BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780743|ref|YP_003065156.1| putative uracil-DNA
glycosylase [Candidatus Liberibacter asiaticus str. psy62]
         (261 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780743|ref|YP_003065156.1| putative uracil-DNA glycosylase [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040420|gb|ACT57216.1| putative uracil-DNA glycosylase [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 261

 Score =  541 bits (1394), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 261/261 (100%), Positives = 261/261 (100%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIH 60
           MTSKRILSQEQILTIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIH
Sbjct: 1   MTSKRILSQEQILTIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIH 60

Query: 61  SPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDS 120
           SPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDS
Sbjct: 61  SPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDS 120

Query: 121 DNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMR 180
           DNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMR
Sbjct: 121 DNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMR 180

Query: 181 QIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQY 240
           QIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQY
Sbjct: 181 QIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQY 240

Query: 241 PLIKKNTWHALITLKKALKNL 261
           PLIKKNTWHALITLKKALKNL
Sbjct: 241 PLIKKNTWHALITLKKALKNL 261


>gi|315121906|ref|YP_004062395.1| putative uracil-DNA glycosylase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495308|gb|ADR51907.1| putative uracil-DNA glycosylase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 260

 Score =  370 bits (949), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 183/260 (70%), Positives = 210/260 (80%), Gaps = 2/260 (0%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIH 60
           MT KR LSQE+IL  ALFYADSGVYWVFD  N + T++S  +EK   S+ QPI  I   +
Sbjct: 1   MTYKRTLSQEKILNTALFYADSGVYWVFDHSNGK-THKSWGEEKPPLSS-QPIKEIDQTN 58

Query: 61  SPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDS 120
           +PLV++A SIAQ A SLHELKSL+ SFHDC L +TS STICATQ  G+DLMIIGYTPSDS
Sbjct: 59  NPLVEKAYSIAQNARSLHELKSLISSFHDCALQNTSSSTICATQEGGKDLMIIGYTPSDS 118

Query: 121 DNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMR 180
           DNI+G PFSGKTG++LDKMLQSI +MR Q H SMISPWHPPGNR LS IEMEICRP+IM+
Sbjct: 119 DNINGNPFSGKTGDILDKMLQSIGVMRIQTHTSMISPWHPPGNRQLSKIEMEICRPLIMK 178

Query: 181 QIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQY 240
           QIEL+SP+IL F+GNKT NFFFNND +  YQNLGKW  +   +  IPTL+TVHPQEL+QY
Sbjct: 179 QIELVSPRILFFLGNKTINFFFNNDDKANYQNLGKWHKIQVQNRTIPTLSTVHPQELMQY 238

Query: 241 PLIKKNTWHALITLKKALKN 260
           PLIKK  WH LITLKKALKN
Sbjct: 239 PLIKKTAWHTLITLKKALKN 258


>gi|116251217|ref|YP_767055.1| uracil-DNA glycosylase [Rhizobium leguminosarum bv. viciae 3841]
 gi|115255865|emb|CAK06946.1| putative uracil-DNA glycosylase [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 299

 Score =  184 bits (466), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 101/296 (34%), Positives = 156/296 (52%), Gaps = 37/296 (12%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVFDEP--NNEATYESQRKEKSI------------ 46
           M S   LS  ++  +  F+AD+GV W+ +E   +  A +E+ +  +              
Sbjct: 1   MISANDLSPAELAALLHFHADAGVEWLLEEEAIDRFAEFEAMKAARRPAAQAQQQRPAAG 60

Query: 47  ------------DSAIQPITNIRHIHSP--------LVQQADSIAQKACSLHELKSLLRS 86
                       ++A++P    R    P         VQQA  +A+ A SL ELK+ + S
Sbjct: 61  ERPAPGQAQVRPNAAVRPAPAERAASGPQPAIPDGEAVQQARFVAETARSLVELKTAIES 120

Query: 87  FHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIM 146
           F+ C+L  ++ STI A+      +M+IG  PS  D+  G PFSGK+G + DKML +I + 
Sbjct: 121 FNGCNLKHSARSTIFASGDAESGIMVIGSAPSAEDDREGMPFSGKSGQLFDKMLAAIGLT 180

Query: 147 RTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDA 206
           R+ I ++ + PW PPGNR  S  EM+ICRP I RQI L  PK +L +GN +  FFF  + 
Sbjct: 181 RSAILLTQVIPWRPPGNRAPSAAEMDICRPFIERQIALAEPKAILLLGNFSARFFFGEN- 239

Query: 207 QKTYQNL-GKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
             T   L G+W  +     +IP +A++HPQ+L+  P+ K+  W+ L+  +  LK+L
Sbjct: 240 -DTIHGLRGRWKEIAAADCVIPAIASLHPQDLLTAPVNKRLAWNDLLAFQAKLKSL 294


>gi|209548539|ref|YP_002280456.1| phage SPO1 DNA polymerase-related protein [Rhizobium leguminosarum
           bv. trifolii WSM2304]
 gi|209534295|gb|ACI54230.1| phage SPO1 DNA polymerase-related protein [Rhizobium leguminosarum
           bv. trifolii WSM2304]
          Length = 299

 Score =  182 bits (461), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 99/296 (33%), Positives = 154/296 (52%), Gaps = 37/296 (12%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVFDEP--NNEATYESQRKEKSIDS---------- 48
           M S   LS  ++  +  F+AD+GV W+ +E   +  A +E+ +  +   +          
Sbjct: 1   MISANDLSPAELAALLHFHADAGVEWLLEEEAIDRFAEFEAMKAARRPAAQTQPSAAGER 60

Query: 49  --------------AIQPITNIRHIHSP--------LVQQADSIAQKACSLHELKSLLRS 86
                         A++P    R    P         VQQA  +A+ A SL ELK+ + +
Sbjct: 61  TPLGENRTPPRPATAVRPAPAERAASGPQPAIPDGEAVQQARFVAESARSLAELKTAIEA 120

Query: 87  FHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIM 146
           F+ C+L  ++ STI A+      +M+IG  P   D+  G PFSGK+G + DKML +I + 
Sbjct: 121 FNGCNLKHSARSTIFASGDAESGIMVIGSAPGAEDDREGVPFSGKSGQLFDKMLAAIGLT 180

Query: 147 RTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDA 206
           R+ I ++ + PW PPGNR  S  EM+ICRP I RQI L  PK +L +GN +  FFF  + 
Sbjct: 181 RSVILLTQVIPWRPPGNRAPSAAEMDICRPFIERQIALAQPKAILLLGNFSARFFFGEN- 239

Query: 207 QKTYQNL-GKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
             T   L G+W  +     +IP +A++HPQ+L+  P+ K+  W+ L+  +  LK+L
Sbjct: 240 -DTIHGLRGRWKEIAAADCVIPAIASLHPQDLLTAPVNKRLAWNDLLAFQAKLKSL 294


>gi|218682587|ref|ZP_03530188.1| phage SPO1 DNA polymerase-related protein [Rhizobium etli CIAT 894]
          Length = 299

 Score =  178 bits (452), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 97/296 (32%), Positives = 151/296 (51%), Gaps = 37/296 (12%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVFDEP--NNEATYESQRKEKSIDSAIQPITNIRH 58
           M S   LS  ++  +  F+AD+GV W+ +E   +  A +E+ +  +   +  QP      
Sbjct: 1   MISANDLSPAELAALLHFHADAGVEWLLEEEAVDRFAEFEAMKAARRPPTQAQPSVAGEG 60

Query: 59  IHS--------------------------------PLVQQADSIAQKACSLHELKSLLRS 86
             S                                  VQQA  +A+ A SL ELK+ + +
Sbjct: 61  TGSGQGRTTPRPNAAARPAPAAIAASGPQPAIPDGEAVQQARFVAETARSLAELKTAIEA 120

Query: 87  FHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIM 146
           F+ C+L  ++ STI A+      +M+IG  P   D+  G PFSGK+G + DKML +I + 
Sbjct: 121 FNGCNLKHSARSTIFASGDADSGIMVIGSAPGAEDDREGVPFSGKSGQLFDKMLAAIGLT 180

Query: 147 RTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDA 206
           R+ + ++ + PW PPGNR  S  EM+ICRP I RQI L  PK +L +GN +  FFF  + 
Sbjct: 181 RSSVLLTQVIPWRPPGNRPPSAAEMDICRPFIERQIALAEPKAILLLGNFSARFFFGEN- 239

Query: 207 QKTYQNL-GKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
             T   L G+W  +     +IP +A++HPQ+L+  P+ K+  W+ L+  +  LK+L
Sbjct: 240 -DTIHGLRGRWKEIAVADCVIPAIASLHPQDLLTAPVNKRLAWNDLLAFQAKLKSL 294


>gi|327193963|gb|EGE60838.1| putative DNA-directed DNA polymerase protein (uracil-DNA
           glycosylase) [Rhizobium etli CNPAF512]
          Length = 296

 Score =  176 bits (446), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 98/293 (33%), Positives = 152/293 (51%), Gaps = 34/293 (11%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVFDEP--NNEATYESQRKEKSIDSAIQ------- 51
           M S   LS  ++  +  F+AD+GV W+ +E   +  A +E+ +  +   SA Q       
Sbjct: 1   MISANDLSPAELAALLHFHADAGVEWLLEEEAVDRFAEFEAMKAARRPASAQQERPAAGE 60

Query: 52  -PITNIRHIHSPL---------------------VQQADSIAQKACSLHELKSLLRSFHD 89
            P    R     L                     VQQA  +A+ A SL ELK+ + +F+ 
Sbjct: 61  SPSVGERQTSPRLTAAARPAPVSGPQPAIPDGEAVQQARFVAEAARSLGELKTAIEAFNG 120

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C+L  ++ STI A+      +M+IG  PS  D+  G PFSGK+G + DKML +I + R+ 
Sbjct: 121 CNLKHSARSTIFASGDAESGIMVIGSAPSAEDDREGLPFSGKSGQLFDKMLAAIGLNRSS 180

Query: 150 IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKT 209
           + ++ + PW PPGNR  S  E++ICRP I RQI L  P+ +L +GN    FF   +   T
Sbjct: 181 VLLTQVIPWRPPGNRAASAAEIDICRPFIERQIALAEPQAILLLGNFAARFFLGEN--DT 238

Query: 210 YQNL-GKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
              L G+W ++      IP +A++HPQ+L+  P+ K+  W+ L+  +  LK+L
Sbjct: 239 IHGLRGRWKDIVIADRAIPAIASLHPQDLLTAPVNKRLAWNDLLAFQAKLKSL 291


>gi|190891014|ref|YP_001977556.1| DNA-directed DNA polymerase (uracil-DNA glycosylase) [Rhizobium
           etli CIAT 652]
 gi|190696293|gb|ACE90378.1| probable DNA-directed DNA polymerase protein (uracil-DNA
           glycosylase) [Rhizobium etli CIAT 652]
          Length = 296

 Score =  176 bits (445), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 98/293 (33%), Positives = 153/293 (52%), Gaps = 34/293 (11%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVFDEP--NNEATYESQRKEKSIDSAIQ------- 51
           M S   LS  ++  +  F+AD+GV W+ +E   +  A +E+ +  +   SA Q       
Sbjct: 1   MISANDLSPAELAALLHFHADAGVEWLLEEEAVDRFAEFEAMKAARRPASAQQERPAAGE 60

Query: 52  ------------PITNIRH--IHSP--------LVQQADSIAQKACSLHELKSLLRSFHD 89
                       P    R   +  P         VQQA  +A+ A SL ELK+ + +F+ 
Sbjct: 61  RPSVGERQTSPRPTAAARPAPVSGPQPAIPDGEAVQQARFVAEAARSLGELKTAIEAFNG 120

