HHsearch results for GI: 254780743 and protein with PDBid: 2c2q_A

>2c2q_A G/U mismatch-specific DNA glycosylase; radiation resistance, DNA repair enzymes, uracil-DNA glycosylase, MUG, hydrolase; 1.7A {Deinococcus radiodurans} PDB: 2c2p_A
Probab=99.96  E-value=3.6e-30  Score=190.81  Aligned_cols=163  Identities=13%  Similarity=0.162  Sum_probs=132.5

Q ss_pred             CCCCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCC-------------EEEEEE
Q ss_conf             5200287722367888884899857898300112001207004899999986098622210-------------000000
Q gi|254780743|r   91 HLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIH-------------ISMISP  157 (261)
Q Consensus        91 ~L~~~~~~~v~g~G~~~a~imiVgeaPg~~Ed~~G~pF~G~aG~lL~~mL~aigl~r~~vy-------------itn~vk  157 (261)
                      .|..++++.|.+.++++++|||||++||.+|+++|+||+|+ |.+|+++|.++|++++++|             +||+++
T Consensus         9 ~~~~~~~~~~P~~~~p~~rilivG~aPG~~s~~~G~~f~~p-~n~fw~~L~~~Gl~~~~~~~~~~~~l~~~~i~~~~~v~   87 (199)
T 2c2q_A            9 DLTGSGEYLVPDVLQPGLTLVLVGTAPSGISARARAYYANP-ENKFWRTLHAVGLTPRQLVPQEYATLPQYGLGLTDVAK   87 (199)
T ss_dssp             CTTTTTTCSSCCBCCTTCSEEEEESCCCHHHHHHTSSSCST-TCCHHHHHHHTTSSSSCCCGGGGGGGGGGTEEEEESCC
T ss_pred             CCCCCCCCCCCCCCCCCCCEEEEECCCCHHHHHCCCCCCCH-HHHHHHHHHHHCCCCCCCCHHHHHHHHHCCCEECCCCC
T ss_conf             64456777689987999978998269798899669853680-78899999991898666788887676640542225668


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEECHHHHHHHHCCCCCCCHHCCCEEEEEECCCCCEEEEEEECHHHH
Q ss_conf             12256666778899999999999863229767995255999998446533101106505766428973789997080388
Q gi|254780743|r  158 WHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQEL  237 (261)
Q Consensus       158 crPp~nr~p~~~ei~~c~p~L~~ei~li~Pk~ii~lG~~a~~~ll~~~~~~i~~~rG~~~~~~~~~~~i~~~pt~HPs~L  237 (261)
                      |++++|+.++..|+  |.+||.++|++++|++||++|+.+++++++... ..... |..........+++++++||||++
T Consensus        88 ~~~~~~~~~~~~e~--~~~~L~~~i~~~~PrvIv~lG~~a~~~~l~~~~-~~~~~-g~~~~~~~~~~~~~v~~lphpS~l  163 (199)
T 2c2q_A           88 RHSGVAAALPGEAW--RPDELRRKVEHYRPRIVAFTSKRGASETLGVPT-GKLPY-GPQPQPLDWPAETELWVLPSTSPL  163 (199)
T ss_dssp             SCCSCGGGSCGGGC--CHHHHHHHHHHHCCSEEEESSHHHHHHHHCSCG-GGCCS-EECCCCSSCCTTCEEEECCCCSGG
T ss_pred             CCCCCCCCCCHHHH--HHHHHHHHHHHCCCCEEEECCHHHHHHHHCCCC-CCCCC-CCCCEECCCCCCCEEEEECCCCHH
T ss_conf             88988887556565--118799999867986999849899999853455-42332-454300134577207985697588


Q ss_pred             HCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             3365989999999999999986
Q gi|254780743|r  238 IQYPLIKKNTWHALITLKKALK  259 (261)
Q Consensus       238 Lr~P~~K~~aW~DL~~l~~~L~  259 (261)
                      .++.. |+..|++|..+.+.|+
T Consensus       164 ~~~~~-r~~~~~~l~~~l~~lr  184 (199)
T 2c2q_A          164 GHNHF-RLEPWQALGDRVRELR  184 (199)
T ss_dssp             GTTTC-CSHHHHHHHHHHHHHH
T ss_pred             HHCCC-CHHHHHHHHHHHHHHH
T ss_conf             71734-2679999999999999