||.+||++|+||+|+||++|++|   +.+.|+++++||+||+|||+|++||.|+..|+..|++||.+|
T Consensus         2 ~~~a~imiVgeaPg~~e~~~G~pF~G~aG~~L~~~l~~~~~~~~~~~~vyit~~vkc~p~~nr~p~~~e~~~c~~~L~~e   81 (165)
T 3ikb_A            2 PKTARINIVGQAPGIKAQESRLYWNDKSGDRLREWXGVDYDTFYHSGYFAVIPXDFYYPGKGKSGDLPPRKGFAQKWHQP   81 (165)
T ss_dssp             CTTCCEEEECSCCCHHHHHHCCSSCSHHHHHHHHHHTCCHHHHHHSSCEEECCSCSSCCCBCSSSBCCCCTTHHHHHHHH
T ss_pred             CCCCCEEEECCCCCHHHHHHCCCCCCHHHHHHHHHHCCHHHCCCCCCCEEEEEEEECCCCCCCCCCCCCHHHHHHHHHHH
T ss_conf             99986899758986666530897737178999998543043135655447887532389988899985178999999999


Q ss_pred             H--HHCCCCEEEEECHHHHHHHHCCC-CCCCHHCCCEEEEEECCCCCEEEEEEECHHHHHC-----CHHHHHHHHHHHHH
Q ss_conf             6--32297679952559999984465-3310110650576642897378999708038833-----65989999999999
Q gi|254780743|r  182 I--ELISPKILLFIGNKTKNFFFNND-AQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ-----YPLIKKNTWHALIT  253 (261)
Q Consensus       182 i--~li~Pk~ii~lG~~a~~~ll~~~-~~~i~~~rG~~~~~~~~~~~i~~~pt~HPs~LLr-----~P~~K~~aW~DL~~  253 (261)
                      |  ++++|++||+||++|++++++.. ..++.+.||+|+++     +++++|||||||++|     +|..|+.+|+||+.
T Consensus        82 i~~~lv~P~~Iv~lG~~A~~~ll~~~~~~~~~~~~g~~~~~-----~~~~~~~~HPs~llr~~~~~~p~~~~~~~~dl~~  156 (165)
T 3ikb_A           82 ILDLLPDIQLTILIGNYAQKYYLHQKSSVKLTDTVAHYKKY-----LPDYFPLVHPSPRNQIWXSRHPWFEAQVVPDLKK  156 (165)
T ss_dssp             HHTTCTTCCEEEEESHHHHHHHTTCCTTSCHHHHHHTGGGG-----TTTEEEECCCCGGGHHHHHHCTHHHHTHHHHHHH
T ss_pred             HHHHCCCCCEEEEECHHHHHHHCCCCCCCCCEEEEECCHHC-----CCCEEEECCCCCCCCHHHHHCCHHHHHHHHHHHH
T ss_conf             99855897599986899999870866678700014403220-----8987987389846607774392366875999999


Q ss_pred             HHHHHHC
Q ss_conf             9999860
Q gi|254780743|r  254 LKKALKN  260 (261)
Q Consensus       254 l~~~L~~  260 (261)
                      +++.|.+
T Consensus       157 ~~~~l~~  163 (165)
T 3ikb_A          157 IIQQIIQ  163 (165)
T ss_dssp             HHHHHHH
T ss_pred             HHHHHHH
T ss_conf             9999973


No 4  
>>2d3y_A Uracil-DNA glycosylase; base excision repair, iron/sulfer cluster, thermophIle, structural genomics, NPPSFA; HET: DU; 1.55A {Thermus thermophilus HB8} PDB: 2ddg_A* 2dem_A* 2dp6_A* (A:)
Probab=100.00  E-value=0  Score=281.26  Aligned_cols=182  Identities=12%  Similarity=0.131  Sum_probs=162.8

Q ss_pred             CCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCC-CCCCCCCCCC-CCHHHHHHHHHHCCCCCCCCC
Q ss_conf             69989999999600388520028772236788888489985789830-0112001207-004899999986098622210
Q gi|254780743|r   74 ACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDS-DNISGKPFSG-KTGNMLDKMLQSIEIMRTQIH  151 (261)
Q Consensus        74 ~~~l~~L~~~~~~~~~C~L~~~~~~~v~g~G~~~a~imiVgeaPg~~-Ed~~G~pF~G-~aG~lL~~mL~aigl~r~~vy  151 (261)
                      +..++.|++.+..|..|.+++.+.++|+|.|+++|+||||||+||.. ||++|+||+| .+|++|+++|.++||+++++|
T Consensus        17 ~~~~~~l~~~~~~~~~~~l~~~~~~~v~g~g~~~a~vl~VgeaPg~~~e~~~G~pF~g~~~g~~l~~~l~~~Gl~~~~~~   96 (219)
T 2d3y_A           17 PRLVAWREEVVGRKRAFRGEPYWARPVPGFGDPEARILLFGLAPGAHGSNRTGRPFTGDASGAFLYPLLHEAGLSSKPES   96 (219)
T ss_dssp             HHHHHHHHHTTTTSGGGTTSCCCCSCCCCEECTTCSEEEEESCCCTTTHHHHSSTTTTSHHHHHHHHHHHHTTCBSCSCC
T ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCEECCHHHHHHHHHHHHHCCCCCCHH
T ss_conf             78999999998620122374136883289999774789960542001023478641034037788888998467643010


Q ss_pred             ------------EEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHC-CCCEEEEECHHHHHHHHCCC---CCCCHHCCCE
Q ss_conf             ------------0000001225666677889999999999986322-97679952559999984465---3310110650
Q gi|254780743|r  152 ------------ISMISPWHPPGNRNLSNIEMEICRPIIMRQIELI-SPKILLFIGNKTKNFFFNND---AQKTYQNLGK  215 (261)
Q Consensus       152 ------------itn~vkcrPp~nr~p~~~ei~~c~p~L~~ei~li-~Pk~ii~lG~~a~~~ll~~~---~~~i~~~rG~  215 (261)
                                  +||++||+| +||.|+..|++.|++||.+||+++ +|++||+||+.|.+++++..   ...+...||+
T Consensus        97 ~~~~~~~~~~~~~t~~vk~~~-~~r~p~~~ei~~c~~~L~~ei~ll~~P~iIv~lG~~a~~~~~~~~~~~~~~~~~~~g~  175 (219)
T 2d3y_A           97 LPGDDLRLYGVYLTAAVRCAP-PKNKPTPEELRACARWTEVELGLLPEVRVYVALGRIALEALLAHFGLRKSAHPFRHGA  175 (219)
T ss_dssp             CTTSCCCBSSEEEEESCCSCC-GGGCCCHHHHHHHHHHHHHHHHTCTTCCEEEEESHHHHHHHHHHHTCCTTTSCCCTTC
T ss_pred             CCCCCCCCCCEEECCCCCCCC-CCCCCCCHHHHHHCCHHHHHHHHHCCCCEEEEECHHHHHHHHHHCCCCCCCCCCCCCE
T ss_conf             012101011201015532367-6668970888884866799999842861454303899998776516521223420221


Q ss_pred             EEEEECCCCCEEEEEEECHHHHHCCHHH--HHHHHHHHHHHHHHHH
Q ss_conf             5766428973789997080388336598--9999999999999986
Q gi|254780743|r  216 WSNLCTPHSIIPTLATVHPQELIQYPLI--KKNTWHALITLKKALK  259 (261)
Q Consensus       216 ~~~~~~~~~~i~~~pt~HPs~LLr~P~~--K~~aW~DL~~l~~~L~  259 (261)
                      ++.+.   .+++++|+||||+++|||..  +..+|+||+++++.|.
T Consensus       176 ~~~~~---~~~~~~~~~hPs~l~~~~~~~~~~~~~~dl~~l~~~l~  218 (219)
T 2d3y_A          176 HYPLP---GGRHLLASYHVSRQNTQTGRLTREMFLEVLMEAKRLAG  218 (219)
T ss_dssp             EEEET---TTEEEEEECCCSHHHHHHTSSCHHHHHHHHHHHHHHTT
T ss_pred             EEECC---CCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCC
T ss_conf             77379---99389998688866658792009999999999999719


No 5  
>>1wyw_A TDG, G/T mismatch-specific thymine DNA glycosylase; hydrolase; 2.10A {Homo sapiens} (A:1-199)
Probab=100.00  E-value=2.2e-43  Score=267.01  Aligned_cols=175  Identities=16%  Similarity=0.160  Sum_probs=162.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCC-------------CCCCCE
Q ss_conf             0038852002877223678888848998578983001120012070048999999860986-------------222100
Q gi|254780743|r   86 SFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIM-------------RTQIHI  152 (261)
Q Consensus        86 ~~~~C~L~~~~~~~v~g~G~~~a~imiVgeaPg~~Ed~~G~pF~G~aG~lL~~mL~aigl~-------------r~~vyi  152 (261)
                      .|+.|++|..++++|+|.|+++|+|||||++||.+|+++|.||+|++|++|++|+.++|++             +++||+
T Consensus         1 ~c~~c~~~~~~~~~v~~~g~~~a~iliVG~~Pg~~~~~~g~~f~g~~g~~l~~~l~~~g~~~~~~~~~~~~~l~~~~i~~   80 (199)
T 1wyw_A            1 GSNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGF   80 (199)
T ss_dssp             -------CCGGGCCCCCBCCSSCSEEEEESSCCHHHHHHTSSSCSSSBCHHHHHHHTTSSSSCCCGGGGGGHHHHHSEEE
T ss_pred             CCCCCCHHHHHHCCCCCCCCCCCCEEEEECCCCHHHHHCCCCCCCCHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCCCCC
T ss_conf             98877899997377998779998689982697977896499865806899999999737875578778877776404454