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C+L  ++ STI A+      +M+IG  PS  D+  G PFSGK+G + DKML +I + R+ 
Sbjct: 121 CNLKHSARSTIFASGDAESGIMVIGSAPSAEDDREGLPFSGKSGQLFDKMLAAIGLNRSS 180

Query: 150 IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKT 209
           + ++ + PW PPGNR  S  E++ICRP I RQI L  P+ +L +GN    FF   +   T
Sbjct: 181 VLLTQVIPWRPPGNRAASAAEIDICRPFIERQIALAEPQAILLLGNFAARFFLGEN--DT 238

Query: 210 YQNL-GKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
              L G+W ++      IP +A++HPQ+L+  P+ K+  W+ L+  +  LK+L
Sbjct: 239 IHGLRGRWKDIVIADRAIPAIASLHPQDLLTAPVNKRLAWNDLLAFQAKLKSL 291


>gi|218675319|ref|ZP_03524988.1| probable DNA-directed DNA polymerase protein (uracil-DNA
           glycosylase) [Rhizobium etli GR56]
          Length = 296

 Score =  176 bits (445), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 98/293 (33%), Positives = 153/293 (52%), Gaps = 34/293 (11%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVFDEP--NNEATYESQRKEKSIDSAIQ------- 51
           M S   LS  ++  +  F+AD+GV W+ +E   +  A +E+ +  +   SA Q       
Sbjct: 1   MISANDLSPAELAALLHFHADAGVEWLLEEEAVDRFAEFEAMKAARRPASAQQERPAVGE 60

Query: 52  ------------PITNIRH--IHSP--------LVQQADSIAQKACSLHELKSLLRSFHD 89
                       P    R   +  P         VQQA  +A+ A SL ELK+ + +F+ 
Sbjct: 61  RPNSGERQTLPRPTAAARPAPVSGPQPAIPDGEAVQQARFVAEAARSLAELKTAIEAFNG 120

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C+L  ++ STI A+      +M+IG  PS  D+  G PFSGK+G + DKML +I + R+ 
Sbjct: 121 CNLKHSARSTIFASGDAESGIMVIGSAPSAEDDREGLPFSGKSGQLFDKMLAAIGLNRSS 180

Query: 150 IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKT 209
           + ++ + PW PPGNR  S  E++ICRP I RQI L  P+ +L +GN    FF   +   T
Sbjct: 181 VLLTQVIPWRPPGNRAASAAEIDICRPFIERQIALAEPQAILLLGNFAARFFLGEN--DT 238

Query: 210 YQNL-GKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
              L G+W ++      IP +A++HPQ+L+  P+ K+  W+ L+  +  LK+L
Sbjct: 239 IHGLRGRWKDIVIADRAIPAIASLHPQDLLTAPVNKRLAWNDLLAFQAKLKSL 291


>gi|86356942|ref|YP_468834.1| DNA polymerase bacteriophage-type (uracil-DNA glycosylase) protein
           [Rhizobium etli CFN 42]
 gi|86281044|gb|ABC90107.1| probable DNA polymerase bacteriophage-type (uracil-DNA glycosylase)
           protein [Rhizobium etli CFN 42]
          Length = 297

 Score =  175 bits (443), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 153/294 (52%), Gaps = 35/294 (11%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVFDEP--NNEATYESQRKEKSIDSAI---QPITN 55
           M S   LS  ++  +  F+AD+GV W+ +E   +  A +E+ +  +   +     +PI  
Sbjct: 1   MISVNDLSPAELAALLHFHADAGVEWLQEEEAVDRFAEFEAMKAARRPAAQAQQERPIAE 60

Query: 56  IRHI---------------------------HSPLVQQADSIAQKACSLHELKSLLRSFH 88
            R +                               VQQA  +A+ A SL ELK+ + +F+
Sbjct: 61  ERPLPGQRQTSPRPSAAARPAPASGPQPAIPDGEAVQQARFVAEAARSLSELKTAIEAFN 120

Query: 89  DCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRT 148
            C+L  ++ STI A+      +M+IG  PS  D+  G PFSGK+G + DKML +I + R+
Sbjct: 121 GCNLKHSARSTIFASGDADSGIMMIGSAPSAEDDREGTPFSGKSGQLFDKMLAAIGLSRS 180

Query: 149 QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQK 208
            + ++ + PW PPGNR  S  EM+ICRP I RQI L  P+ +L +GN    FFF  +   
Sbjct: 181 SVLLTQVIPWRPPGNRAASPAEMDICRPFIERQIALAEPQAILLLGNFAARFFFGEN--D 238

Query: 209 TYQNL-GKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
           T   L G+W  +     IIPT+A++HPQ+L+  P+ K+  W+ L+  +  L +L
Sbjct: 239 TIHGLRGRWREIAVAGRIIPTIASLHPQDLLTAPVNKRLAWNDLLVFQAKLNSL 292


>gi|241203823|ref|YP_002974919.1| phage SPO1 DNA polymerase-related protein [Rhizobium leguminosarum
           bv. trifolii WSM1325]
 gi|240857713|gb|ACS55380.1| phage SPO1 DNA polymerase-related protein [Rhizobium leguminosarum
           bv. trifolii WSM1325]
          Length = 299

 Score =  173 bits (439), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 83/199 (41%), Positives = 123/199 (61%), Gaps = 3/199 (1%)

Query: 64  VQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNI 123
           VQQA  +A+ A SL ELK+ + +F+ C+L  ++ STI A+      +M+IG  PS  D+ 
Sbjct: 98  VQQARFVAETARSLVELKTAIETFNGCNLKHSARSTIFASGDTESGIMVIGSAPSAEDDR 157

Query: 124 SGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIE 183
            G PFSGK+G + DKML +I + R+ I ++ + PW PPGNR  S  EM+ICRP I RQI 
Sbjct: 158 EGLPFSGKSGQLFDKMLAAIGLTRSTILLTQVIPWRPPGNRAPSAAEMDICRPFIERQIA 217

Query: 184 LISPKILLFIGNKTKNFFFNNDAQKTYQNL-GKWSNLCTPHSIIPTLATVHPQELIQYPL 242
           L  PK +L +GN +  FFF  +   T   L G+W  +     +IP +A++HPQ+L+  P+
Sbjct: 218 LAEPKAILLLGNFSARFFFGEN--DTIHGLRGRWKEIAAADCVIPAIASLHPQDLLTAPV 275

Query: 243 IKKNTWHALITLKKALKNL 261
            K+  W+ L+  +  LK+L
Sbjct: 276 NKRLAWNDLLAFQAKLKSL 294


>gi|15888330|ref|NP_354011.1| DNA polymerase [Agrobacterium tumefaciens str. C58]
 gi|15156000|gb|AAK86796.1| DNA polymerase [Agrobacterium tumefaciens str. C58]
          Length = 296

 Score =  168 bits (425), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 96/296 (32%), Positives = 144/296 (48%), Gaps = 47/296 (15%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVFDEP--NNEATYESQRKEKSIDSAIQPITNIRH 58
           M +   LS  ++  +  F+AD+GV W+ +E   +  A + + R     D+A    T  R 
Sbjct: 1   MIAAHDLSPAELAALLHFHADAGVDWMLEEAPVDRFAEFAAARPMPGQDAA----TPARQ 56

Query: 59  IHSPLVQQADS--------------------------------------IAQKACSLHEL 80
             SP  ++ D+                                       A+ A SL EL
Sbjct: 57  AQSPADRRTDAPQRQAPGRSAPARGAPAAPAIQQNVAMPDEQAVSAARFAAESARSLGEL 116

Query: 81  KSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKML 140
           ++ L  F+ C+L +++ +TI +       +M+IG  P   D+  G PF+GKTG +L++ML
Sbjct: 117 RTALEGFNGCNLKNSARNTIFSEGDPASAIMVIGPMPDADDDREGTPFAGKTGQLLERML 176

Query: 141 QSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNF 200
            +I + R+ I I  + PW PPGNR  +  EM+ICRP I RQI L  PK LL +GN T  F
Sbjct: 177 AAIGLERSAIMIGNVVPWRPPGNRPPTQAEMDICRPFIERQIALAEPKHLLLLGNFTARF 236

Query: 201 FFNNDAQKTYQNL-GKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
           FF      T   L G+W ++   H I+P LA++HPQEL+  P  K   W  L+  +
Sbjct: 237 FFGGTG--TIHTLRGQWRDVAAGHLILPALASLHPQELLNAPASKSLAWQDLLAFQ 290


>gi|150395871|ref|YP_001326338.1| phage SPO1 DNA polymerase-like protein [Sinorhizobium medicae
           WSM419]
 gi|150027386|gb|ABR59503.1| phage SPO1 DNA polymerase-related protein [Sinorhizobium medicae
           WSM419]
          Length = 289

 Score =  167 bits (422), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 97/285 (34%), Positives = 147/285 (51%), Gaps = 31/285 (10%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVFDEP--NNEATYESQRKEKSIDSAI-------- 50
           M S   LS  ++  +  F+A++GV W+ +E   +  A +E+ R  ++   A         
Sbjct: 1   MISANDLSPSELAALLAFHAEAGVEWLIEEEPLDRLAEFEAMRMRRTESRAAPQANEMAA 60

Query: 51  ---QPI--TNIRH-------IHSPLV--------QQADSIAQKACSLHELKSLLRSFHDC 90
              QP+  T  R           P+V        ++A  +A  A SL EL++ + +F  C
Sbjct: 61  ERRQPVPETTARERAQAAPTARPPVVAIPDEQAIKEAQFVAGAARSLGELRTAMEAFSGC 120

Query: 91  HLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQI 150
           +L +++ + + A  +    +MIIG  P   D+  G PF+G+ G ML++ML  I + R  +
Sbjct: 121 NLRNSARNLVFAEGSAASGVMIIGPMPYADDDRDGHPFAGRHGQMLERMLFGIGLSRDDV 180

Query: 151 HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTY 210
            ++   PW PPGNR  S  E +ICRP I RQIEL  PK LL +GN T  FFF   A+  +
Sbjct: 181 LLTNTVPWRPPGNRVPSAREADICRPFIERQIELAEPKQLLLLGNFTARFFFGG-AEMIH 239

Query: 211 QNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
           Q  G+W  L    + IP LAT+HPQ+LI  P+ K+  W  L+  K
Sbjct: 240 QLRGEWRELTFAGTSIPALATLHPQDLIAAPINKRFAWLDLLAFK 284


>gi|15964784|ref|NP_385137.1| hypothetical protein SMc02375 [Sinorhizobium meliloti 1021]
 gi|307309672|ref|ZP_07589324.1| phage SPO1 DNA polymerase-related protein [Sinorhizobium meliloti
           BL225C]
 gi|15073962|emb|CAC45603.1| Putative DNA polymerase bacteriophage-type [Sinorhizobium meliloti
           1021]
 gi|306899884|gb|EFN30507.1| phage SPO1 DNA polymerase-related protein [Sinorhizobium meliloti
           BL225C]
          Length = 286

 Score =  166 bits (419), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 91/288 (31%), Positives = 145/288 (50%), Gaps = 33/288 (11%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVFDEP--NNEATYESQRKEKSIDSAIQPITNIRH 58
           M S   LS+ ++  +  F+A++GV W+ +E   +  A +E+ +  ++   A+ P T    
Sbjct: 1   MISANDLSRSELAALLAFHAEAGVEWLLEEEPVDRLAEFEAMKSRRAQSRAV-PQTGATA 59

