BLAST/PSIBLAST alignment of GI: 254780743 and GI: 209548539 at iteration 1
>gi|209548539|ref|YP_002280456.1| phage SPO1 DNA polymerase-related protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 299
>gi|209534295|gb|ACI54230.1| phage SPO1 DNA polymerase-related protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 299
 Score =  182 bits (461), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 99/296 (33%), Positives = 154/296 (52%), Gaps = 37/296 (12%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVFDEP--NNEATYESQRKEKSIDS---------- 48
           M S   LS  ++  +  F+AD+GV W+ +E   +  A +E+ +  +   +          
Sbjct: 1   MISANDLSPAELAALLHFHADAGVEWLLEEEAIDRFAEFEAMKAARRPAAQTQPSAAGER 60

Query: 49  --------------AIQPITNIRHIHSP--------LVQQADSIAQKACSLHELKSLLRS 86
                         A++P    R    P         VQQA  +A+ A SL ELK+ + +
Sbjct: 61  TPLGENRTPPRPATAVRPAPAERAASGPQPAIPDGEAVQQARFVAESARSLAELKTAIEA 120

Query: 87  FHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIM 146
           F+ C+L  ++ STI A+      +M+IG  P   D+  G PFSGK+G + DKML +I + 
Sbjct: 121 FNGCNLKHSARSTIFASGDAESGIMVIGSAPGAEDDREGVPFSGKSGQLFDKMLAAIGLT 180

Query: 147 RTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDA 206
           R+ I ++ + PW PPGNR  S  EM+ICRP I RQI L  PK +L +GN +  FFF  + 
Sbjct: 181 RSVILLTQVIPWRPPGNRAPSAAEMDICRPFIERQIALAQPKAILLLGNFSARFFFGEN- 239

Query: 207 QKTYQNL-GKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
             T   L G+W  +     +IP +A++HPQ+L+  P+ K+  W+ L+  +  LK+L
Sbjct: 240 -DTIHGLRGRWKEIAAADCVIPAIASLHPQDLLTAPVNKRLAWNDLLAFQAKLKSL 294