Q ss_pred             EEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEECHHHHHHHHCCCCCCCHHCCCEEEEEEC--CCCCEEEEE
Q ss_conf             000001225666677889999999999986322976799525599999844653310110650576642--897378999
Q gi|254780743|r  153 SMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCT--PHSIIPTLA  230 (261)
Q Consensus       153 tn~vkcrPp~nr~p~~~ei~~c~p~L~~ei~li~Pk~ii~lG~~a~~~ll~~~~~~i~~~rG~~~~~~~--~~~~i~~~p  230 (261)
                      ||+++|+|+.|+.|+..|+..|.+||.+||++++|++||++|+.|.+.+++.. ..+.+.+|+|+....  ...++++++
T Consensus        81 t~~v~~~~~~~~~~~~~e~~~~~~~L~~ei~~~~P~~i~~lG~~a~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~  159 (199)
T 1wyw_A           81 TNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEV-FGVKVKNLEFGLQPHKIPDTETLCYV  159 (199)
T ss_dssp             EESCCSCCSCGGGCCHHHHHHHHHHHHHHHHHHCCSEEEEESHHHHHHHHHHH-TCCCCSSCCSEECSCCSTTSCCEEEE
T ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEECCHHHHHHHHHHC-CCCCCCCCCCCCCCCCCCCCCCEEEE
T ss_conf             44314678888999889999868999999998199889663999999997400-26664213235564335888745997


Q ss_pred             EECHHHHHCCH---HHHHHHHHHHHHHHHHHHCC
Q ss_conf             70803883365---98999999999999998609
Q gi|254780743|r  231 TVHPQELIQYP---LIKKNTWHALITLKKALKNL  261 (261)
Q Consensus       231 t~HPs~LLr~P---~~K~~aW~DL~~l~~~L~~l  261 (261)
                      +||||+++++|   +.|+.+|++|+.+.+.|+++
T Consensus       160 ~~hpS~l~~~~~~~~~~~~~~~~l~~~~~~l~~~  193 (199)
T 1wyw_A          160 MPSSSARCAQFPRAQDKVHYYIKLKDLRDQLKGI  193 (199)
T ss_dssp             ECCCBTTCSSCCSGGGTHHHHHHHHHHHHHHTTC
T ss_pred             CCCCHHHHHCCCCHHHHHHHHHHHHHHHHHHHHH
T ss_conf             3897088706652699999999999999998777


No 6  
>>1oe4_A SMUG1, single-strand selective monofunctional uracil DNA glycosylase; hydrolase, hydrolase/complex, SMUG1; HET: 3DR; 2.0A {Xenopus laevis} (A:)
Probab=100.00  E-value=1.4e-45  Score=280.10  Aligned_cols=166  Identities=11%  Similarity=0.035  Sum_probs=146.5

Q ss_pred             CHHHHHHHHHCCCCCCCCCCCCCCCCCC-CCCCCCEEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCC----CC
Q ss_conf             9899999996003885200287722367-888884899857898300112001207004899999986098622----21
Q gi|254780743|r   76 SLHELKSLLRSFHDCHLCSTSLSTICAT-QTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRT----QI  150 (261)
Q Consensus        76 ~l~~L~~~~~~~~~C~L~~~~~~~v~g~-G~~~a~imiVgeaPg~~Ed~~G~pF~G~aG~lL~~mL~aigl~r~----~v  150 (261)
                      .+.+|...+..|..|.++.++.+.+.+. |..++++|+|||+||.+||.+|.||+|+||++|++||+++|++++    +|
T Consensus        57 ~l~~l~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~igeaP~~~ed~~g~pf~g~sG~~L~~~l~~~gl~~~~f~~~~  136 (247)
T 1oe4_A           57 LFLGMNPGPFGMAQTGVPFGEVNHVRDWLQIEGPVSKPEVEHPKRRIRGFECPQSEVSGARFWSLFKSLCGQPETFFKHC  136 (247)
T ss_dssp             EEEESSCCTTTHHHHSSTTCCHHHHHHTTCCCCCCCCCSSCCTTSCCCGGGCCSCCHHHHHHHHHHHHHHSSHHHHHTTE
T ss_pred             EEEECCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCHHHHHHHH
T ss_conf             99842898777864087858879998785367746789644777765354664256529889999998739988986634


Q ss_pred             CEEEEEECCC-----------CCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEECHHHHHHHHCCCCCCCHHCCCEEEEE
Q ss_conf             0000000122-----------56666778899999999999863229767995255999998446533101106505766
Q gi|254780743|r  151 HISMISPWHP-----------PGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNL  219 (261)
Q Consensus       151 yitn~vkcrP-----------p~nr~p~~~ei~~c~p~L~~ei~li~Pk~ii~lG~~a~~~ll~~~~~~i~~~rG~~~~~  219 (261)
                      ||||+|||+|           +.||+|+..|+..|++||.+||++++|++||+||++|.+++++     +.+.||+|   
T Consensus       137 yitn~v~c~p~~~~~k~~~~~~~nr~p~~~e~~~C~~~L~~eI~l~~P~iIv~lG~~a~~~ll~-----~~~~~g~~---  208 (247)
T 1oe4_A          137 FVHNHCPLIFMNHSGKNLTPTDLPKAQRDTLLEICDEALCQAVRVLGVKLVIGVGRFSEQRARK-----ALMAEGID---  208 (247)
T ss_dssp             EEEESCCCEEECTTCCEECGGGSCHHHHHHHHHHHHHHHHHHHHHHTCSEEEEESHHHHHHHHH-----HHHHTTCS---
T ss_pred             EEEECCCCEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECHHHHHHHHH-----HHCCCCCC---
T ss_conf             0451377223288998688133789999999999999999999862972899977899999999-----85146998---


Q ss_pred             ECCCCCEEEEEEECHHHH--HCCHHHHHHHHHHHHHHH
Q ss_conf             428973789997080388--336598999999999999
Q gi|254780743|r  220 CTPHSIIPTLATVHPQEL--IQYPLIKKNTWHALITLK  255 (261)
Q Consensus       220 ~~~~~~i~~~pt~HPs~L--Lr~P~~K~~aW~DL~~l~  255 (261)
                            +++++||||||+  +++|+.|+.+|+||+.++
T Consensus       209 ------i~v~~~~HPS~~~~~~~~~~~~~~~~~l~~lk  240 (247)
T 1oe4_A          209 ------VTVKGIMHPSPRNPQANKGWEGIVRGQLLELG  240 (247)
T ss_dssp             ------CEEEEECCCCTTCGGGTTTHHHHHHHHHHHHT
T ss_pred             ------CEEEECCCCCCCCHHHCCCCHHHHHHHHHHCC
T ss_conf             ------36865589999880010583899999999877


No 7  
>>2c2q_A G/U mismatch-specific DNA glycosylase; radiation resistance, DNA repair enzymes, uracil-DNA glycosylase, MUG, hydrolase; 1.7A {Deinococcus radiodurans} PDB: 2c2p_A (A:)
Probab=100.00  E-value=2.7e-41  Score=255.07  Aligned_cols=174  Identities=10%  Similarity=0.036  Sum_probs=149.4

Q ss_pred             HHCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHCC------------CCCCCCC
Q ss_conf             9600388520028772236788888489985789830011200120700489999998609------------8622210
Q gi|254780743|r   84 LRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIE------------IMRTQIH  151 (261)
Q Consensus        84 ~~~~~~C~L~~~~~~~v~g~G~~~a~imiVgeaPg~~Ed~~G~pF~G~aG~lL~~mL~aig------------l~r~~vy  151 (261)
                      .+.|+.|+|++.+++.|+|.|+.+|+|||||++||.+|+++|+||+|++|++|+.|+++.+            |.+.+||
T Consensus         2 ~~~c~~C~l~~~~~~~v~g~g~~~a~iliiG~aPg~~~~~~G~pf~g~sg~~l~~l~~~g~~~~~~~~~~~~~l~~~~v~   81 (199)
T 2c2q_A            2 TAPHDVPDLTGSGEYLVPDVLQPGLTLVLVGTAPSGISARARAYYANPENKFWRTLHAVGLTPRQLVPQEYATLPQYGLG   81 (199)
T ss_dssp             -----CCCTTTTTTCSSCCBCCTTCSEEEEESCCCHHHHHHTSSSCSTTCCHHHHHHHTTSSSSCCCGGGGGGGGGGTEE
T ss_pred             CCCCCCCCHHCCCCCCCCCCCCCCCCEEEEECCCCHHHHHCCCCCCCCCCHHHHHHHHHHCCCCCCCHHHHCCCCCCCCE
T ss_conf             98888712120477758987799984899846979879974987568620789999885168877786662331124613