Query: 59  IH----------------------------SPLVQQADSIAQKACSLHELKSLLRSFHDC 90
                                            +++A  +A  A SL EL++ + +F  C
Sbjct: 60  AEPQQSAPPAAARERRPAPPAPPPVVAIPDEQAIKEAQFVADAARSLGELRTAMEAFAGC 119

Query: 91  HLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQI 150
           +L +++ + + A  +    +MIIG  P   D+  G+PF+G+ G ML++ML  I + R  +
Sbjct: 120 NLRNSARNLVFAEGSAASGVMIIGPMPYADDDRDGRPFAGRHGEMLERMLSGIGLSREDV 179

Query: 151 HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTY 210
            ++   PW PPGNR  S  E +ICRP I RQI L  PK LL +GN T  FFF    +  +
Sbjct: 180 LLANAVPWRPPGNRVPSAREADICRPFIERQIALAEPKQLLLLGNFTARFFFGG--ETIH 237

Query: 211 QNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
           Q  G+W  L    + IPTLAT+HPQ+L+  P+ K+  W  L+  K  L
Sbjct: 238 QLRGEWRELTFGGTSIPTLATLHPQDLVAAPINKRFAWLDLLAFKSRL 285


>gi|307319469|ref|ZP_07598896.1| phage SPO1 DNA polymerase-related protein [Sinorhizobium meliloti
           AK83]
 gi|306894841|gb|EFN25600.1| phage SPO1 DNA polymerase-related protein [Sinorhizobium meliloti
           AK83]
          Length = 286

 Score =  165 bits (418), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 91/288 (31%), Positives = 145/288 (50%), Gaps = 33/288 (11%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVFDEP--NNEATYESQRKEKSIDSAIQPITNIRH 58
           M S   LS+ ++  +  F+A++GV W+ +E   +  A +E+ +  ++   A+ P T    
Sbjct: 1   MISANDLSRSELAALLAFHAEAGVEWLLEEEPVDRLAEFEAMKSRRAQSRAV-PQTGATA 59

Query: 59  IH----------------------------SPLVQQADSIAQKACSLHELKSLLRSFHDC 90
                                            +++A  +A  A SL EL++ + +F  C
Sbjct: 60  AEPQQSAPPAAARERRPAPPAPPPVVAIPDEQAIKEAQFVADAARSLGELRTAMEAFAGC 119

Query: 91  HLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQI 150
           +L +++ + + A  +    +MIIG  P   D+  G+PF+G+ G ML++ML  I + R  +
Sbjct: 120 NLRNSARNLVFAEGSAAPGVMIIGPMPYADDDRDGRPFAGRHGEMLERMLSGIGLSREDV 179

Query: 151 HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTY 210
            ++   PW PPGNR  S  E +ICRP I RQI L  PK LL +GN T  FFF    +  +
Sbjct: 180 LLANAVPWRPPGNRVPSAREADICRPFIERQIALAEPKQLLLLGNFTARFFFGG--ETIH 237

Query: 211 QNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
           Q  G+W  L    + IPTLAT+HPQ+L+  P+ K+  W  L+  K  L
Sbjct: 238 QLRGEWRELTFGGTSIPTLATLHPQDLVAAPINKRFAWLDLLAFKSRL 285


>gi|227821368|ref|YP_002825338.1| DNA polymerase [Sinorhizobium fredii NGR234]
 gi|227340367|gb|ACP24585.1| DNA polymerase [Sinorhizobium fredii NGR234]
          Length = 293

 Score =  165 bits (417), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 89/291 (30%), Positives = 143/291 (49%), Gaps = 39/291 (13%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVF-DEPNNE------------------------- 34
           M S   LS  ++  +  F+A++GV W+  DEP +                          
Sbjct: 1   MISANDLSASELAALLAFHAEAGVEWLLEDEPVDRLAEFEAMKAKRADARAAPPVRQATP 60

Query: 35  ----------ATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLL 84
                     AT    R  +    ++ P   I    +  V +A   A+ A SL EL++ +
Sbjct: 61  PEVQGGRVQPATSGKARDARPAAPSVPPTVAIPDEQA--VSEARFAAESARSLAELRTAM 118

Query: 85  RSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIE 144
            +F  C+L +++ + + A       +M++G  P   D+  G+PF+G+ G+ML++ML  I 
Sbjct: 119 EAFTGCNLKNSARNLVFADGNAASGIMVVGPMPYAEDDRDGQPFAGRHGDMLERMLSGIG 178

Query: 145 IMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNN 204
           + R+ I ++ + PW PPGNR  S  E +ICRP I RQI L  P+ +L +GN T  FFF  
Sbjct: 179 LSRSDILLTNVVPWRPPGNRVPSGREADICRPFIERQIALAEPRHMLLLGNFTARFFFGT 238

Query: 205 DAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
           + +  +Q  G+W  L     ++P LAT+HPQ+LI  P+ K+  W  L+  K
Sbjct: 239 N-ETIHQTRGQWRELSAGGHLVPALATLHPQDLISAPVNKRFAWQDLLAFK 288


>gi|222085329|ref|YP_002543859.1| DNA polymerase bacteriophage-type (uracil-DNA glycosylase) protein
           [Agrobacterium radiobacter K84]
 gi|221722777|gb|ACM25933.1| DNA polymerase bacteriophage-type (uracil-DNA glycosylase) protein
           [Agrobacterium radiobacter K84]
          Length = 255

 Score =  163 bits (413), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 81/193 (41%), Positives = 120/193 (62%), Gaps = 3/193 (1%)

Query: 64  VQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNI 123
           V+QA   A+ A SL ELK+ L +F+ C+L +++ STI A+      +M+IG  PS  D+ 
Sbjct: 56  VEQARFAAESARSLSELKTALEAFNSCNLKNSARSTIFASGAPEGRIMVIGPMPSADDDR 115

Query: 124 SGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIE 183
            G PF+G+TG +LDKML +I + R  I ++ + PW PPGNR  S  E+EICRP I RQI 
Sbjct: 116 EGAPFAGRTGLLLDKMLAAIGLKRNDILLTNVIPWRPPGNRAPSAPEIEICRPFIERQIT 175

Query: 184 LISPKILLFIGNKTKNFFFNNDAQKTYQNL-GKWSNLCTPHSIIPTLATVHPQELIQYPL 242
           L  P+ LL +GN T   FF ++  +T   L G+W ++      IP +A++HPQEL+  P+
Sbjct: 176 LAEPQALLLLGNFTARHFFGSN--ETIHGLRGQWRDVTISGRAIPAIASLHPQELLTAPI 233

Query: 243 IKKNTWHALITLK 255
            K+  W+ L+  +
Sbjct: 234 NKRLAWNDLLAFR 246


>gi|222148035|ref|YP_002548992.1| DNA polymerase [Agrobacterium vitis S4]
 gi|221735023|gb|ACM35986.1| DNA polymerase [Agrobacterium vitis S4]
          Length = 302

 Score =  150 bits (378), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 73/188 (38%), Positives = 104/188 (55%), Gaps = 1/188 (0%)

Query: 71  AQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSG 130
           A+ A SL ELK+ L  F  C+L +++ STI A       +M+IG  PS  D+  G  FSG
Sbjct: 115 AESARSLAELKAALEGFSSCNLKTSARSTIFAEGPAEAGIMVIGPIPSADDDREGLAFSG 174

Query: 131 KTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKIL 190
           +TG +LD+ML +I + R  + ++   PW  PG+R  +  E  ICRP I RQI L  PK +
Sbjct: 175 RTGALLDRMLAAIGLRRDALLLTTAIPWRGPGDRMPTPAEAAICRPFIERQIALAEPKAV 234

Query: 191 LFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHA 250
           L +GN T  FFF   A   +   G+W ++      +  +AT HPQEL+Q P  K   W  
Sbjct: 235 LLLGNFTARFFFGGTA-TIHSMRGEWRDVAAGGHGVAAMATFHPQELLQAPATKALAWRD 293

Query: 251 LITLKKAL 258
           L+  ++ L
Sbjct: 294 LLAFRQRL 301


>gi|325292366|ref|YP_004278230.1| DNA polymerase bacteriophage-type [Agrobacterium sp. H13-3]
 gi|325060219|gb|ADY63910.1| putative DNA polymerase bacteriophage-type [Agrobacterium sp.
           H13-3]
          Length = 299

 Score =  150 bits (378), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 104/181 (57%), Gaps = 3/181 (1%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           SL ELK  L  F  C+L +++ +T+         +M+IG  P   D+  G+ F+GKTG +
Sbjct: 115 SLSELKIALEGFSGCNLKNSARNTVFTEGDPACAVMVIGPMPDADDDREGQLFAGKTGLL 174

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           LD+ML +I + R +I +  + PW PPGNR  +  EM+ICRP I RQI L  PK LL +GN
Sbjct: 175 LDRMLAAIGLDRARIMLGNVVPWRPPGNRPPTQAEMDICRPFIERQIALAEPKHLLLLGN 234

Query: 196 KTKNFFFNNDAQKTYQNL-GKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITL 254
            T  FFF      T   L G+W ++   H ++P LA++HPQEL+  P  K   W  L+  
Sbjct: 235 LTARFFFGGTG--TIHTLRGQWRDVAAGHLVLPALASLHPQELLNAPASKSLAWQDLLAF 292

Query: 255 K 255
           +
Sbjct: 293 Q 293


>gi|218516704|ref|ZP_03513544.1| probable DNA-directed DNA polymerase protein (uracil-DNA
           glycosylase) [Rhizobium etli 8C-3]
          Length = 183

 Score =  149 bits (375), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 68/179 (37%), Positives = 107/179 (59%), Gaps = 3/179 (1%)

Query: 84  LRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSI 143
           + +F+ C+L  ++ STI A+      +M+IG  PS  D+  G PFSGK+G + DKML +I
Sbjct: 2   IEAFNGCNLKHSARSTIFASGDAESGIMVIGSAPSAEDDREGLPFSGKSGQLFDKMLAAI 61

Query: 144 EIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFN 203
            + R+ + ++ + PW PPGNR  S  E++ICRP I RQI L  P+ +L +GN    FF  
Sbjct: 62  GLNRSSVLLTQVIPWRPPGNRAASAAEIDICRPFIERQIALAEPQAILLLGNFAARFFLG 121

Query: 204 NDAQKTYQNL-GKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
            +   T   L G+W ++      IP +A++HPQ+L+  P+ K+  W+ L+  +  LK+L
Sbjct: 122 EN--DTIHGLRGRWKDIVIADRAIPAIASLHPQDLLTAPVNKRLAWNDLLAFQAKLKSL 178


>gi|49474043|ref|YP_032085.1| DNA polymerase [Bartonella quintana str. Toulouse]
 gi|49239547|emb|CAF25904.1| DNA polymerase, bacteriophage type [Bartonella quintana str.
           Toulouse]
          Length = 275

 Score =  147 bits (371), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 99/274 (36%), Positives = 144/274 (52%), Gaps = 19/274 (6%)

Query: 3   SKRILSQEQILTIALFYADSGVYWVF-DEPNN---EATYESQRKEKSIDS----AIQPIT 54
           S+  +S E++L+   FY +SGV  V  D P +   +A+  +Q  +K ID+    ++ P  
Sbjct: 5   SQYSISYEELLS---FYKESGVDAVLSDVPIDRFSQASSSTQELKKVIDTPHHQSVSPTI 61

