BLAST/PSIBLAST alignment of GI: 254780743 and GI: 86356942 at iteration 1
>gi|86356942|ref|YP_468834.1| DNA polymerase bacteriophage-type (uracil-DNA glycosylase) protein [Rhizobium etli CFN 42] Length = 297
>gi|86281044|gb|ABC90107.1| probable DNA polymerase bacteriophage-type (uracil-DNA glycosylase) protein [Rhizobium etli CFN 42] Length = 297
 Score =  175 bits (443), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 153/294 (52%), Gaps = 35/294 (11%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVFDEP--NNEATYESQRKEKSIDSAI---QPITN 55
           M S   LS  ++  +  F+AD+GV W+ +E   +  A +E+ +  +   +     +PI  
Sbjct: 1   MISVNDLSPAELAALLHFHADAGVEWLQEEEAVDRFAEFEAMKAARRPAAQAQQERPIAE 60

Query: 56  IRHI---------------------------HSPLVQQADSIAQKACSLHELKSLLRSFH 88
            R +                               VQQA  +A+ A SL ELK+ + +F+
Sbjct: 61  ERPLPGQRQTSPRPSAAARPAPASGPQPAIPDGEAVQQARFVAEAARSLSELKTAIEAFN 120

Query: 89  DCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRT 148
            C+L  ++ STI A+      +M+IG  PS  D+  G PFSGK+G + DKML +I + R+
Sbjct: 121 GCNLKHSARSTIFASGDADSGIMMIGSAPSAEDDREGTPFSGKSGQLFDKMLAAIGLSRS 180

Query: 149 QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQK 208
            + ++ + PW PPGNR  S  EM+ICRP I RQI L  P+ +L +GN    FFF  +   
Sbjct: 181 SVLLTQVIPWRPPGNRAASPAEMDICRPFIERQIALAEPQAILLLGNFAARFFFGEN--D 238

Query: 209 TYQNL-GKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
           T   L G+W  +     IIPT+A++HPQ+L+  P+ K+  W+ L+  +  L +L
Sbjct: 239 TIHGLRGRWREIAVAGRIIPTIASLHPQDLLTAPVNKRLAWNDLLVFQAKLNSL 292