Q ss_pred             EEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEECHHHHHHHHCCCCCCCHHCCCEEEEEECCCCCEEEEEE
Q ss_conf             00000012256666778899999999999863229767995255999998446533101106505766428973789997
Q gi|254780743|r  152 ISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLAT  231 (261)
Q Consensus       152 itn~vkcrPp~nr~p~~~ei~~c~p~L~~ei~li~Pk~ii~lG~~a~~~ll~~~~~~i~~~rG~~~~~~~~~~~i~~~pt  231 (261)
                      +||++||+|++|+.++..|+  |.+||.+||++++|++||++|+.|.+.+++... .....++++ .....+.+++++++
T Consensus        82 it~~vk~~~~~~~~~~~~e~--~~~~L~~ei~~~~P~iiv~lG~~a~~~~~~~~~-~~~~~~~~~-~~~~~~~~~~~~~l  157 (199)
T 2c2q_A           82 LTDVAKRHSGVAAALPGEAW--RPDELRRKVEHYRPRIVAFTSKRGASETLGVPT-GKLPYGPQP-QPLDWPAETELWVL  157 (199)
T ss_dssp             EEESCCSCCSCGGGSCGGGC--CHHHHHHHHHHHCCSEEEESSHHHHHHHHCSCG-GGCCSEECC-CCSSCCTTCEEEEC
T ss_pred             EECCCCCCCCCCCCCCHHHH--HHHHHHHHHHHHCCCEEEEECHHHHHHHHCCCC-CCCCCCCCC-CCCCCCCCCCEEEE
T ss_conf             54135656888788756666--676799999960996899817799999853564-434334332-00235678744564


Q ss_pred             ECHHHHH--CCHHHHHHHHHH-HHHHHHHHHCC
Q ss_conf             0803883--365989999999-99999998609
Q gi|254780743|r  232 VHPQELI--QYPLIKKNTWHA-LITLKKALKNL  261 (261)
Q Consensus       232 ~HPs~LL--r~P~~K~~aW~D-L~~l~~~L~~l  261 (261)
                      ||||++.  +++..|+..|.| |+.+++.+.++
T Consensus       158 ~hpS~~~~~~~~~~k~~~~~~~l~~l~~~l~~~  190 (199)
T 2c2q_A          158 PSTSPLGHNHFRLEPWQALGDRVRELRGAAEAG  190 (199)
T ss_dssp             CCCSGGGTTTCCSHHHHHHHHHHHHHHHHHHC-
T ss_pred             CCCCHHHHCCCCHHHHHHHHHHHHHHHHHHHCC
T ss_conf             388858707332568999999999999986436


No 8  
>>1mug_A Protein (G:T/U specific DNA glycosylase); hydrolase; 1.80A {Escherichia coli} (A:)
Probab=100.00  E-value=3.2e-37  Score=231.89  Aligned_cols=154  Identities=12%  Similarity=0.125  Sum_probs=136.8

Q ss_pred             CCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCC-------------CCCEEEEEECCCCCCCC
Q ss_conf             22367888884899857898300112001207004899999986098622-------------21000000012256666
Q gi|254780743|r   99 TICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRT-------------QIHISMISPWHPPGNRN  165 (261)
Q Consensus        99 ~v~g~G~~~a~imiVgeaPg~~Ed~~G~pF~G~aG~lL~~mL~aigl~r~-------------~vyitn~vkcrPp~nr~  165 (261)
                      +|+|.|+.+|+|||||++||.+|+++|+||+|+.+ +|++||.++|++++             ++|+||+++|+|+.||.
T Consensus         1 ~v~g~g~~~a~ilivG~~Pg~~~~~~g~~f~g~g~-~l~~~l~~~~~~~~~~~~~~~~~l~~~~i~~~~~v~~~~~~~~~   79 (168)
T 1mug_A            1 MVEDILAPGLRVVFCGINPGLSSAGTGFPFAHPAN-RFWKVIYQAGFTDRQLKPQEAQHLLDYRCGVTKLVDRPTVQANE   79 (168)
T ss_dssp             CCCCBCCTTCSEEEEESSCCHHHHHHSSTTCSTTC-CHHHHHHHTTSSSSCCCGGGGGGGGGGTEEEEESCCCCCSSGGG
T ss_pred             CCCCCCCCCCCEEEEECCCCHHHHHCCCCCCCCHH-HHHHHHHHHCCCCCCCCHHHHHHHHHCCEEEECCCCCCCCCCCC
T ss_conf             98876599998899827989658855998778618-89999999659986556777655332366772376778888899


Q ss_pred             CCHHHHHHHHHHHHHHHHHCCCCEEEEECHHHHHHHHCCCCCCCHHCCCEEEEEECCCCCEEEEEEECHHHHHCCHHHHH
Q ss_conf             77889999999999986322976799525599999844653310110650576642897378999708038833659899
Q gi|254780743|r  166 LSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKK  245 (261)
Q Consensus       166 p~~~ei~~c~p~L~~ei~li~Pk~ii~lG~~a~~~ll~~~~~~i~~~rG~~~~~~~~~~~i~~~pt~HPs~LLr~P~~K~  245 (261)
                      |+..|+..|++||.+||++++|++||++|+.|.+++++.. ..+.+.+|+++.    +.++.++|+|||++++++|+. +
T Consensus        80 ~~~~e~~~c~~~l~~ei~~~~P~iiv~lG~~a~~~~~~~~-~~~~~~~~~~~~----~~~~~~lP~~sp~~~~~~~~~-~  153 (168)
T 1mug_A           80 VSKQELHAGGRKLIEKIEDYQPQALAILGKQAYEQGFSQR-GAQWGKQTLTIG----STQIWVLPNPSGLSRVSLEKL-V  153 (168)
T ss_dssp             SCHHHHHHHHHHHHHHHHHHCCSEEEEECHHHHHHHHTCC-SCCSEEEEEEET----TEEEEEECCCSTTSCCCHHHH-H
T ss_pred             CCHHHHHHHHHHHHHHHHHHCCCEEEECCHHHHHHHHCCC-CCCCCCEEECCC----CCCEEEECCCCHHHHCCHHHH-H
T ss_conf             8999999989999999998098889985959999984777-664454000258----977799318987782899999-9


Q ss_pred             HHHHHHHHHHHHHH
Q ss_conf             99999999999986
Q gi|254780743|r  246 NTWHALITLKKALK  259 (261)
Q Consensus       246 ~aW~DL~~l~~~L~  259 (261)
                      .+|++|+.+++.+.
T Consensus       154 ~~~~~l~~~l~~l~  167 (168)
T 1mug_A          154 EAYRELDQALVVRG  167 (168)
T ss_dssp             HHHHHHHHHSCC--
T ss_pred             HHHHHHHHHHHHCC
T ss_conf             99999999998645


No 9  
>>3fci_A UDG, uracil-DNA glycosylase; DNA repair, alternative splicing, disease mutation, DNA damage, glycosidase, HOST- virus interaction, hydrolase; HET: 3FI; 1.27A {Homo sapiens} PDB: 1emh_A* 1emj_A* 1q3f_A* 1ssp_E* 1ugh_E 1akz_A* 2oxm_A* 2oyt_A* 3fcf_A* 2hxm_A* 3fck_B* 3fcl_A* 2ssp_E* 1yuo_A 4skn_E* 1okb_A (A:)
Probab=93.57  E-value=0.49  Score=25.58  Aligned_cols=116  Identities=15%  Similarity=0.169  Sum_probs=66.7

Q ss_pred             CCCCEEEEECCCCCC-CCCCCCCCCCCCHH----HHHHHHHHC-----CCC-----------CCCCCEEEEEECCCCCCC
Q ss_conf             888489985789830-01120012070048----999999860-----986-----------222100000001225666
Q gi|254780743|r  106 EGQDLMIIGYTPSDS-DNISGKPFSGKTGN----MLDKMLQSI-----EIM-----------RTQIHISMISPWHPPGNR  164 (261)
Q Consensus       106 ~~a~imiVgeaPg~~-Ed~~G~pF~G~aG~----lL~~mL~ai-----gl~-----------r~~vyitn~vkcrPp~nr  164 (261)
                      .+-||+|+|+-|-.. +...|..|.-..|.    -|.++++++     |+.           ++.|.+-|.+--.-.|. 
T Consensus        54 ~~vkVVIlGQDPY~~~g~A~GlaFsv~~~~~~p~SL~NI~kel~~~~~~~~~p~~g~L~~Wa~qGVLLLNt~LTv~~g~-  132 (223)
T 3fci_A           54 KDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQ-  132 (223)
T ss_dssp             GGCCEEEEECSCCCSTTTCCSSTTCCCTTSCCCHHHHHHHHHHHHHSTTCCCCSSCCTHHHHTTTEEEEESSCCEETTC-
T ss_pred             HHCEEEEEECCCCCCCCCCEEEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCHHHHHHCCEEEEECCEEEECCC-
T ss_conf             5747999943587667741003331258854585089999999875158878886604667517768886618997553-


Q ss_pred             CCCHHH--HHHHHHHHHHHHH-HCCCCEEEEECHHHHHHHHCCCCCCCHHCCCEEEEEECCCCCEEEEEEECHHHHHC
Q ss_conf             677889--9999999999863-22976799525599999844653310110650576642897378999708038833
Q gi|254780743|r  165 NLSNIE--MEICRPIIMRQIE-LISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ  239 (261)
Q Consensus       165 ~p~~~e--i~~c~p~L~~ei~-li~Pk~ii~lG~~a~~~ll~~~~~~i~~~rG~~~~~~~~~~~i~~~pt~HPs~LLr  239 (261)
                      ..+...  -+.+...+.+.|. -.++-+.++.|+.|.+..   .  .|...+            ..++-+.|||.+-.
T Consensus       133 ~~sH~~~gWe~ft~~ii~~l~~~~~~iVf~LwG~~A~~~~---~--~i~~~~------------h~il~~~HPSpls~  193 (223)
T 3fci_A          133 ANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKG---S--AIDRKR------------HHVLQTAHPSPLSV  193 (223)
T ss_dssp             TTTTTTSSHHHHHHHHHHHHHHHCCSCEEEEESHHHHHHT---T--TCCTTT------------SEEEEECCSSTTTG
T ss_pred             CCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEHHHHHHHHH---H--HCCCCC------------CEEEEECCCCCCCC
T ss_conf             4575212689999999999866477839874387799998---7--515789------------86998069982023