Query: 55  NIRHI---HSPLVQQADS---IAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQ 108
                   HS  +Q+  S   IA+ A +L ELKS L  F+ C L  T+ ST  +  T G 
Sbjct: 62  KQHSYPLPHSSTIQREPSAIEIAKSANTLDELKSALLVFNGCSLKLTAKSTCFSDGTAGS 121

Query: 109 DLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSN 168
            LMIIG  P   ++I G PF GK G +L+K+L SI + R  ++I+   PW PPGNR  + 
Sbjct: 122 PLMIIGEAPGREEDIQGIPFVGKAGMLLNKILASIGLTRKNVYIANTIPWRPPGNRTPTP 181

Query: 169 IEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSI-IP 227
            E+ +CRP I RQI L +P+IL+ +G      F         +  GKW    +  +I IP
Sbjct: 182 REVALCRPFIERQIHLANPRILIALGGVAMQ-FLTGSQNGIIRTRGKWCTYESEDNIKIP 240

Query: 228 TLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
            + T HP  L++ P  KK TW   + +K  L NL
Sbjct: 241 VMPTFHPAYLLRTPSQKKLTWRDFLEVKNRLNNL 274


>gi|114705011|ref|ZP_01437919.1| hypothetical protein FP2506_08741 [Fulvimarina pelagi HTCC2506]
 gi|114539796|gb|EAU42916.1| hypothetical protein FP2506_08741 [Fulvimarina pelagi HTCC2506]
          Length = 308

 Score =  145 bits (367), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 74/202 (36%), Positives = 111/202 (54%), Gaps = 6/202 (2%)

Query: 64  VQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNI 123
           +  A   A+ A SL EL+  LRSF  C L  T+ S +     E  DLM++G  P   +++
Sbjct: 106 IADARERARSAASLAELEDALRSFEGCALRVTAKSCVFGNGREDADLMLVGEAPGRDEDL 165

Query: 124 SGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIE 183
            G+PF GK+G +LD+ML SI + R  + ++   PW PPGNR  + +E  +C P + R IE
Sbjct: 166 EGEPFVGKSGQLLDRMLLSIGLEREAVRVTNTVPWRPPGNRQPTPVETAMCLPFLQRHIE 225

Query: 184 LISPKILLFIGNKTKNFFFNNDAQKTYQNL-GKWSNLC---TPHSIIPTLATVHPQELIQ 239
           L+ PKIL+ +GN         DA++    L GKW +       +  IP +A +HP  L++
Sbjct: 226 LVRPKILVALGNPASIALL--DAKEGILRLRGKWKSYTMGLGENDQIPAMAMLHPAYLLR 283

Query: 240 YPLIKKNTWHALITLKKALKNL 261
            P  K+  W  L+ LK  L++L
Sbjct: 284 NPAQKRLAWRDLLMLKAKLEDL 305


>gi|254504642|ref|ZP_05116793.1| uracil-DNA glycosylase, family 4, putative [Labrenzia alexandrii
           DFL-11]
 gi|222440713|gb|EEE47392.1| uracil-DNA glycosylase, family 4, putative [Labrenzia alexandrii
           DFL-11]
          Length = 300

 Score =  144 bits (364), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 68/200 (34%), Positives = 113/200 (56%), Gaps = 3/200 (1%)

Query: 63  LVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDN 122
           ++  A  +A    SL +L++ L +F  C+L  T+ S + A       +M+IG  P   ++
Sbjct: 102 VISTARELASSTGSLADLRACLEAFDGCNLKRTAKSLVFADGNPDARVMLIGEAPGRDED 161

Query: 123 ISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQI 182
           + GKPF G++G +LD+ML +I + R++++I+   PW PPGNR  +  E EICRP I RQI
Sbjct: 162 LQGKPFVGRSGQLLDRMLTAIGLDRSRVYIANTVPWRPPGNRTPTPQETEICRPFIQRQI 221

Query: 183 ELISPKILLFIGNKT-KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
           EL++P +++F+G  + K      D  +  +  G+W         +  LAT HP  L++ P
Sbjct: 222 ELVNPDVVVFLGAASAKTLLGVQDGIRKMR--GRWMTYPVAGRQVAALATYHPAYLLRSP 279

Query: 242 LIKKNTWHALITLKKALKNL 261
           L K+ +W   +++K  L  L
Sbjct: 280 LEKRLSWRDFLSVKSKLSEL 299


>gi|110633263|ref|YP_673471.1| phage SPO1 DNA polymerase-related protein [Mesorhizobium sp. BNC1]
 gi|110284247|gb|ABG62306.1| phage SPO1 DNA polymerase-related protein [Chelativorans sp. BNC1]
          Length = 285

 Score =  143 bits (361), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 94/285 (32%), Positives = 143/285 (50%), Gaps = 27/285 (9%)

Query: 1   MTSKRILSQEQILTIALFYADSGV---YW-----VFDEPNNEA-TY-ESQRKEKSIDSAI 50
           MTS   L    I  +  FY+++G     W      F E    A T+ E+ R  +S  +A 
Sbjct: 1   MTSTTPLDFAGIRELLAFYSEAGADEALWEEAQDRFAEAKASAQTFSETVRPAQSDAAAP 60

Query: 51  QPITNIRHIH-SPLVQQ------------ADSIAQKACSLHELKSLLRSFHDCHLCSTSL 97
           QP         +P+  Q            A  +A++A +L ELK +L  F  C+L  T+ 
Sbjct: 61  QPENRATQPKPAPISAQPAAVPDEAQAAHAREVARQARTLDELKEILAGFEGCNLRLTAK 120

Query: 98  STICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISP 157
           + + A      DLM++G  P   +++ G PF G++G +L++ML +I   R+  +I+ + P
Sbjct: 121 NLVFADGNPQADLMLVGEAPGRDEDLQGLPFVGRSGQLLNRMLAAIGRDRSTAYIANVIP 180

Query: 158 WHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNL-GKW 216
           W PPGNR+ S +E EICRP I R IEL++PK+L+ +GN +         Q     L G W
Sbjct: 181 WRPPGNRDPSPLETEICRPFIERHIELVAPKLLVTLGNPSTKLLLGT--QTGIMRLRGTW 238

Query: 217 SNLCTPHSI-IPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
           S   T   + IPT+ T+HP  L++ P  KK  W   + +K  L N
Sbjct: 239 SVHRTAGGLEIPTMPTLHPAYLLRNPAHKKLAWRDFLAVKMRLAN 283


>gi|260462363|ref|ZP_05810571.1| phage SPO1 DNA polymerase-related protein [Mesorhizobium
           opportunistum WSM2075]
 gi|259031857|gb|EEW33125.1| phage SPO1 DNA polymerase-related protein [Mesorhizobium
           opportunistum WSM2075]
          Length = 298

 Score =  143 bits (361), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 83/285 (29%), Positives = 138/285 (48%), Gaps = 32/285 (11%)

Query: 8   SQEQILTIALFYADSGVYWVFDE-----------------------PNNEATYESQRKEK 44
           S  +I  I  FYA +GV    ++                       P  + T E      
Sbjct: 14  SPTEIADILAFYASAGVDEALEDAPVNRFAEAAPRPVERAPAPLPSPREDKTPERPAASS 73

Query: 45  SIDSAIQPITNIRHIHS----PLVQQA---DSIAQKACSLHELKSLLRSFHDCHLCSTSL 97
            +D++  P   +R + +    P   QA     +A  A +L EL+  + +F  C+L +T+ 
Sbjct: 74  GLDASKVPDAPVRTVSATAAVPDEAQAALARQMATSASTLEELRQHMAAFEGCNLKATAK 133

Query: 98  STICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISP 157
           + + A       +M++G  P   ++I G PF G++G +LD+ML +I + R+ ++I+ + P
Sbjct: 134 NLVFADGNPQAAVMLVGEAPGRDEDIEGLPFVGRSGRLLDRMLAAIGLDRSSVYIANVIP 193

Query: 158 WHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWS 217
           W PPGNR  +  E EICRP I RQIEL++PK+L+ +G  +     N  ++   +  G W 
Sbjct: 194 WRPPGNRTPTPHETEICRPFIERQIELLNPKVLVNLGGPSAKTLLNT-SEGILRLRGNWR 252

Query: 218 NLCTPHSI-IPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
              T   + IP + T+HP  L++ P  KK  W   + +K  L+ L
Sbjct: 253 AHTTASGVTIPAMPTLHPAYLLRTPAHKKLAWRDFLEVKAKLRAL 297


>gi|121602683|ref|YP_988758.1| uracil-DNA glycosylase [Bartonella bacilliformis KC583]
 gi|120614860|gb|ABM45461.1| uracil-DNA glycosylase, family 4 [Bartonella bacilliformis KC583]
          Length = 275

 Score =  143 bits (361), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 94/271 (34%), Positives = 139/271 (51%), Gaps = 21/271 (7%)

Query: 7   LSQEQILTIALFYADSGVYWVF-DEPNNEATYESQRKEK-----SIDSAIQPITNIRHIH 60
           +S E++L+   FY +SG      DEP N        ++K      I S  Q    I+ ++
Sbjct: 9   ISYEELLS---FYKESGADAALADEPINRFNQSPSSEQKLKQTCDIPSHQQTPPTIK-LN 64

Query: 61  SPLVQQADS---------IAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLM 111
           +P +   D+         +A+ A +L ELKS L +F  C L  T+ +T  +  T G  LM
Sbjct: 65  APPLNHPDTTQHALSAIEMAKNAKTLDELKSALLAFDGCSLKMTAKNTCFSDGTAGSPLM 124

Query: 112 IIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEM 171
           +IG  P   ++I G PF GK G +L+K+L SI + R  ++I+   PW PPGNR  +  EM
Sbjct: 125 LIGEAPGREEDIQGIPFVGKAGILLNKILASIGLTRENVYIANTVPWRPPGNRTPTAREM 184

Query: 172 EICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSI-IPTLA 230
            +CRP I RQI+L +P+IL+ +G     FF    +    +  GKW    T   + IP + 
Sbjct: 185 ALCRPFIERQIQLANPRILVALGGTAVQFFTGTQS-GIVRIRGKWLTYETEDKVKIPVMP 243

Query: 231 TVHPQELIQYPLIKKNTWHALITLKKALKNL 261
           T HP  L++ P  KK TW   + +K  L NL
Sbjct: 244 TFHPAYLLRTPSQKKLTWIDFLEVKNRLNNL 274


>gi|115526415|ref|YP_783326.1| phage SPO1 DNA polymerase-related protein [Rhodopseudomonas
           palustris BisA53]
 gi|115520362|gb|ABJ08346.1| phage SPO1 DNA polymerase-related protein [Rhodopseudomonas
           palustris BisA53]
          Length = 273

 Score =  142 bits (359), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 84/264 (31%), Positives = 129/264 (48%), Gaps = 28/264 (10%)

Query: 18  FYADSGVYWVF-DEPNNEATYESQRKEKSIDSAI--QPITNIRHIHSPL----------- 63
           FY ++GV     DEP N  T ES       DSA+  +P+        PL           
Sbjct: 15  FYLEAGVDCALADEPVNRLTDES-------DSALVARPVARALPAAMPLAPMLAPAQPLA 67

Query: 64  ------VQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTP 117
                 +  A   A+ A +L  L+ LL  F  C L ST+   + A       +M++G  P
Sbjct: 68  PAPDQAISSAREAARSAPTLEALRDLLERFDGCALKSTATRLVFADGNPQARIMLVGEAP 127

Query: 118 SDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPI 177
              ++I G PF G++G +LD ML +I + R+Q++I+ + PW PPGNR  +  E +IC P 
Sbjct: 128 GRDEDIEGLPFVGRSGKLLDLMLAAIGLDRSQVYIANVIPWRPPGNRTPTPQETQICLPF 187

