HHsearch results for GI: 254780743 and protein with PDBid: 1wyw_A

>1wyw_A TDG, G/T mismatch-specific thymine DNA glycosylase; hydrolase; 2.10A {Homo sapiens} SCOP: c.18.1.2 PDB: 2d07_A 2rba_A*
Probab=99.92  E-value=9.6e-25  Score=159.86  Aligned_cols=164  Identities=17%  Similarity=0.195  Sum_probs=135.4

Q ss_pred             CCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCC--------------CCCCEEEEEECCCC
Q ss_conf             8772236788888489985789830011200120700489999998609862--------------22100000001225
Q gi|254780743|r   96 SLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR--------------TQIHISMISPWHPP  161 (261)
Q Consensus        96 ~~~~v~g~G~~~a~imiVgeaPg~~Ed~~G~pF~G~aG~lL~~mL~aigl~r--------------~~vyitn~vkcrPp  161 (261)
                      -++.+.....++++|||||.+||..++++|++|+|+++.+.. +|...|+..              ..+++||+|+|+++
T Consensus        11 ~~~~lPd~~~p~~~vLivG~~PG~~S~~~G~~ya~p~N~FW~-~L~~~g~~~~~~~~~e~~~~l~~~gigltdvv~r~t~   89 (230)
T 1wyw_A           11 LTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWK-CLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTP   89 (230)
T ss_dssp             GGCCCCCBCCSSCSEEEEESSCCHHHHHHTSSSCSSSBCHHH-HHHHTTSSSSCCCGGGGGGHHHHHSEEEEESCCSCCS
T ss_pred             HHCCCCCCCCCCCCEEEEECCCCHHHHHCCCCCCCCCHHHHH-HHHHHCCCCCCCCHHHHHHHHHHCCCCEEEEECCCCC
T ss_conf             727799877999978998428896678438888786134999-9999748886678778766665314430212215687


Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEECHHHHHHHHCCCCCCCHHCCCEEEEE--ECCCCCEEEEEEECHHHHHC
Q ss_conf             6666778899999999999863229767995255999998446533101106505766--42897378999708038833
Q gi|254780743|r  162 GNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNL--CTPHSIIPTLATVHPQELIQ  239 (261)
Q Consensus       162 ~nr~p~~~ei~~c~p~L~~ei~li~Pk~ii~lG~~a~~~ll~~~~~~i~~~rG~~~~~--~~~~~~i~~~pt~HPs~LLr  239 (261)
                      +++.|+..|+..|.++|.++|+.++|++|+++|..|.+.+++.. .++...+++|...  ..++..+.+++++|||.+-+
T Consensus        90 ~~s~ls~~E~~~~~~~L~~~I~~~~P~~iv~~G~~A~~~f~~~~-~g~~~~~~~~G~q~~~~~~~~~~v~vlPS~S~~na  168 (230)
T 1wyw_A           90 GSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEV-FGVKVKNLEFGLQPHKIPDTETLCYVMPSSSARCA  168 (230)
T ss_dssp             CGGGCCHHHHHHHHHHHHHHHHHHCCSEEEEESHHHHHHHHHHH-TCCCCSSCCSEECSCCSTTSCCEEEEECCCBTTCS
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECHHHHHHHHHHH-CCCCCCCCEECCCCCCCCCCCCEEEECCCCCHHHH
T ss_conf             77898778998758999999998399689870789999998642-16775331121355456887856998589818860


Q ss_pred             C---HHHHHHHHHHHHHHHHHHHCC
Q ss_conf             6---598999999999999998609
Q gi|254780743|r  240 Y---PLIKKNTWHALITLKKALKNL  261 (261)
Q Consensus       240 ~---P~~K~~aW~DL~~l~~~L~~l  261 (261)
                      +   .+.|-..|..|+.+++.|+.+
T Consensus       169 ~~~r~~~k~~~~~~L~~~~d~l~~~  193 (230)
T 1wyw_A          169 QFPRAQDKVHYYIKLKDLRDQLKGI  193 (230)
T ss_dssp             SCCSGGGTHHHHHHHHHHHHHHTTC
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHH
T ss_conf             8774899999999999999998767