No 10 
>>2j8x_A Uracil-DNA glycosylase; hydrolase/inhibitor, hydrolase/inhibitor complex, EBV, DNA repair, lytic protein, epstein-BARR virus; 2.3A {Epstein-barr virus} (A:48-231)
Probab=93.33  E-value=0.54  Score=25.34  Aligned_cols=114  Identities=15%  Similarity=0.207  Sum_probs=67.1

Q ss_pred             CCCEEEEECCCCCCCCCCCCCCCCCCH----HHHHHHHHHC-----CCC-----------CCCCCEEEEEECCCCCCCCC
Q ss_conf             884899857898300112001207004----8999999860-----986-----------22210000000122566667
Q gi|254780743|r  107 GQDLMIIGYTPSDSDNISGKPFSGKTG----NMLDKMLQSI-----EIM-----------RTQIHISMISPWHPPGNRNL  166 (261)
Q Consensus       107 ~a~imiVgeaPg~~Ed~~G~pF~G~aG----~lL~~mL~ai-----gl~-----------r~~vyitn~vkcrPp~nr~p  166 (261)
                      +-||+|+|+-|-..+...|..|.-+.|    .-|.+|++++     |+.           ++.|.+-|.+---..|... 
T Consensus        11 ~vkVVIlGQDPY~~~~A~GlaFsv~~~~~~p~SL~NI~kel~~d~~~~~~p~~g~L~~WakQGVLLLNt~LTv~~g~~~-   89 (184)
T 2j8x_A           11 DIKVVILGQDPYHGGQANGLAFSVAYGFPVPPSLRNIYAELHRSLPEFSPPDHGCLDAWASQGVLLLNTILTVQKGKPG-   89 (184)
T ss_dssp             GCCEEEEECSCCSSSCCCSSSSCCCTTSCCCHHHHHHHHHHHHHCTTCCCCSSCCCHHHHTTTEEEEESSCCEETTBTT-
T ss_pred             HEEEEEEECCCCCCCCEEEEEEECCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCHHHHHHCCEEEEEEEEEEECCCCC-
T ss_conf             8489998546787886324553045689788229999999986347687667798578864976888657887379999-


Q ss_pred             CHHH--HHHHHHHHHHHHH-HCCCCEEEEECHHHHHHHHCCCCCCCHHCCCEEEEEECCCCCEEEEEEECHHHHH
Q ss_conf             7889--9999999999863-2297679952559999984465331011065057664289737899970803883
Q gi|254780743|r  167 SNIE--MEICRPIIMRQIE-LISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELI  238 (261)
Q Consensus       167 ~~~e--i~~c~p~L~~ei~-li~Pk~ii~lG~~a~~~ll~~~~~~i~~~rG~~~~~~~~~~~i~~~pt~HPs~LL  238 (261)
                      +...  -+.+..-+.++|. -.++-+.++.|+.|.+..     ..|...            ...++-+.|||.+-
T Consensus        90 SH~~~gWe~ft~~ii~~l~~~~~~ivf~LwG~~A~~~~-----~~i~~~------------~h~il~~~HPSpls  147 (184)
T 2j8x_A           90 SHADIGWAWFTDHVISLLSERLKACVFMLWGAKAGDKA-----SLINSK------------KHLVLTSQHPSPLA  147 (184)
T ss_dssp             TTTTSSHHHHHHHHHHHHHHHCSSCEEEEESHHHHGGG-----GGSCTT------------TSEEEEECCSSGGG
T ss_pred             CCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHH-----HHCCCC------------CCEEEECCCCCCCC
T ss_conf             85555818899999999981468859998103455666-----532578------------97699767999511


No 11 
>>4eug_A UDG, UNG, protein (glycosylase); 1.40A {Escherichia coli} (A:45-229)
Probab=90.66  E-value=1.1  Score=23.50  Aligned_cols=116  Identities=17%  Similarity=0.203  Sum_probs=66.2

Q ss_pred             CCCEEEEECCCCCC-CCCCCCCCCCCCH-HH---HHHHHHHCC-----CC-----------CCCCCEEEEEECCCCCCCC
Q ss_conf             88489985789830-0112001207004-89---999998609-----86-----------2221000000012256666
Q gi|254780743|r  107 GQDLMIIGYTPSDS-DNISGKPFSGKTG-NM---LDKMLQSIE-----IM-----------RTQIHISMISPWHPPGNRN  165 (261)
Q Consensus       107 ~a~imiVgeaPg~~-Ed~~G~pF~G~aG-~l---L~~mL~aig-----l~-----------r~~vyitn~vkcrPp~nr~  165 (261)
                      +-||+|+|+-|-.. ++..|..|.-+.| ++   |.++++++.     +.           ++.|.+.|.+--.-.|. .
T Consensus        11 ~vkVVIlGQDPY~~~~~A~GlaFsv~~~~~~p~SL~NI~kel~~~~~~~~~p~~g~L~~Wa~QGVLLLN~~LTv~~~~-~   89 (185)
T 4eug_A           11 DVKVVILGQDPYHGPGQAHGLAFSVRPGIAIPPSLLNMYKELENTIPGFTRPNHGYLESWARQGVLLLNTVLTVRAGQ-A   89 (185)
T ss_dssp             GCCEEEEESSCCCSTTTCSSSTTCCCTTSCCCHHHHHHHHHHHHHSTTCCCCSCCCCHHHHTTTEEEEESSCCEETTB-T
T ss_pred             HCEEEEEECCCCCCCCCCCEEEECCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCHHHHHCCEEEEEEEEEEECCC-C
T ss_conf             857999954788655434402201358988882499999999987389977899854045416726774258997366-6


Q ss_pred             CCHHH--HHHHHHHHHHHHH-HCCCCEEEEECHHHHHHHHCCCCCCCHHCCCEEEEEECCCCCEEEEEEECHHHHHCC
Q ss_conf             77889--9999999999863-229767995255999998446533101106505766428973789997080388336
Q gi|254780743|r  166 LSNIE--MEICRPIIMRQIE-LISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQY  240 (261)
Q Consensus       166 p~~~e--i~~c~p~L~~ei~-li~Pk~ii~lG~~a~~~ll~~~~~~i~~~rG~~~~~~~~~~~i~~~pt~HPs~LLr~  240 (261)
                      -+...  -+.+..-+.+.|. -.++-+.++.|+.|.+.. .    .+..            ....++-+.|||.|-++
T Consensus        90 ~SH~~~gWe~ft~~ii~~i~~~~~~ivf~LwG~~A~~~~-~----~i~~------------~~~~vl~~~HPSPls~~  150 (185)
T 4eug_A           90 HSHASLGWETFTDKVISLINQHREGVVFLLWGSHAQKKG-A----IIDK------------QRHHVLKAPQPSPLSAH  150 (185)
T ss_dssp             TTTTTSSHHHHHHHHHHHHHHHCSSCEEEEESHHHHHHT-T----TSCT------------TTSEEEEECCSSTTTGG
T ss_pred             CCCCCHHHHHHHHHHHHHHHCCCCCEEEEEEEEHHHHHH-H----HHCC------------CCCEEEECCCCCCHHCC
T ss_conf             663101289999999999971788869998511167787-6----5046------------78659983899802047


No 12 
>>3cxm_A Uracil-DNA glycosylase; base excision repair, BER, DNA damage repair, MSGPP, SGPP, hydrolase, 5-bromouracil, structural genomics; 1.50A {Leishmania naiffi} (A:83-268)
Probab=89.67  E-value=1.4  Score=23.02  Aligned_cols=116  Identities=15%  Similarity=0.173  Sum_probs=65.8

Q ss_pred             CCCEEEEECCCCCC-CCCCCCCCCCCCHH----HHHHHHHHC-----CCC-----------CCCCCEEEEEECCCCCCCC
Q ss_conf             88489985789830-01120012070048----999999860-----986-----------2221000000012256666
Q gi|254780743|r  107 GQDLMIIGYTPSDS-DNISGKPFSGKTGN----MLDKMLQSI-----EIM-----------RTQIHISMISPWHPPGNRN  165 (261)
Q Consensus       107 ~a~imiVgeaPg~~-Ed~~G~pF~G~aG~----lL~~mL~ai-----gl~-----------r~~vyitn~vkcrPp~nr~  165 (261)
                      +-||+|+|+-|-.. +...|..|.-..|.    -|.+|++++     |+.           ++.|.+-|.+---..|...
T Consensus        10 ~vKVVIlGQDPY~~~~~A~GlaFs~~~~~~~p~SL~NI~keL~~~~~~~~~p~~g~L~~Wa~QGVLLLNt~LTv~~g~~~   89 (186)
T 3cxm_A           10 GLKVVLLGQDPYHDLHQAHGLCFSVLPEVPLPPSLRNIYKELTTDIAGFQAPKHGYLQSWSEQGMLMLNATLTVEAHKAN   89 (186)
T ss_dssp             TCCEEEEESSCCCSTTTCCSSTTCCCTTSCCCHHHHHHHHHHHHHSTTCCCCSSCCCHHHHTTTEEEEESSCCEETTCTT
T ss_pred             HCEEEEEECCCCCCCCCCCEEECCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCHHHHCCEEEEEEEEEEECCCCC
T ss_conf             94799984479988520024311356777789429999999997528788999876111520987999624788889765