Query: 178 IMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQEL 237
           I RQIEL+ P +L+ +GN +     +   +   +  G+W +  T    I  L T HP  L
Sbjct: 188 IKRQIELVDPDVLVTLGNPSTQAILST-REGIMRTRGRWIDYDTGRRSIRALPTFHPAYL 246

Query: 238 IQYPLIKKNTWHALITLKKALKNL 261
           ++ P  K+ +W  L  +  AL++L
Sbjct: 247 LRQPSYKRMSWQDLRAIATALESL 270


>gi|319405336|emb|CBI78954.1| phage SPO1 DNA polymerase-related protein [Bartonella sp. AR 15-3]
          Length = 273

 Score =  142 bits (358), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 96/272 (35%), Positives = 134/272 (49%), Gaps = 18/272 (6%)

Query: 4   KRILSQEQILTIALFYADSGVYWVF-----DEPNNEATYESQRKEKSIDSAIQPITNIRH 58
           K ++  E +L+   FY +SGV         D  N     E Q  +    S  Q I+    
Sbjct: 6   KDVILNEDLLS---FYKESGVDTALTDVPIDHFNQAIPLEPQLNQACDISYHQKISPTIK 62

Query: 59  IHSPLVQQAD---------SIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQD 109
            H+PL+   D          IA+ A +L ELKS L SF+ C L  T+ +T  +  T G  
Sbjct: 63  SHTPLLNNPDKTQPVLSAVEIAKNAQTLDELKSALLSFNGCLLKLTAQNTCFSDGTAGSP 122

Query: 110 LMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNI 169
           LM+IG  P   ++I G PF GK G +L+K+L SI + R  ++I+   PW PPGNR  +  
Sbjct: 123 LMLIGEAPGREEDIQGIPFVGKAGILLNKILASIGLTRQNVYIANTIPWRPPGNRTPTPR 182

Query: 170 EMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTL 229
           E+ +CRP I RQI L  P+IL+ +G+ T   FF        +  GKW         IP +
Sbjct: 183 EIALCRPFIERQILLAKPRILIALGS-TAVQFFTGIQSGIIRIRGKWLTYENEDLKIPVM 241

Query: 230 ATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
            T HP  L++ P  KK TW   + +K  L NL
Sbjct: 242 PTFHPAYLLRTPSQKKLTWIDFLEVKNRLNNL 273


>gi|85714248|ref|ZP_01045236.1| phage SPO1 DNA polymerase-related protein [Nitrobacter sp. Nb-311A]
 gi|85698695|gb|EAQ36564.1| phage SPO1 DNA polymerase-related protein [Nitrobacter sp. Nb-311A]
          Length = 281

 Score =  141 bits (356), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 85/281 (30%), Positives = 144/281 (51%), Gaps = 26/281 (9%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVF-DEP-NNEATYESQRKEKSIDSA--IQPITNI 56
           MTS +  +  ++L    FY ++GV     DEP +  +T +  R ++ + +A  I P+  +
Sbjct: 1   MTSDQATTVRELLA---FYLEAGVDCALGDEPIDRLSTPDLARSDRPVATAAGIVPVAAV 57

Query: 57  RH-------------IHSP---LVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTI 100
           R              +  P    ++ A   A+ A SL  L++LL SF  C L  T+   +
Sbjct: 58  RQPPRQTATAAPRAGVAPPPDIAIESAREAARTAPSLEALRTLLESFDGCALKFTASRLV 117

Query: 101 CATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHP 160
            A       LM +G  P   ++I+G PF G++G +L++M+ +I + R+ ++I+ + PW P
Sbjct: 118 FADGNPQARLMFVGEAPGRDEDIAGLPFVGRSGQLLNRMIAAIGLKRSDVYIANVIPWRP 177

Query: 161 PGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN-KTKNFFFNNDAQKTYQNLGKWSNL 219
           PGNR  +  E +IC P I RQIEL++P +L+ +GN  T+      +  K  +  GKW + 
Sbjct: 178 PGNRTPTPQETQICLPFIRRQIELVNPDVLVTLGNPSTQTLLQTREGIKRIR--GKWFDY 235

Query: 220 CTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
                 I  +AT HP  L++ P  K+  W  L  + +AL++
Sbjct: 236 DVGTRTIRAMATFHPAYLLRSPFDKRMAWLDLRAIARALED 276


>gi|304393614|ref|ZP_07375542.1| DNA polymerase [Ahrensia sp. R2A130]
 gi|303294621|gb|EFL88993.1| DNA polymerase [Ahrensia sp. R2A130]
          Length = 293

 Score =  141 bits (355), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 69/197 (35%), Positives = 106/197 (53%), Gaps = 3/197 (1%)

Query: 64  VQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNI 123
           V+QA  +A KA +L EL+  +R F  C+L   +   + A       +M+IG  P   ++ 
Sbjct: 95  VEQAKQLASKATTLDELRDAIRGFEGCNLRYQAKQMVFADGNPEASVMLIGEAPGRDEDA 154

Query: 124 SGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIE 183
            G PF GK+G +LD+ML +I + R  ++IS + PW P GNR  +  E+EICRP I R IE
Sbjct: 155 QGLPFVGKSGQLLDRMLAAIGLDRKSVYISNVIPWRPAGNRTPTPAEIEICRPFIERHIE 214

Query: 184 LISPKILLFIGNKT-KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPL 242
           L +PK+L+ +G  + K      D   + +  G+W ++       P L   HP  L++ P 
Sbjct: 215 LAAPKLLVLVGGSSAKAMLRTTDGITSVR--GRWKDVKIGEREWPALPMFHPAYLLRNPA 272

Query: 243 IKKNTWHALITLKKALK 259
            K+  W  L+ LK  L+
Sbjct: 273 QKRRAWQDLLMLKARLE 289


>gi|319403899|emb|CBI77485.1| phage SPO1 DNA polymerase-related protein [Bartonella rochalimae
           ATCC BAA-1498]
          Length = 273

 Score =  141 bits (355), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 98/278 (35%), Positives = 137/278 (49%), Gaps = 28/278 (10%)

Query: 3   SKRILSQEQILTIALFYADSGVYWVF-----DEPNNEATYESQRKE-------KSIDSAI 50
           +K ++S E +L+   FY +SGV         D  N  A+ E Q  +       K I   I
Sbjct: 5   NKDVISNEDLLS---FYKESGVDAALTDVPIDHFNQAASLEPQLNQAHDIPYYKKISPTI 61

Query: 51  QPITNIRHIHSP-------LVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICAT 103
           +      H  +P        V  A  IA+ A +L ELKS L SF+ C L  T+ +T  + 
Sbjct: 62  K-----SHTLAPDNPDKTQPVLSAVEIAKSAQTLDELKSALLSFNGCSLKLTAKNTCFSD 116

Query: 104 QTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGN 163
            T G  LM+IG  P   ++I G PF GK G +L+K+L SI + R  ++I+   PW PPGN
Sbjct: 117 GTAGSPLMLIGEAPGREEDIQGIPFVGKAGILLNKILASIGLSRQNVYIANTIPWRPPGN 176

Query: 164 RNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPH 223
           R  +  E+ +CRP I RQI L  P+IL+ +G+ T   FF        +  GKW       
Sbjct: 177 RTPTPREVTLCRPFIERQILLAKPRILIALGS-TAAQFFTGIQSGIIRIRGKWLTYENED 235

Query: 224 SIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
             IP + T HP  L++ P  KK TW   + +K  L NL
Sbjct: 236 LQIPVMPTFHPAYLLRTPSQKKLTWMDFLEVKNRLNNL 273


>gi|319898574|ref|YP_004158667.1| phage SPO1 DNA polymerase-related protein [Bartonella clarridgeiae
           73]
 gi|319402538|emb|CBI76081.1| phage SPO1 DNA polymerase-related protein [Bartonella clarridgeiae
           73]
          Length = 283

 Score =  140 bits (354), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 79/195 (40%), Positives = 108/195 (55%), Gaps = 1/195 (0%)

Query: 67  ADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGK 126
           A  IA+ A +L ELKS L SF+DC L  T+ +T  +  T G  LM+IG  P   ++I G 
Sbjct: 90  AIEIAKNAQTLDELKSALLSFNDCSLKLTAKNTCFSDGTAGSPLMLIGEAPGREEDIQGI 149

Query: 127 PFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELIS 186
           PF GK G +L+K+L SI + R  ++I+   PW PPGNR  +  E+ +CRP I RQI L  
Sbjct: 150 PFVGKAGILLNKILASIGLTRQNVYIANTIPWRPPGNRTPTPREVALCRPFIERQIFLAK 209

Query: 187 PKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKN 246
           P+IL+ +G  T   FF        +  GKW      +  IP + T HP  L++ P  KK 
Sbjct: 210 PRILIALGG-TATQFFTGVQSSIIRIRGKWLTYENENLKIPVMPTFHPAYLLRTPSQKKL 268

Query: 247 TWHALITLKKALKNL 261
           TW   + +K  L NL
Sbjct: 269 TWIDFLEVKNRLNNL 283


>gi|300024378|ref|YP_003756989.1| phage SPO1 DNA polymerase-related protein [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299526199|gb|ADJ24668.1| phage SPO1 DNA polymerase-related protein [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 275

 Score =  140 bits (354), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 70/192 (36%), Positives = 103/192 (53%), Gaps = 1/192 (0%)

Query: 67  ADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGK 126
           A  IA++A SL  L++ L+ F  C L +T+            DLMI+G  P   +++ GK
Sbjct: 85  ARRIAREAQSLEALEAALKGFDGCGLKATATKLCFYRGAPAADLMIVGEAPGRDEDLEGK 144

Query: 127 PFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELIS 186
           PF G+ G +LDKML +I +  + +HI+ I  W PPGNR  +  E   CRP + RQIEL++
Sbjct: 145 PFVGRAGRLLDKMLAAIGLSESDVHITNIVYWRPPGNRTPTPQEALACRPFLERQIELVA 204

Query: 187 PKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKN 246
           PKI++ +G       F   A+   +  GKW  L      I  LAT+HP  L++ P  K  
Sbjct: 205 PKIVVAVGGSAAKELFGV-AEGIMRLRGKWRELTVGDRKIQALATLHPAYLLRTPAAKNL 263

Query: 247 TWHALITLKKAL 258
            W  L+ ++  L
Sbjct: 264 AWLDLLQIRSKL 275


>gi|319406910|emb|CBI80545.1| phage SPO1 DNA polymerase-related protein [Bartonella sp. 1-1C]
          Length = 273

 Score =  140 bits (352), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 98/274 (35%), Positives = 138/274 (50%), Gaps = 20/274 (7%)

Query: 3   SKRILSQEQILTIALFYADSGVYWVF-----DEPNNEATYESQRKE-------KSIDSAI 50
           +K ++S E +L+   FY +SGV         D  N  A+ E Q  +       K I   I
Sbjct: 5   NKDVISNEDLLS---FYKESGVDAALTDVPIDHFNQAASLEPQLNQAHDIPYHKQISPTI 61

Query: 51  QPIT---NIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEG 107
           +  T   +      PL+  A  IA+ A +L ELKS L SF+ C L  T+ +T  +  T G
Sbjct: 62  KSHTLAPDNPDKTQPLLS-AVEIAKSAQTLDELKSALLSFNGCSLKLTAKNTCFSDGTAG 120

Query: 108 QDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLS 167
             LM+IG  P   ++I G PF GK G +L+K+L SI + R  ++I+   PW PPGNR  +
Sbjct: 121 SPLMLIGEAPGREEDIQGIPFVGKAGILLNKILASIGLSRQNVYIANTIPWRPPGNRTPT 180

Query: 168 NIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIP 227
             E+ +CRP I RQI L  P+IL+ +G+ T   FF        +  GKW         IP
Sbjct: 181 PREVALCRPFIERQILLAKPRILIALGS-TAAQFFTGIQSGIIRIRGKWLTYENEDLQIP 239

Query: 228 TLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
            + T HP  L++ P  KK TW   + +K  L NL
Sbjct: 240 VMPTFHPAYLLRTPSQKKLTWMDFLEVKNRLNNL 273


>gi|288962809|ref|YP_003453103.1| DNA polymerase bacteriophage-type [Azospirillum sp. B510]
 gi|288915075|dbj|BAI76559.1| DNA polymerase bacteriophage-type [Azospirillum sp. B510]
          Length = 285

 Score =  140 bits (352), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 64/196 (32%), Positives = 112/196 (57%), Gaps = 1/196 (0%)

Query: 66  QADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISG 125
           QA + A +A +L  L++ LRSF  C L +T+++T+ A       +M+IG  P + ++  G
Sbjct: 88  QARARAGEAGTLEALEAALRSFDGCPLKATAMNTVFADGNPQAPVMLIGEAPGEDEDRQG 147

Query: 126 KPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELI 185
           KPF G +G +LD+ML  I + R  ++IS I PW PPGNR+ +  E+  C P + R +EL+
Sbjct: 148 KPFVGVSGKLLDRMLAQIGLDRGTVYISNILPWRPPGNRSPTQAEVAACLPFLERHVELV 207

Query: 186 SPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKK 245
            PK+L+ +G  +     N  A+   +  G+W +     + IP +  +HP  L++ P+ K+
Sbjct: 208 RPKLLVALGGVSAKTLLNR-AEGITRLRGQWRSYEAAGTPIPLMPMLHPAYLLRNPIAKR 266

Query: 246 NTWHALITLKKALKNL 261
             W  ++ L++ +  +
Sbjct: 267 EAWRDMLALRQKIDEV 282


>gi|13476397|ref|NP_107967.1| hypothetical protein mll7705 [Mesorhizobium loti MAFF303099]
 gi|14027158|dbj|BAB54112.1| mll7705 [Mesorhizobium loti MAFF303099]
          Length = 291

 Score =  140 bits (352), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 88/294 (29%), Positives = 137/294 (46%), Gaps = 37/294 (12%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVF-DEPNNEATYESQRKEKSIDSAIQPITNIRHI 59
           MT+    S   I  I  FYA +GV     D P N     + R    ++ A  P+   R  
Sbjct: 1   MTAASPNSPTDIADILAFYASAGVDEALEDAPVNRFAEAAPR---PVERAPAPVAPPREE 57

Query: 60  HSPLVQQA----------------DSIAQ---------------KACSLHELKSLLRSFH 88
            +P    A                 S+A                 A +L EL+  + +F 
Sbjct: 58  KAPERPAAPPGLDASKVPDAPPARSSVAAVPDEAQAALARQLATTATTLDELRQHMAAFD 117

Query: 89  DCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRT 148
            C+L +T+ + + A       +M++G  P   ++I G PF G++G +LD+ML +I + RT
Sbjct: 118 GCNLKATAKNLVFADGNPDAAVMLVGEAPGRDEDIEGLPFVGRSGRLLDRMLAAIGLDRT 177

Query: 149 QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQK 208
            ++I+ + PW PPGNR  +  E EICRP I RQIEL++PK+L+ +G  +     N  ++ 
Sbjct: 178 SVYIANVIPWRPPGNRTPTPHETEICRPFIERQIELVNPKVLVNLGGPSAKTLLNT-SEG 236

Query: 209 TYQNLGKWSNLCTPHSI-IPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
             +  G W    T   I IP + T+HP  L++ P  KK  W   + +K  L+ L
Sbjct: 237 ILRLRGNWRVHTTASGIAIPAMPTLHPAYLLRTPAHKKLAWRDFLEVKAKLRAL 290


>gi|218462023|ref|ZP_03502114.1| probable DNA-directed DNA polymerase protein (uracil-DNA
           glycosylase) [Rhizobium etli Kim 5]
          Length = 155

 Score =  140 bits (352), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 62/152 (40%), Positives = 94/152 (61%), Gaps = 3/152 (1%)

Query: 111 MIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIE 170
           M+IG  PS  D+  G PFSGK+G + DKML +I + R+ + ++ + PW PPGNR  S  E
Sbjct: 1   MVIGSAPSAEDDREGLPFSGKSGQLFDKMLAAIGLDRSSVLLTQVIPWRPPGNRAASAAE 60

Query: 171 MEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNL-GKWSNLCTPHSIIPTL 229
           ++ICRP I RQI L  P+++L +GN    FFF  +   T   L G+W ++      IP +
Sbjct: 61  IDICRPFIERQIALAEPQVILLLGNFAARFFFGEN--DTIHGLRGRWKDIVIADRAIPAI 118

Query: 230 ATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
           A++HPQ+L+  P+ K+  W+ L+  +  LK+L
Sbjct: 119 ASLHPQDLLTAPVNKRLAWNDLLAFQAKLKSL 150


>gi|209886081|ref|YP_002289938.1| uracil-DNA glycosylase, family 4 [Oligotropha carboxidovorans OM5]
 gi|209874277|gb|ACI94073.1| uracil-DNA glycosylase, family 4 [Oligotropha carboxidovorans OM5]
          Length = 275

 Score =  139 bits (351), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 84/276 (30%), Positives = 135/276 (48%), Gaps = 25/276 (9%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVF-DEPNNEATYESQRKEKSIDSAIQPITNIRHI 59
           M S+R  +Q ++L    FY ++GV     +EP N  +      E   + A    T +R  
Sbjct: 4   MMSERPPTQHELLA---FYLEAGVDCALAEEPVNRLS------ETEAEPAPMRATPVRER 54

Query: 60  HSPL--------------VQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQT 105
            +PL              ++ A  +A +A +L EL+ LL  F  C L  T+   +     
Sbjct: 55  PAPLPVPRTDVAPAPDVAIESARELAPQAKTLDELRGLLEVFDGCALKMTATRLVFGDGN 114

Query: 106 EGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRN 165
               +M +G  P   +++ G PF G++G +LD ML SI + RT  +I+ + PW PPGNR 
Sbjct: 115 PQARVMFVGEAPGRDEDLQGIPFIGRSGKLLDLMLASIGLDRTSAYIANVIPWRPPGNRE 174

Query: 166 LSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSI 225
            S  E ++C P I RQIEL+ P +L+ +G  +             ++ G+W +  T   +
Sbjct: 175 PSPHETQMCLPFIRRQIELVDPDVLVCLGKPSSQAVLELK-DGIVKSRGRWFDYNTGTRM 233

Query: 226 IPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
           I  +AT HP  L++ P+ K+ TW  L  +++AL  L
Sbjct: 234 IRAMATFHPAYLLRQPIYKRMTWKDLRMIRRALAAL 269


>gi|312114358|ref|YP_004011954.1| phage SPO1 DNA polymerase-related protein [Rhodomicrobium vannielii
           ATCC 17100]
 gi|311219487|gb|ADP70855.1| phage SPO1 DNA polymerase-related protein [Rhodomicrobium vannielii
           ATCC 17100]
          Length = 289

 Score =  139 bits (351), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 71/199 (35%), Positives = 114/199 (57%), Gaps = 4/199 (2%)

Query: 64  VQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQ-TEGQDLMIIGYTPSDSDN 122
           V  A  +A+ A SL EL++LL SF  C L +T+ S +C ++ +    LM+IG  P   ++
Sbjct: 90  VMAARELARSAKSLEELRALLESFEGCGLKATA-SRLCLSRGSPSAPLMLIGEAPGKDED 148

Query: 123 ISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQI 182
             G+PF G+ G +LD+ML +I +     +I+ I  W PPGNR  S  E+ +C+P + RQI
Sbjct: 149 RLGQPFVGRAGQLLDRMLAAIGLTEADFYITNIVFWRPPGNRTPSPEEVLVCQPFVERQI 208

Query: 183 ELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPL 242
           EL++P+I++F+GN           +   +  GKW  L   H  +  +AT+HP  L++ P+
Sbjct: 209 ELLAPRIVVFLGNAAAR-QLTGATEGIMKLRGKWLELPG-HPGVRAMATLHPAYLLRTPI 266

Query: 243 IKKNTWHALITLKKALKNL 261
            K+  W  L+ ++ AL  L
Sbjct: 267 AKRLAWRDLLAVRAALDAL 285


>gi|182678993|ref|YP_001833139.1| phage SPO1 DNA polymerase-related protein [Beijerinckia indica
           subsp. indica ATCC 9039]
 gi|182634876|gb|ACB95650.1| phage SPO1 DNA polymerase-related protein [Beijerinckia indica
           subsp. indica ATCC 9039]
          Length = 290

 Score =  139 bits (350), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 68/198 (34%), Positives = 105/198 (53%), Gaps = 1/198 (0%)

Query: 63  LVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDN 122
           L Q A+  A  A +L EL+  L +F  C L +T+   + A       +MIIG  P   ++
Sbjct: 86  LSQNAEEAAASAKTLDELREKLDAFQGCGLKNTATQLVFADGNPNSSVMIIGEAPGADED 145

Query: 123 ISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQI 182
             G+PF G+ G +LD+ML ++++ RTQ++I+ I PW PPGNR  + +E+  C P I RQI
Sbjct: 146 RQGRPFVGRAGQLLDRMLAAVDLDRTQVYIANIVPWRPPGNRTPTPLEIAACLPFIRRQI 205

Query: 183 ELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPL 242
           EL+SP+ ++ +G  +           T    G+W +       I  L  +HP  L++ P 
Sbjct: 206 ELVSPRFIVCLGAPSAQTLLGTKEAITRLR-GRWRDWSCGGKTIHVLPMLHPAYLLRQPA 264

Query: 243 IKKNTWHALITLKKALKN 260
            KK  W     L KAL++
Sbjct: 265 EKKRAWADWRLLAKALRD 282


>gi|299134677|ref|ZP_07027869.1| phage SPO1 DNA polymerase-related protein [Afipia sp. 1NLS2]
 gi|298590487|gb|EFI50690.1| phage SPO1 DNA polymerase-related protein [Afipia sp. 1NLS2]
          Length = 271

 Score =  139 bits (350), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 80/269 (29%), Positives = 133/269 (49%), Gaps = 15/269 (5%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPIT------ 54
           M S+R  +  ++L    FY ++GV     E   +   E + +       I P+T      
Sbjct: 1   MISERPPTPHELLA---FYLEAGVDCALAEEPFDRLSEIEAEPAPAPRRIAPLTPAPALT 57

Query: 55  -----NIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQD 109
                ++       ++ A  +A KA +L EL+ LL +F  C L +T+   +         
Sbjct: 58  AAPQTDLAPAPDAAIESARELAPKAKTLEELRGLLEAFDGCALKATATKLVFGDGNPQAR 117

Query: 110 LMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNI 169
           +M +G  P   +++ G PF G++G +LD ML SI + RT+ +I+ + PW PPGNR+ S  
Sbjct: 118 VMFVGEAPGRDEDLQGIPFIGRSGKLLDLMLASIGLDRTKAYIANVIPWRPPGNRDPSPH 177