Q ss_pred             CCHHH---HHHHHHHHHHHHHHCC--CCEEEEECHHHHHHHHCCCCCCCHHCCCEEEEEECCCCCEEEEEEECHHHHHCC
Q ss_conf             77889---9999999999863229--767995255999998446533101106505766428973789997080388336
Q gi|254780743|r  166 LSNIE---MEICRPIIMRQIELIS--PKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQY  240 (261)
Q Consensus       166 p~~~e---i~~c~p~L~~ei~li~--Pk~ii~lG~~a~~~ll~~~~~~i~~~rG~~~~~~~~~~~i~~~pt~HPs~LLr~  240 (261)
                       +...   -+.+..-+.+.|..-+  |-+.++.|+.|.+ +.    ..|...            ...++-+.|||.+-..
T Consensus        90 -sH~~~~gWe~ft~~ii~~l~~~~~~~iVf~LwG~~A~~-~~----~~i~~~------------~~~vl~~~HPSpls~~  151 (186)
T 3cxm_A           90 -SHSKTSGWAAFTDAVIQHLSQHHPNRLVFLLWGGYAQQ-KK----RLIDAN------------RHVVLENVHPSPLSAN  151 (186)
T ss_dssp             -TTTTTSCHHHHHHHHHHHHHHHCSSCCEEEEESHHHHG-GG----GGSCTT------------TSEEEEECCSSHHHHT
T ss_pred             -CCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCHHHH-HH----HHCCCC------------CCEEEEECCCCCCCCC
T ss_conf             -33344058999999999985157786699984666788-98----608987------------8779973799962446


No 13 
>>2boo_A UDG, uracil-DNA glycosylase; UNG, base excision repair, radiation resistance, DNA damage, DNA repair, glycosidase, hydrolase; 1.8A {Deinococcus radiodurans} (A:)
Probab=88.34  E-value=1.7  Score=22.48  Aligned_cols=117  Identities=13%  Similarity=0.201  Sum_probs=67.8

Q ss_pred             CCCCCEEEEECCCCCC-CCCCCCCCCCCCHH-H---HHHHHHHC-----CCC-----------CCCCCEEEEEECCCCCC
Q ss_conf             8888489985789830-01120012070048-9---99999860-----986-----------22210000000122566
Q gi|254780743|r  105 TEGQDLMIIGYTPSDS-DNISGKPFSGKTGN-M---LDKMLQSI-----EIM-----------RTQIHISMISPWHPPGN  163 (261)
Q Consensus       105 ~~~a~imiVgeaPg~~-Ed~~G~pF~G~aG~-l---L~~mL~ai-----gl~-----------r~~vyitn~vkcrPp~n  163 (261)
                      -.+-||+|+|+-|-.. ++..|..|.-+.|. +   |.++++++     |+.           ++.|.+-|.+----.|.
T Consensus        72 ~~~vKVVIlGQDPY~~~g~A~GLaFsv~~~~~~p~SL~NI~kEL~~d~~~~~~~~~g~L~~Wa~QGVLLLNt~LTv~~g~  151 (247)
T 2boo_A           72 LGEVKVLILGQDPYHGPNQAHGLSFSVRPGVRVPPSLRNIYKELTEDIPGFVAPKHGYLRSWAEQGVLLLNAVLTVRAGQ  151 (247)
T ss_dssp             GGGCCEEEEESSCCCSTTCCSSSSSCCCTTSCCCHHHHHHHHHHHHHSTTCCCCSSCCCHHHHTTTEEEEESSCCEETTB
T ss_pred             HHHCEEEEEECCCCCCCCEECEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCHHHHHHCCEEEEEEEEEECCCC
T ss_conf             85775999955688555522112003117978993278999999986079878888626669768778986016521887


Q ss_pred             CCCCHHH--HHHHHHHHHHHHHHC-CCCEEEEECHHHHHHHHCCCCCCCHHCCCEEEEEECCCCCEEEEEEECHHHHHC
Q ss_conf             6677889--999999999986322-976799525599999844653310110650576642897378999708038833
Q gi|254780743|r  164 RNLSNIE--MEICRPIIMRQIELI-SPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ  239 (261)
Q Consensus       164 r~p~~~e--i~~c~p~L~~ei~li-~Pk~ii~lG~~a~~~ll~~~~~~i~~~rG~~~~~~~~~~~i~~~pt~HPs~LLr  239 (261)
                       ..+...  -+.+...+.++|..- ++-+.++.|+.|.+. .    ..|..            ....++-+.|||.+-.
T Consensus       152 -~~SH~~~gWe~ft~~ii~~l~~~~~~iVf~LWG~~A~~~-~----~~i~~------------~~~~il~s~HPSpls~  212 (247)
T 2boo_A          152 -ANSHQGKGWEHFTDAVIKAVNAKEERVVFILWGSYARKK-K----KLITG------------KNHVVIESGHPSPLSE  212 (247)
T ss_dssp             -TTTTTTSSHHHHHHHHHHHHHTCSSCCEEEEESHHHHGG-G----GGCCC------------TTCEEEEECCSSTTTG
T ss_pred             -CCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEEHHHHHHH-H----HHCCC------------CCCEEEECCCCCHHHC
T ss_conf             -566521309999999999998256885999715789988-7----40467------------7865997089881113


No 14 
>>1udg_A Uracil-DNA glycosylase; hydrolase; 1.75A {Herpes simplex virus} (A:70-244)
Probab=86.20  E-value=2.3  Score=21.76  Aligned_cols=116  Identities=18%  Similarity=0.243  Sum_probs=65.0

Q ss_pred             CCCEEEEECCCCCC-CCCCCCCCCCCCHH----HHHHHHHHC-----CCC-----------CCCCCEEEEEECCCCCCCC
Q ss_conf             88489985789830-01120012070048----999999860-----986-----------2221000000012256666
Q gi|254780743|r  107 GQDLMIIGYTPSDS-DNISGKPFSGKTGN----MLDKMLQSI-----EIM-----------RTQIHISMISPWHPPGNRN  165 (261)
Q Consensus       107 ~a~imiVgeaPg~~-Ed~~G~pF~G~aG~----lL~~mL~ai-----gl~-----------r~~vyitn~vkcrPp~nr~  165 (261)
                      +-||+|+|+-|-.. +...|..|.-+.|.    -|.++++++     ++.           ++.|.+-|.+----.|. .
T Consensus        10 ~vkVVIlGQDPY~~~~~A~GlaFsv~~~~~~p~SL~NI~kel~~~~~~~~~~~~g~L~~wakQGVLLLNt~LTv~~g~-~   88 (175)
T 1udg_A           10 EVRVVIIGQDPYHHPGQAHGLAFSVRANVPPPPSLRNVLAAVKNCYPEARMSGHGCLEKWARDGVLLLNTTLTVKRGA-A   88 (175)
T ss_dssp             GCCEEEEECSCCCSTTTCSSSSSCCCTTSCCCHHHHHHHHHHHHHCTTCCCCSCCCCHHHHHTTEEEEESSCCEETTB-T
T ss_pred             HCEEEEEEECCCCCCCEEEEEECCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHCCEEEEEEEEEEECCC-C
T ss_conf             346999961588766403333313676413237789999999753477777778877778527778775048887254-5


Q ss_pred             CCHHH--HHHHHHHHHHHHHHC-CCCEEEEECHHHHHHHHCCCCCCCHHCCCEEEEEECCCCCEEEEEEECHHHHHCCH
Q ss_conf             77889--999999999986322-97679952559999984465331011065057664289737899970803883365
Q gi|254780743|r  166 LSNIE--MEICRPIIMRQIELI-SPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP  241 (261)
Q Consensus       166 p~~~e--i~~c~p~L~~ei~li-~Pk~ii~lG~~a~~~ll~~~~~~i~~~rG~~~~~~~~~~~i~~~pt~HPs~LLr~P  241 (261)
                      .+...  -+.+..-+.++|... ++-+.++.|+.|.+. ..     +...+            ..++-+.|||-+-+++
T Consensus        89 ~SH~~~gWe~ft~~ii~~l~~~~~~vvf~LwG~~A~~~-~~-----~~~~~------------h~il~~~HPSpls~~~  149 (175)
T 1udg_A           89 ASHSRIGWDRFVGGVIRRLAARRPGLVFMLWGTHAQNA-IR-----PDPRV------------HCVLKFSHPSPLSKVP  149 (175)
T ss_dssp             TTTTTSSHHHHHHHHHHHHHHHCSSCEEEEESHHHHHH-CC-----CCTTT------------SEEEEECCSSTTSSSC
T ss_pred             CCCCCHHHHHHHHHHHHHHHCCCCCEEEEEEHHHHHHH-HC-----CCCCC------------CEEEEECCCCHHHCCC
T ss_conf             77642109999999999997288986999734667656-20-----38999------------8699878998454369


No 15 
>>1uok_A Oligo-1,6-glucosidase; sugar degradation, hydrolase, TIM-barrel glycosidase; 2.00A {Bacillus cereus} (A:1-101,A:173-259,A:359-376)
Probab=74.44  E-value=6  Score=19.38  Aligned_cols=18  Identities=11%  Similarity=0.416  Sum_probs=9.1

Q ss_pred             HHHHHHHHHHHHHCCHHH
Q ss_conf             999999999999837078
Q gi|254780743|r    9 QEQILTIALFYADSGVYW   26 (261)
Q Consensus         9 ~~~l~~ll~~~~e~GVd~   26 (261)
                      +++++..+.||.+.|||.
T Consensus       107 r~ei~~il~fWl~kGVDG  124 (206)
T 1uok_A          107 RQDVYEMMKFWLEKGIDG  124 (206)
T ss_dssp             HHHHHHHHHHHHHTTCCE
T ss_pred             HHHHHHHHHHHHHCCCCC
T ss_conf             999999999998618987