Query: 170 EMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTL 229
           E ++C P I RQIEL+ P I++ +G  +     +       +  G+W +  T    I  +
Sbjct: 178 ETQMCLPFIKRQIELVDPDIVVCLGKPSSQAVLDLK-DGIMRTRGRWFDYNTGTRTIRAM 236

Query: 230 ATVHPQELIQYPLIKKNTWHALITLKKAL 258
           AT HP  L++ P+ K+ TW  L T++ AL
Sbjct: 237 ATFHPAYLLRQPIYKRMTWKDLRTIQTAL 265


>gi|319408256|emb|CBI81909.1| phage SPO1 DNA polymerase-related protein [Bartonella
           schoenbuchensis R1]
          Length = 276

 Score =  138 bits (347), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 94/275 (34%), Positives = 146/275 (53%), Gaps = 26/275 (9%)

Query: 6   ILSQEQILTIALFYADSGVYWVF-DEPNNEATYES---QRKEKSID-----SAIQPIT-- 54
           ++S E++L+   FY +SGV     D P +  +  +   Q+ ++++D        QPI   
Sbjct: 8   LISYEELLS---FYKESGVDAALNDTPIDRFSQSAILEQKSKQAVDIIHHKQTSQPIKLH 64

Query: 55  -----NIRH-IHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQ 108
                N+ +  H  L   A  +A+ A +L ELKS L +F+ C L  T+ +T  +  T G 
Sbjct: 65  NKPPHNLDNKTHDTL--SAIEMAKNAHTLDELKSALLAFNGCSLKLTAKNTCFSDGTAGS 122

Query: 109 DLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSN 168
            LM+IG  P   ++I G PF GK G +L+K+L SI + R  ++I+   PW PPGNR  + 
Sbjct: 123 PLMLIGEAPGRDEDIQGIPFVGKAGMLLNKILASIGLTRKNVYIANTIPWRPPGNRTPTP 182

Query: 169 IEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNL-GKWSNLCTPHSI-I 226
            E+ +CRP I RQIEL +P++L+ +G     F     AQ     + GKW    + +++ I
Sbjct: 183 REVALCRPFIERQIELANPRVLIALGGTAAQFL--TGAQGGIIRIRGKWQIYESANNVKI 240

Query: 227 PTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
           P + T HP  L++ P  KK TW   + +K  L NL
Sbjct: 241 PVMPTFHPAYLLRTPSQKKLTWMDFLEVKDRLNNL 275


>gi|163759107|ref|ZP_02166193.1| phage SPO1 DNA polymerase-related protein [Hoeflea phototrophica
           DFL-43]
 gi|162283511|gb|EDQ33796.1| phage SPO1 DNA polymerase-related protein [Hoeflea phototrophica
           DFL-43]
          Length = 313

 Score =  137 bits (346), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 63/199 (31%), Positives = 112/199 (56%), Gaps = 1/199 (0%)

Query: 63  LVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDN 122
           + + A ++A+ A ++ EL++ L  F  C+L  ++ S + A      ++M IG  P   ++
Sbjct: 113 VFKDARALAESASTIDELRAALEGFGGCNLRHSAKSLVFADGNPEAEVMFIGEAPGREED 172

Query: 123 ISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQI 182
           + G PF G+ G +LD+ML +I + R   +I+ + PW PPGNR  +  E+E+CRP I R +
Sbjct: 173 LQGTPFVGRAGQLLDRMLAAIGLNRQTAYITNMIPWRPPGNRTPAPHEIELCRPFIERHV 232

Query: 183 ELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPL 242
            L +PKI++ +GN       N D +      G W    +  + IP + T+HP  L++ P 
Sbjct: 233 TLAAPKIVVMLGNVATKSLLNTD-KGILSLRGDWMEYTSGTTSIPAMPTLHPAYLLRNPA 291

Query: 243 IKKNTWHALITLKKALKNL 261
            K+  W  L++L++ L+++
Sbjct: 292 QKRLVWADLLSLQQRLEDM 310


>gi|328544965|ref|YP_004305074.1| Uracil-DNA glycosylase, family 4 [polymorphum gilvum SL003B-26A1]
 gi|326414707|gb|ADZ71770.1| Uracil-DNA glycosylase, family 4, putative [Polymorphum gilvum
           SL003B-26A1]
          Length = 300

 Score =  137 bits (345), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 109/196 (55%), Gaps = 3/196 (1%)

Query: 64  VQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNI 123
           V  A   A+ A +L  L++ L +F  C+L  T+ + +         +M++G  P   +++
Sbjct: 104 VVSAREAARSAETLEALRACLAAFKGCNLHLTAKNLVFDDGNPQARVMLVGEAPGRDEDL 163

Query: 124 SGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIE 183
            G PF G++G +LD+ML++I + R+Q++I+ + PW PPGNR  +  E EIC+P I RQIE
Sbjct: 164 QGLPFVGRSGQLLDRMLKAIGLDRSQVYIANVVPWRPPGNRTPTPQETEICKPFIARQIE 223

Query: 184 LISPKILLFIGNKTKNFFFN-NDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPL 242
           L  P IL+F+G  +        D  +  +  G+W    T    I  +AT HP  L++ PL
Sbjct: 224 LADPDILVFLGAASAKVLLGVQDGIRKMR--GRWMTYDTGRRQIRCIATFHPAYLLRSPL 281

Query: 243 IKKNTWHALITLKKAL 258
            K+  W   + L++AL
Sbjct: 282 EKRLAWRDFLALRQAL 297


>gi|298290634|ref|YP_003692573.1| phage SPO1 DNA polymerase-related protein [Starkeya novella DSM
           506]
 gi|296927145|gb|ADH87954.1| phage SPO1 DNA polymerase-related protein [Starkeya novella DSM
           506]
          Length = 295

 Score =  137 bits (344), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 67/186 (36%), Positives = 100/186 (53%), Gaps = 1/186 (0%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L  L++LL  F  C L  T+   + A       LM++G  P   ++I GKPF G++G +
Sbjct: 105 TLEALEALLEKFDGCPLKHTATRLVFADGNPQARLMLVGEAPGRDEDIEGKPFVGRSGKL 164

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           LD+ML +I I RT  +I+ + PW PPGNR  +  E  IC P I RQIEL +P +L+ +G 
Sbjct: 165 LDRMLAAIGIDRTTAYIANVVPWRPPGNRTPTPQETAICLPFICRQIELANPDVLVCLGG 224

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
            +           T    G+W +  T   +IP LAT HP  L++ PL K+  W  ++ ++
Sbjct: 225 PSAQTLLGIRDGITKAR-GRWMDYDTGSRVIPALATFHPAYLLRSPLGKRMAWRDMLAIE 283

Query: 256 KALKNL 261
             L  L
Sbjct: 284 ARLAGL 289


>gi|92118685|ref|YP_578414.1| phage SPO1 DNA polymerase-related protein [Nitrobacter hamburgensis
           X14]
 gi|91801579|gb|ABE63954.1| phage SPO1 DNA polymerase-related protein [Nitrobacter hamburgensis
           X14]
          Length = 289

 Score =  137 bits (344), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 67/198 (33%), Positives = 109/198 (55%), Gaps = 1/198 (0%)

Query: 64  VQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNI 123
           ++ A   A+ A SL  L++LL +F  C L  T+   + A       LM +G  P   ++I
Sbjct: 85  IESAREAARTAPSLEALRTLLDTFDGCALKFTASRLVFADGNPHARLMFVGEAPGRDEDI 144

Query: 124 SGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIE 183
            G PF G++G +L++M+ +I + R+ ++I+ + PW PPGNR  +  E +IC P I RQIE
Sbjct: 145 EGLPFVGRSGQLLNRMIAAIGLTRSDVYIANVIPWRPPGNRTPTPQETQICLPFIRRQIE 204

Query: 184 LISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLI 243
           L++P +L+ +GN +         +   +  GKW +  T    I  +AT HP  L++ P  
Sbjct: 205 LVNPDVLVTLGNPSTQTLLPTR-EGIMKTRGKWFDYDTDTRTIRAMATFHPAYLLRSPSS 263

Query: 244 KKNTWHALITLKKALKNL 261
           K+  W  L  + KALK++
Sbjct: 264 KRMAWLDLRAIAKALKDM 281


>gi|319784543|ref|YP_004144019.1| phage SPO1 DNA polymerase-related protein [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317170431|gb|ADV13969.1| phage SPO1 DNA polymerase-related protein [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 296

 Score =  136 bits (343), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 67/189 (35%), Positives = 107/189 (56%), Gaps = 2/189 (1%)

Query: 74  ACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTG 133
           A +L EL+  + +F  C+L +T+ + + A       +M++G  P   ++I G PF G++G
Sbjct: 108 ATTLDELRQHMAAFEGCNLKATAKNLVFADGNPEAAVMLVGEAPGRDEDIEGLPFVGRSG 167

Query: 134 NMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFI 193
            +LD+ML +I + RT  +I+ + PW PPGNR  +  E EICRP I RQIEL++PK+L+ +
Sbjct: 168 RLLDRMLAAIGLDRTSAYIANVIPWRPPGNRTPTPHETEICRPFIERQIELVNPKVLINL 227

Query: 194 GNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSI-IPTLATVHPQELIQYPLIKKNTWHALI 252
           G  +     N  ++   +  G W    T   I IP + T+HP  L++ P  KK  W   +
Sbjct: 228 GGPSAKTLLNT-SEGILRLRGNWRVHTTASGIAIPAMPTLHPAYLLRTPSHKKLAWRDFL 286

Query: 253 TLKKALKNL 261
            +K  L+ L
Sbjct: 287 EVKAKLRAL 295


>gi|307941594|ref|ZP_07656949.1| DNA polymerase [Roseibium sp. TrichSKD4]
 gi|307775202|gb|EFO34408.1| DNA polymerase [Roseibium sp. TrichSKD4]
          Length = 307

 Score =  136 bits (342), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 67/199 (33%), Positives = 110/199 (55%), Gaps = 3/199 (1%)

Query: 64  VQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNI 123
           +  A   A  A SL EL+ LL +F  C+L  T+ + + A       +M +G  P   ++I
Sbjct: 108 INSARERALTAQSLDELRELLGTFEGCNLRLTAKNLVFADGNPVAKVMFVGEAPGRDEDI 167

Query: 124 SGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIE 183
            GKPF G++G +LD+ML +I + R+  +I+ + PW PPGNR  +  E E+C+P I RQI 
Sbjct: 168 LGKPFVGRSGQLLDRMLTAIGLDRSSAYIANVVPWRPPGNRTPTPQETELCKPFIQRQIT 227

Query: 184 LISPKILLFIGNKTKNFFFNNDAQKTYQNL-GKWSNLCTPHSIIPTLATVHPQELIQYPL 242
           L +P +L+F+G  +       D +   + L G+W    +    IP +AT HP  L++ PL
Sbjct: 228 LANPDVLVFLGAASAKSLL--DVKDGIRRLRGQWKEYDSGSRKIPCVATYHPAYLLRSPL 285

Query: 243 IKKNTWHALITLKKALKNL 261
            K+ +W   + ++  L ++
Sbjct: 286 EKRLSWRDFLAIRAKLDDM 304


>gi|86748208|ref|YP_484704.1| phage SPO1 DNA polymerase-related protein [Rhodopseudomonas
           palustris HaA2]
 gi|86571236|gb|ABD05793.1| phage SPO1 DNA polymerase-related protein [Rhodopseudomonas
           palustris HaA2]
          Length = 277