No 16 
>>2zhx_A UDG, uracil-DNA glycosylase; DNA repair, UNG-UGI complex, UNG-DNA interactions, cytoplasm, DNA damage; 3.10A {Mycobacterium tuberculosis} (A:)
Probab=69.20  E-value=8  Score=18.67  Aligned_cols=120  Identities=14%  Similarity=0.158  Sum_probs=69.7

Q ss_pred             CCCCCCCEEEEECCCCCC-CCCCCCCCCCCCHH-----HHHHHHHHC----CCCC-----------CCCCEEEEEECCCC
Q ss_conf             788888489985789830-01120012070048-----999999860----9862-----------22100000001225
Q gi|254780743|r  103 TQTEGQDLMIIGYTPSDS-DNISGKPFSGKTGN-----MLDKMLQSI----EIMR-----------TQIHISMISPWHPP  161 (261)
Q Consensus       103 ~G~~~a~imiVgeaPg~~-Ed~~G~pF~G~aG~-----lL~~mL~ai----gl~r-----------~~vyitn~vkcrPp  161 (261)
                      .-..+-||+|+|+-|-.. +...|..|.-+.|.     -|.+++.++    |+..           +.|.+-|.+--.-.
T Consensus        66 ~p~~~vKVVIlGQDPY~~~g~A~GlaFSv~~~~~~~P~SL~NI~keL~~~~g~~~~~~g~L~~WakQGVLLLNt~LTv~~  145 (238)
T 2zhx_A           66 FPFDNVRVLIVGQDPYPTPGHAVGLSFSVAPDVRPWPRSLANIFDEYTADLGYPLPSNGDLTPWAQRGVLLLNRVLTVRP  145 (238)
T ss_dssp             SCSTTCCEEEECCSCCSSTTTCCSSSSCCCTTCCSCCHHHHHHHHHHHHHSSCCCCSSSCCHHHHTTTEECCCSSCCCCT
T ss_pred             CCHHHCEEEEEECCCCCCCCCEEEEEECCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHCCEEEEEEEEEEEC
T ss_conf             99789368998504888888055553026899977756799999999985199999998877786177389864577876


Q ss_pred             CCCCCCHHH--HHHHHHHHHHHHHHCC-CCEEEEECHHHHHHHHCCCCCCCHHCCCEEEEEECCCCCEEEEEEECHHHHH
Q ss_conf             666677889--9999999999863229-7679952559999984465331011065057664289737899970803883
Q gi|254780743|r  162 GNRNLSNIE--MEICRPIIMRQIELIS-PKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELI  238 (261)
Q Consensus       162 ~nr~p~~~e--i~~c~p~L~~ei~li~-Pk~ii~lG~~a~~~ll~~~~~~i~~~rG~~~~~~~~~~~i~~~pt~HPs~LL  238 (261)
                      |. ..+...  -+.+...+.+.|..-+ +-+.++.|+.|.+. .    ..|..            ....++-+.|||.+-
T Consensus       146 g~-~~SH~~~gWe~ft~~ii~~l~~~~~~iVf~LwG~~A~~~-~----~~i~~------------~~~~vl~s~HPSpls  207 (238)
T 2zhx_A          146 SN-PASHRGKGWEAVTECAIRALAARAAPLVAILWGRDASTL-K----PMLAA------------GNCVAIESPHPSPLS  207 (238)
T ss_dssp             TC-TTTTTTSSHHHHHHHHHHHHHHSSSCEEEEEESHHHHTT-T----TTSCS------------SSEEEEEECCSSTTT
T ss_pred             CC-CCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECHHHHH-H----HCCCC------------CCCEEEECCCCCCCC
T ss_conf             86-577300229999999999998205782899983434443-3----02467------------786699748999502


Q ss_pred             CC
Q ss_conf             36
Q gi|254780743|r  239 QY  240 (261)
Q Consensus       239 r~  240 (261)
                      +.
T Consensus       208 ~~  209 (238)
T 2zhx_A          208 AS  209 (238)
T ss_dssp             GG
T ss_pred             CC
T ss_conf             25


No 17 
>>2owr_A UDG, uracil-DNA glycosylase; uracil-DNA glycosylase fold in the core: 3 layers (A/B/A); HET: EPE; 2.30A {Vaccinia virus} PDB: 2owq_A (A:48-218)
Probab=67.92  E-value=8.5  Score=18.52  Aligned_cols=96  Identities=11%  Similarity=0.125  Sum_probs=58.0

Q ss_pred             CCCCCEEEEECCCCCCCCCCCCCCCCCCHH--HHHHHHHHC----CCCC---------CCCCEEEEEECCCCCCCCCCHH
Q ss_conf             888848998578983001120012070048--999999860----9862---------2210000000122566667788
Q gi|254780743|r  105 TEGQDLMIIGYTPSDSDNISGKPFSGKTGN--MLDKMLQSI----EIMR---------TQIHISMISPWHPPGNRNLSNI  169 (261)
Q Consensus       105 ~~~a~imiVgeaPg~~Ed~~G~pF~G~aG~--lL~~mL~ai----gl~r---------~~vyitn~vkcrPp~nr~p~~~  169 (261)
                      ..+-||+|+|+-| ..-...|..|+-+.|-  -|.+|..++    +...         +.|.+-|.+----.|....-..
T Consensus        10 ~~~vkVVIlGQDP-Y~~~A~GLaFSv~~~~p~sL~nI~kel~~~~~~~~~~g~l~~waqgVLLLN~~LTv~~g~~~sH~~   88 (171)
T 2owr_A           10 LRNKRVCVCGIDP-YPKDGTGVPFESPNFTKKSIKEIASSISRLTGVIDYKGYNLNIIDGVIPWNYYLSCKLGETKSHAI   88 (171)
T ss_dssp             STTCCEEEEESSC-CSSCCCSSTTCCTTSCCHHHHHHHHHHHHHHCCCCCSEECGGGSTTEEEEESSSCEETTCTTTTHH
T ss_pred             HHHCEEEEEECCC-CCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHCCCEEHHHHEEECCCCCCCHHH
T ss_conf             8894699984579-998666702257788865899999997760398888887857862400351103323898760254


Q ss_pred             HHHHHHHHHHHHHHHCCCCEEEEECHHHHHHH
Q ss_conf             99999999999863229767995255999998
Q gi|254780743|r  170 EMEICRPIIMRQIELISPKILLFIGNKTKNFF  201 (261)
Q Consensus       170 ei~~c~p~L~~ei~li~Pk~ii~lG~~a~~~l  201 (261)
                      --+.+..-+.+.|.--++-+.++.|+.|.+..
T Consensus        89 gWe~ft~~ii~~l~~~~~ivf~LwG~~A~~~~  120 (171)
T 2owr_A           89 YWDKISKLLLQHITKHVSVLYCLGKTDFSNIR  120 (171)
T ss_dssp             HHHHHHHHHHHHHTTTCSEEEEECHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHCCCCEEEEEECHHHHHHH
T ss_conf             59999999999971669739998527878644


No 18 
>>1y5e_A Molybdenum cofactor biosynthesis protein B; structural genomics, protein structure initiative, PSI, MCSG, midwest center for structural genomics; 1.90A {Bacillus cereus} (A:)
Probab=60.15  E-value=12  Score=17.67  Aligned_cols=74  Identities=14%  Similarity=0.172  Sum_probs=50.9

Q ss_pred             CCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCEEEEEECCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             23678888848998578983001120012070048999999860986222100000001225666677889999999999
Q gi|254780743|r  100 ICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIM  179 (261)
Q Consensus       100 v~g~G~~~a~imiVgeaPg~~Ed~~G~pF~G~aG~lL~~mL~aigl~r~~vyitn~vkcrPp~nr~p~~~ei~~c~p~L~  179 (261)
                      |.-...+..-|+.+|+-+|..+|.        .|.+|...|...|.+-....+.           ..+.+++...   +.
T Consensus         8 v~v~~~~rv~ii~~GdE~G~~~d~--------n~~~l~~~l~~~G~~v~~~~~v-----------~Dd~~~i~~~---i~   65 (169)
T 1y5e_A            8 KQAPKEVRCKIVTISDTRTEETDK--------SGQLLHELLKEAGHKVTSYEIV-----------KDDKESIQQA---VL   65 (169)
T ss_dssp             ----CCCEEEEEEECSSCCTTTCH--------HHHHHHHHHHHHTCEEEEEEEE-----------CSSHHHHHHH---HH
T ss_pred             HHCCCCCEEEEEEECCCCCCCCCC--------CHHHHHHHHHHCCCEEEEEEEE-----------CCCHHHHHHH---HH
T ss_conf             307777669999971888877584--------0999999999779956786563-----------5879999999---99


Q ss_pred             HHHHHCCCCEEEEECH
Q ss_conf             9863229767995255
Q gi|254780743|r  180 RQIELISPKILLFIGN  195 (261)
Q Consensus       180 ~ei~li~Pk~ii~lG~  195 (261)
                      +.++--.+.+||+.|.
T Consensus        66 ~~~~~~~~dlVittGG   81 (169)
T 1y5e_A           66 AGYHKEDVDVVLTNGG   81 (169)
T ss_dssp             HHHTCTTCSEEEEECC
T ss_pred             HHHHCCCCCEEEEECC
T ss_conf             8752566758998435


No 19 
>>1em8_B DNA polymerase III PSI subunit; DNA POL III, heterodimer, clamp-loader, alpha-beta fold, gene regulation; HET: DNA; 2.10A {Escherichia coli} (B:)
Probab=59.05  E-value=13  Score=17.56  Aligned_cols=91  Identities=14%  Similarity=0.227  Sum_probs=55.2

Q ss_pred             CCCCCEEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             88884899857898300112001207004899999986098622210000000122566667788999999999998632
Q gi|254780743|r  105 TEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIEL  184 (261)
Q Consensus       105 ~~~a~imiVgeaPg~~Ed~~G~pF~G~aG~lL~~mL~aigl~r~~vyitn~vkcrPp~nr~p~~~ei~~c~p~L~~ei~l  184 (261)
                      +.+-|++||.+.+-..           .--||..+|++++|+.+++|..+           |.             +++.
T Consensus         9 p~~~rLliVa~~~p~~-----------~~~L~~dVLrsl~L~~~q~~~lt-----------pe-------------ql~~   53 (112)
T 1em8_B            9 PAHVRLVMVANDLPAL-----------TDPLVSDVLRALTVSPDQVLQLT-----------PE-------------KIAM   53 (112)
T ss_dssp             CTTCCEEEECSSCCCT-----------TSHHHHHHHHHTTCCGGGEEEEC-----------TT-------------GGGG
T ss_pred             CCCCEEEEEECCCCCC-----------CCHHHHHHHHHCCCCHHHEEEEC-----------HH-------------HHHH
T ss_conf             5305699983898664-----------57399999998699999941119-----------99-------------9962


Q ss_pred             CC---CCEEEEECHHHHHHHHCCCCCCCHHCCCEEEEEECCCCCEEEEEEECHHHHHCCHHHHHHHHHHHHH
Q ss_conf             29---7679952559999984465331011065057664289737899970803883365989999999999
Q gi|254780743|r  185 IS---PKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALIT  253 (261)
Q Consensus       185 i~---Pk~ii~lG~~a~~~ll~~~~~~i~~~rG~~~~~~~~~~~i~~~pt~HPs~LLr~P~~K~~aW~DL~~  253 (261)
                      +.   +..+=.+|         .+.. . ..-|            ..+-+-.-+-|-.|+..||.-|+-...
T Consensus        54 L~~~~~~~~W~lG---------~~~~-~-~~~~------------~~l~Sp~L~~L~~n~~aKRaLWQQIc~  102 (112)
T 1em8_B           54 LPQGSHCNSWRLG---------TDEP-L-SLEG------------AQVASPALTDLRANPTARAALWQQICT  102 (112)
T ss_dssp             SCTTCBCEEEEES---------CCSC-C-SSBS------------CEEEECCHHHHHHCHHHHHHHHHHHHH
T ss_pred             CCCCCCCEEEECC---------CCCC-C-CCCC------------CEEECCCHHHHHCCHHHHHHHHHHHHH
T ss_conf             7778875478745---------7677-6-6578------------778281899883597999999999998


No 20 
>>1mkz_A Molybdenum cofactor biosynthesis protein B; MAD, WEAK anomalous signal, molybdopterin synthesis, structural genomics, PSI; HET: MSE; 1.60A {Escherichia coli} (A:)
Probab=37.98  E-value=28  Score=15.60  Aligned_cols=77  Identities=10%  Similarity=0.105  Sum_probs=52.3

Q ss_pred             CCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCEEEEEECCCCCCCCCCHHHHHHHHHHH
Q ss_conf             22367888884899857898300112001207004899999986098622210000000122566667788999999999
Q gi|254780743|r   99 TICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPII  178 (261)
Q Consensus        99 ~v~g~G~~~a~imiVgeaPg~~Ed~~G~pF~G~aG~lL~~mL~aigl~r~~vyitn~vkcrPp~nr~p~~~ei~~c~p~L  178 (261)
                      .|.-...+..-|+.+|+-+|...|.        +|.+|...|...|.+-..+.+.           ..+.+++...   +
T Consensus         4 ~v~v~~~prv~ii~tGdE~G~i~D~--------n~~~l~~~l~~~G~~v~~~~~v-----------~Dd~~~i~~~---i   61 (172)
T 1mkz_A            4 VSTEFIPTRIAILTVSNRRGEEDDT--------SGHYLRDSAQEAGHHVVDKAIV-----------KENRYAIRAQ---V   61 (172)
T ss_dssp             CCSSCCCCEEEEEEECSSCCGGGCH--------HHHHHHHHHHHTTCEEEEEEEE-----------CSCHHHHHHH---H
T ss_pred             CCCCCCCCEEEEEEEECCCCCCCCC--------HHHHHHHHHHHCCCEEEEEEEE-----------CCCHHHHHHH---H
T ss_conf             7778768689999984888877777--------3999999999859946665672-----------8988999999---9


Q ss_pred             HHHHHHCCCCEEEEECHHH
Q ss_conf             9986322976799525599
Q gi|254780743|r  179 MRQIELISPKILLFIGNKT  197 (261)
Q Consensus       179 ~~ei~li~Pk~ii~lG~~a  197 (261)
                      .+.++.-+..+||+.|.+.
T Consensus        62 ~~~~~~~~~DivittGG~g   80 (172)
T 1mkz_A           62 SAWIASDDVQVVLITGGTG   80 (172)
T ss_dssp             HHHHHSSSCCEEEEESCCS
T ss_pred             HHHHHCCCCEEEEECCEEE
T ss_conf             9987536842898567786


No 21 
>>1nrp_R Receptor based peptide NR'S; serine proteinase/receptor; 3.00A {Homo sapiens} PDB: 1nrn_R 1nrq_R* (R:)
Probab=33.21  E-value=4.8  Score=19.91  Aligned_cols=17  Identities=24%  Similarity=0.266  Sum_probs=13.2

Q ss_pred             HHHHCCHHHHH-HHHHHH
Q ss_conf             38833659899-999999
Q gi|254780743|r  235 QELIQYPLIKK-NTWHAL  251 (261)
Q Consensus       235 s~LLr~P~~K~-~aW~DL  251 (261)
                      |+|||||..|- -+|+|-
T Consensus         5 sfllrnpndkyepfwede   22 (26)
T 1nrp_R            5 SFLLRNPNDKYEPFWEDE   22 (26)
T ss_pred             HHHHCCCCCCCCCCCCCC
T ss_conf             132218776667563432


No 22 
>>3hki_C Proteinase-activated receptor 1; serine protease, acute phase, blood coagulation, calcium, cleavage on PAIR of basic residues, disulfide bond; HET: NAG; 2.20A {Homo sapiens} PDB: 3hkj_C* (C:)
Probab=30.55  E-value=4.8  Score=19.95  Aligned_cols=18  Identities=22%  Similarity=0.202  Sum_probs=12.9

Q ss_pred             HHHHCCHHHHH-HHHHHHH
Q ss_conf             38833659899-9999999
Q gi|254780743|r  235 QELIQYPLIKK-NTWHALI  252 (261)
Q Consensus       235 s~LLr~P~~K~-~aW~DL~  252 (261)
                      |+|||||..|- .+|+|-.
T Consensus         1 sfllrnpndkyepfwedee   19 (26)
T 3hki_C            1 SFLLRNPNDKYEPFWEDEE   19 (26)
T ss_pred             CCCCCCCCCCCCCCCCCHH
T ss_conf             9433387766674533232


No 23 
>>3jwp_A Transcriptional regulatory protein SIR2 homologue; malaria, transcription regulation, structural genomics, structural genomics consortium; HET: AMP PGE; 2.65A {Plasmodium falciparum} (A:1-123,A:176-265)
Probab=30.13  E-value=37  Score=14.84  Aligned_cols=73  Identities=14%  Similarity=0.068  Sum_probs=47.7

Q ss_pred             CHHHHHHHHHCCCCCCCC--CCCCCCCCCC-------CCCCCCEEEEECCCCCCCCCCC-CCCCCCCHHHHHHHHHHCCC
Q ss_conf             989999999600388520--0287722367-------8888848998578983001120-01207004899999986098
Q gi|254780743|r   76 SLHELKSLLRSFHDCHLC--STSLSTICAT-------QTEGQDLMIIGYTPSDSDNISG-KPFSGKTGNMLDKMLQSIEI  145 (261)
Q Consensus        76 ~l~~L~~~~~~~~~C~L~--~~~~~~v~g~-------G~~~a~imiVgeaPg~~Ed~~G-~pF~G~aG~lL~~mL~aigl  145 (261)
                      .-+.+....+.++.|.+.  -+..=.|++.       -..+++|.+|--.|...+++.. .-|.|++++.|.+++...|+
T Consensus       126 p~~~~~~~~~~~~~~D~~lviGTSl~V~pa~~l~~~a~~~g~~v~iiN~~~t~~d~~~~d~~~~g~~~~vl~~l~~~l~~  205 (213)
T 3jwp_A          126 SSDLLKEAEEEIAKCDLLLVIGTSSTVSTATNLCHFACKKKKKIVEINISKTYITNKXSDYHVCAKFSELTKVANILKGS  205 (213)
T ss_dssp             CHHHHHHHHHHHHTCSEEEEESCCSSSSHHHHHHHHHHHTTCCEEEEESSCCSSTTTTCSEEEECCGGGGHHHHHHHHC-
T ss_pred             CHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHHHHHHHHCCCEEEEECCCCCCCCCCCCEEEEECCHHHHHHHHHHHCCC
T ss_conf             88999999975314888999888972168889999998607669999199999988631299926488999999984696


Q ss_pred             CCC
Q ss_conf             622
Q gi|254780743|r  146 MRT  148 (261)
Q Consensus       146 ~r~  148 (261)
                      ..+
T Consensus       206 ~~~  208 (213)
T 3jwp_A          206 SEK  208 (213)
T ss_dssp             ---
T ss_pred             CHH
T ss_conf             143


No 24 
>>2b4y_A NAD-dependent deacetylase sirtuin-5; histone deacetylase, structural genomics, structural genomics consortium, SGC, hydrolase; HET: APR EPE; 1.90A {Homo sapiens} (A:1-126,A:195-271)
Probab=27.79  E-value=41  Score=14.61  Aligned_cols=65  Identities=18%  Similarity=0.250  Sum_probs=42.8

Q ss_pred             CHHHHHHHHHCCCCCC--CCCCCCCCCCCCC-------CCCCCEEEEECCCCCCCCCCCCCCCCCCHHHHHHHH
Q ss_conf             9899999996003885--2002877223678-------888848998578983001120012070048999999
Q gi|254780743|r   76 SLHELKSLLRSFHDCH--LCSTSLSTICATQ-------TEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKML  140 (261)
Q Consensus        76 ~l~~L~~~~~~~~~C~--L~~~~~~~v~g~G-------~~~a~imiVgeaPg~~Ed~~G~pF~G~aG~lL~~mL  140 (261)
                      .-+.++...+.++.|.  |+-+..=.|++..       ..+++|+||--.|...++..-.-+.|++++.|.+++
T Consensus       129 p~~~~~~a~~~~~~aD~~lviGTSl~V~pa~~l~~~a~~~g~~v~iiN~~~t~~d~~a~~~i~~~~~~vl~~l~  202 (203)
T 2b4y_A          129 DPAILEEVDRELAHCDLCLVVGTSSVVYPAAXFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEAL  202 (203)
T ss_dssp             CHHHHHHHHHHHHHCSEEEEESCCSCSTTGGGHHHHHHHTTCCEEEEESSCCTTGGGSSEEEESCHHHHHHHHT
T ss_pred             CHHHHHHHHHHHHCCCEEEEECCCCEECCHHHHHHHHHHCCCEEEEECCCCCCCCCCCCEEEECCHHHHHHHHH
T ss_conf             88899999987730856999888970137889999999869909998299999987108899688999999986


No 25 
>>1r7a_A Sucrose phosphorylase; beta-alpha-barrels, dimer, glycoside hydrolase, transferase; 1.77A {Bifidobacterium adolescentis} (A:1-86,A:166-234,A:372-435)
Probab=23.10  E-value=51  Score=14.09  Aligned_cols=132  Identities=10%  Similarity=-0.003  Sum_probs=63.9

Q ss_pred             CHHHHHHHHHHHHHCCHHHHHHCCCCHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHCCCCCCHHHHHHHHHCC
Q ss_conf             99999999999998370788718820000022244567655567766655567642111023002469989999999600
Q gi|254780743|r    8 SQEQILTIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSF   87 (261)
Q Consensus         8 ~~~~l~~ll~~~~e~GVd~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~l~~L~~~~~~~   87 (261)
                      +-+++...|....++||+.+.=.|...........       .            .+..-..+...-.+++++++.++..
T Consensus        18 ~~~~i~~~l~~l~~lG~~~i~l~Pi~~~~~~~~~G-------Y------------~~~d~~~vd~~~Gt~~d~~~l~~gi   78 (219)
T 1r7a_A           18 TIKSMTDILRTRFDGVYDGVHILPFFTPFDGADAG-------F------------DPIDHTKVDERLGSWDDVAELSKTH   78 (219)
T ss_dssp             SHHHHHHHHHHHSTTTCCEEEECCCEECSSSSSTT-------S------------SCSEEEEECTTTCCHHHHHHHHTTS
T ss_pred             CHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCC-------C------------CCCCHHHHCHHCCCHHHHHHHHHCC
T ss_conf             87899998789987796879979988898778899-------6------------7534302242029999999998199


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCEEE--EECCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCEEEEEEC--CCCCC
Q ss_conf             3885200287722367888884899--8578983001120012070048999999860986222100000001--22566
Q gi|254780743|r   88 HDCHLCSTSLSTICATQTEGQDLMI--IGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPW--HPPGN  163 (261)
Q Consensus        88 ~~C~L~~~~~~~v~g~G~~~a~imi--VgeaPg~~Ed~~G~pF~G~aG~lL~~mL~aigl~r~~vyitn~vkc--rPp~n  163 (261)
                      .                     ||+  |=+.|...+            ++++-+...+...-+-+.+- +++.  +-++.
T Consensus        79 ~---------------------vi~D~V~~NP~V~~------------~l~~i~~~Wl~~GVDGFRlD-av~~i~k~~~~  124 (219)
T 1r7a_A           79 N---------------------IMVDAIVDSDKGWE------------YLMSIFDQMAASHVSYIRLD-AVGYGAKEAGT  124 (219)
T ss_dssp             E---------------------EEEEEECTSHHHHH------------HHHHHHHHHHHTTCCEEEEE-TGGGSCCCTTS
T ss_pred             E---------------------EEEEECCCCHHHHH------------HHHHHHHHHHHCCCCCCCCC-CCCCCCCCCCC
T ss_conf             8---------------------99998877878887------------78899988987198633344-43444456664


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHCCCCEEEE
Q ss_conf             66778899999999999863229767995
Q gi|254780743|r  164 RNLSNIEMEICRPIIMRQIELISPKILLF  192 (261)
Q Consensus       164 r~p~~~ei~~c~p~L~~ei~li~Pk~ii~  192 (261)
                      +.....+.......+...+....|.+++.
T Consensus       125 ~~~~~~~~~~~~~~~r~~v~~~~~~~~~~  153 (219)
T 1r7a_A          125 SCFMTPKTFKLISRLREEGVKRGLEILIE  153 (219)
T ss_dssp             CSSSCHHHHHHHHHHHHHHHHTTCEEEEC
T ss_pred             CCCCCCHHHHHHHHHHHHHHHCCCCCCCC
T ss_conf             24576203788888999986327533233


No 26 
>>1g94_A Alpha-amylase; beta-alpha-8-barrel, 3 domain structure, hydrolase; HET: DAF GLC; 1.74A {Pseudoalteromonas haloplanktis} (A:1-87,A:148-337)
Probab=22.30  E-value=50  Score=14.14  Aligned_cols=25  Identities=12%  Similarity=0.128  Sum_probs=16.5

Q ss_pred             CHHHHH-HHHHHHHHCCHHHHHHCCC
Q ss_conf             999999-9999999837078871882
Q gi|254780743|r    8 SQEQIL-TIALFYADSGVYWVFDEPN   32 (261)
Q Consensus         8 ~~~~l~-~ll~~~~e~GVd~~~~~p~   32 (261)
                      +-.++. ..|++..++||+.+.=.|+
T Consensus        12 ~~~~~~~~~~~~~~~~g~~~i~~~p~   37 (277)
T 1g94_A           12 NWQDVAQECEQYLGPKGYAAVQVSPP   37 (277)
T ss_dssp             CHHHHHHHHHHTHHHHTCCEEEECCC
T ss_pred             CHHHHHHHHHHHHHHHCCCEEEECCC
T ss_conf             47999999999999809988995988


No 27 
>>2jsx_A Protein NAPD; TAT, proofreading, cytoplasm, chaperone; NMR {Escherichia coli K12} PDB: 2pq4_A (A:)
Probab=21.16  E-value=56  Score=13.86  Aligned_cols=42  Identities=12%  Similarity=0.362  Sum_probs=32.1

Q ss_pred             CCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCC
Q ss_conf             24699899999996003885200287722367888884899857898300
Q gi|254780743|r   72 QKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSD  121 (261)
Q Consensus        72 ~~~~~l~~L~~~~~~~~~C~L~~~~~~~v~g~G~~~a~imiVgeaPg~~E  121 (261)
                      ..+..+++++..+..+.+|..+        +....+.||.++-|+++.++
T Consensus        14 ~~Pe~~~~V~~~l~~~~g~Eih--------~~~~~~GKlVVtiE~~~~~~   55 (95)
T 2jsx_A           14 AKSERISDISTQLNAFPGCEVA--------VSDAPSGQLIVVVEAEDSET   55 (95)
T ss_dssp             ECTTSHHHHHHHHTTSTTEEEE--------EEETTTTEEEEEEEESSHHH
T ss_pred             ECHHHHHHHHHHHHCCCCCEEE--------EECCCCCEEEEEEEECCHHH
T ss_conf             6888899999999748997896--------30388960999997098589


No 28 
>>1g5a_A Amylosucrase; glycosyltransferase, glycoside hydrolase, (beta-alpha)8 barrel; HET: EPE; 1.40A {Neisseria polysaccharea} (A:1-185,A:261-394,A:457-551)
Probab=20.66  E-value=54  Score=13.91  Aligned_cols=14  Identities=7%  Similarity=0.050  Sum_probs=7.8

Q ss_pred             CCEEEEECCCCCCC
Q ss_conf             84899857898300
Q gi|254780743|r  108 QDLMIIGYTPSDSD  121 (261)
Q Consensus       108 a~imiVgeaPg~~E  121 (261)
                      ....++||.-+..+
T Consensus       246 ~~~~~~gE~~~~~~  259 (414)
T 1g5a_A          246 PAVFFKSEAIVHPD  259 (414)
T ss_dssp             TTCEEEECCCSCHH
T ss_pred             CCCEEEEECCCCHH
T ss_conf             98058641257767


Done!