 Score =  135 bits (341), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 83/273 (30%), Positives = 131/273 (47%), Gaps = 19/273 (6%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVF-DEPNNEATYESQRKEKSIDSAIQPITNIR-- 57
           MT +   S +Q+L    FY ++GV     DEP N    +        D+ +     IR  
Sbjct: 1   MTPEPAPSLKQLLA---FYLEAGVDCALTDEPINRMLDDETATPAIADAPVARADTIRPP 57

Query: 58  --------HIHSP----LVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQT 105
                    +  P     +  A   A  A +L  L++L+  F  C L ST+   + A   
Sbjct: 58  APRPTALPGVAPPSPEAAIVSAREAAATAPTLEALRALMEQFEGCALRSTATRLVFADGN 117

Query: 106 EGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRN 165
               LM++G  P   ++I G PF G++G +LD ML +I + R+Q++I+ + PW PPGNR 
Sbjct: 118 PQARLMLVGEAPGREEDIEGLPFVGRSGKLLDLMLAAIGLDRSQVYIANVIPWRPPGNRT 177

Query: 166 LSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSI 225
            +  E +IC P I RQIEL++P IL+ +GN +     +     T +  G+W +      +
Sbjct: 178 PTPQETQICLPFIKRQIELVNPAILVTLGNPSTQTLLSTRDGIT-RTRGRWFDYDNGTRM 236

Query: 226 IPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
           I  + T+HP  L++ P  K+  W  L  +  AL
Sbjct: 237 IRAMPTLHPAYLLRQPTYKRLAWQDLRAIATAL 269


>gi|17987604|ref|NP_540238.1| DNA polymerase [Brucella melitensis bv. 1 str. 16M]
 gi|23501507|ref|NP_697634.1| phage SPO1 DNA polymerase-like protein [Brucella suis 1330]
 gi|62289582|ref|YP_221375.1| phage SPO1 DNA polymerase-like protein [Brucella abortus bv. 1 str.
           9-941]
 gi|82699512|ref|YP_414086.1| uracil-DNA glycosylase [Brucella melitensis biovar Abortus 2308]
 gi|148560496|ref|YP_001258613.1| phage SPO1 DNA polymerase-like protein [Brucella ovis ATCC 25840]
 gi|161618595|ref|YP_001592482.1| uracil-DNA glycosylase [Brucella canis ATCC 23365]
 gi|163842895|ref|YP_001627299.1| uracil-DNA glycosylase [Brucella suis ATCC 23445]
 gi|189023841|ref|YP_001934609.1| DNA polymerase, bacteriophage-type [Brucella abortus S19]
 gi|225627127|ref|ZP_03785165.1| uracil-DNA glycosylase, family 4 [Brucella ceti str. Cudo]
 gi|225852145|ref|YP_002732378.1| uracil-DNA glycosylase [Brucella melitensis ATCC 23457]
 gi|237815079|ref|ZP_04594077.1| uracil-DNA glycosylase, family 4 [Brucella abortus str. 2308 A]
 gi|254688903|ref|ZP_05152157.1| uracil-DNA glycosylase, family 4 [Brucella abortus bv. 6 str. 870]
 gi|254693384|ref|ZP_05155212.1| uracil-DNA glycosylase, family 4 [Brucella abortus bv. 3 str.
           Tulya]
 gi|254697035|ref|ZP_05158863.1| uracil-DNA glycosylase, family 4 [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254701414|ref|ZP_05163242.1| uracil-DNA glycosylase, family 4 [Brucella suis bv. 5 str. 513]
 gi|254703959|ref|ZP_05165787.1| uracil-DNA glycosylase, family 4 [Brucella suis bv. 3 str. 686]
 gi|254707663|ref|ZP_05169491.1| uracil-DNA glycosylase, family 4 [Brucella pinnipedialis
           M163/99/10]
 gi|254709754|ref|ZP_05171565.1| uracil-DNA glycosylase, family 4 [Brucella pinnipedialis B2/94]
 gi|254713757|ref|ZP_05175568.1| uracil-DNA glycosylase, family 4 [Brucella ceti M644/93/1]
 gi|254717185|ref|ZP_05178996.1| uracil-DNA glycosylase, family 4 [Brucella ceti M13/05/1]
 gi|254729934|ref|ZP_05188512.1| uracil-DNA glycosylase, family 4 [Brucella abortus bv. 4 str. 292]
 gi|256031244|ref|ZP_05444858.1| uracil-DNA glycosylase, family 4 [Brucella pinnipedialis M292/94/1]
 gi|256044322|ref|ZP_05447226.1| uracil-DNA glycosylase, family 4 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256159355|ref|ZP_05457138.1| uracil-DNA glycosylase, family 4 [Brucella ceti M490/95/1]
 gi|256254652|ref|ZP_05460188.1| uracil-DNA glycosylase, family 4 [Brucella ceti B1/94]
 gi|256257151|ref|ZP_05462687.1| uracil-DNA glycosylase, family 4 [Brucella abortus bv. 9 str. C68]
 gi|256264343|ref|ZP_05466875.1| DNA polymerase [Brucella melitensis bv. 2 str. 63/9]
 gi|256369059|ref|YP_003106567.1| phage SPO1 DNA polymerase-related protein [Brucella microti CCM
           4915]
 gi|260168380|ref|ZP_05755191.1| phage SPO1 DNA polymerase-related protein [Brucella sp. F5/99]
 gi|260545657|ref|ZP_05821398.1| DNA polymerase [Brucella abortus NCTC 8038]
 gi|260563676|ref|ZP_05834162.1| DNA polymerase [Brucella melitensis bv. 1 str. 16M]
 gi|260566792|ref|ZP_05837262.1| DNA polymerase [Brucella suis bv. 4 str. 40]
 gi|260754388|ref|ZP_05866736.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260757607|ref|ZP_05869955.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260761433|ref|ZP_05873776.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260883413|ref|ZP_05895027.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|261213634|ref|ZP_05927915.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|261219001|ref|ZP_05933282.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261221827|ref|ZP_05936108.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|261315159|ref|ZP_05954356.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261317285|ref|ZP_05956482.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261321499|ref|ZP_05960696.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261751953|ref|ZP_05995662.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261754611|ref|ZP_05998320.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|261757840|ref|ZP_06001549.1| DNA polymerase [Brucella sp. F5/99]
 gi|265988323|ref|ZP_06100880.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|265990734|ref|ZP_06103291.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265997792|ref|ZP_06110349.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|294851989|ref|ZP_06792662.1| uracil-DNA glycosylase [Brucella sp. NVSL 07-0026]
 gi|297247997|ref|ZP_06931715.1| DNA polymerase bacteriophage-type [Brucella abortus bv. 5 str.
           B3196]
 gi|17983312|gb|AAL52502.1| DNA polymerase, bacteriophage-type [Brucella melitensis bv. 1 str.
           16M]
 gi|23347415|gb|AAN29549.1| phage SPO1 DNA polymerase-related protein [Brucella suis 1330]
 gi|62195714|gb|AAX74014.1| phage SPO1 DNA polymerase-related protein [Brucella abortus bv. 1
           str. 9-941]
 gi|82615613|emb|CAJ10600.1| ATP/GTP-binding site motif A (P-loop):Uracil-DNA glycosylase
           superfamily:Phage SPO1 DNA polymerase-related protein
           [Brucella melitensis biovar Abortus 2308]
 gi|148371753|gb|ABQ61732.1| phage SPO1 DNA polymerase-related protein [Brucella ovis ATCC
           25840]
 gi|161335406|gb|ABX61711.1| uracil-DNA glycosylase, family 4 [Brucella canis ATCC 23365]
 gi|163673618|gb|ABY37729.1| uracil-DNA glycosylase, family 4 [Brucella suis ATCC 23445]
 gi|189019413|gb|ACD72135.1| DNA polymerase, bacteriophage-type [Brucella abortus S19]
 gi|225617962|gb|EEH15006.1| uracil-DNA glycosylase, family 4 [Brucella ceti str. Cudo]
 gi|225640510|gb|ACO00424.1| uracil-DNA glycosylase, family 4 [Brucella melitensis ATCC 23457]
 gi|237789916|gb|EEP64126.1| uracil-DNA glycosylase, family 4 [Brucella abortus str. 2308 A]
 gi|255999219|gb|ACU47618.1| phage SPO1 DNA polymerase-related protein [Brucella microti CCM
           4915]
 gi|260097064|gb|EEW80939.1| DNA polymerase [Brucella abortus NCTC 8038]
 gi|260153692|gb|EEW88784.1| DNA polymerase [Brucella melitensis bv. 1 str. 16M]
 gi|260156310|gb|EEW91390.1| DNA polymerase [Brucella suis bv. 4 str. 40]
 gi|260667925|gb|EEX54865.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260671865|gb|EEX58686.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260674496|gb|EEX61317.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260872941|gb|EEX80010.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|260915241|gb|EEX82102.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|260920411|gb|EEX87064.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|260924090|gb|EEX90658.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261294189|gb|EEX97685.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261296508|gb|EEY00005.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261304185|gb|EEY07682.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261737824|gb|EEY25820.1| DNA polymerase [Brucella sp. F5/99]
 gi|261741706|gb|EEY29632.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261744364|gb|EEY32290.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|262552260|gb|EEZ08250.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|263001518|gb|EEZ14093.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263094617|gb|EEZ18415.1| DNA polymerase [Brucella melitensis bv. 2 str. 63/9]
 gi|264660520|gb|EEZ30781.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|294820578|gb|EFG37577.1| uracil-DNA glycosylase [Brucella sp. NVSL 07-0026]
 gi|297175166|gb|EFH34513.1| DNA polymerase bacteriophage-type [Brucella abortus bv. 5 str.
           B3196]
 gi|326408646|gb|ADZ65711.1| DNA polymerase, bacteriophage-type [Brucella melitensis M28]
 gi|326538367|gb|ADZ86582.1| uracil-DNA glycosylase, family 4 [Brucella melitensis M5-90]
          Length = 290

 Score =  135 bits (339), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 107/196 (54%), Gaps = 2/196 (1%)

Query: 67  ADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGK 126
           A   A +A +L EL+  L +F  C+L  T+ +   A      D+M IG  P   +++ G 
Sbjct: 94  AREAASQAETLEELREKLAAFDGCNLKFTAKNLCFADGDPSSDIMFIGEAPGRDEDMEGL 153

Query: 127 PFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELIS 186
           PF GK+G +L++M+++I + R +++I+   PW PPGNR  + +E E+CRP I RQIEL +
Sbjct: 154 PFVGKSGQLLNRMIEAIGLKREEVYIANTIPWRPPGNRAPTPLETELCRPFIERQIELAA 213

Query: 187 PKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSI-IPTLATVHPQELIQYPLIKK 245
           PK+L+ +G           A+   +  G W    TP  + IP + T+HP  L++ P  K+
Sbjct: 214 PKVLVALGGPAGK-ALTGAAEGILRLRGNWKIHRTPTGMEIPVMPTLHPAYLLRTPAQKR 272

Query: 246 NTWHALITLKKALKNL 261
             W   + +K  L  L
Sbjct: 273 FAWRDFLAVKLKLAEL 288


>gi|256060754|ref|ZP_05450917.1| uracil-DNA glycosylase, family 4 [Brucella neotomae 5K33]
 gi|261324742|ref|ZP_05963939.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261300722|gb|EEY04219.1| conserved hypothetical protein [Brucella neotomae 5K33]
          Length = 290

 Score =  135 bits (339), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 107/196 (54%), Gaps = 2/196 (1%)

Query: 67  ADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGK 126
           A   A +A +L EL+  L +F  C+L  T+ +   A      D+M IG  P   +++ G 
Sbjct: 94  AREAASQAETLEELREKLAAFDGCNLKFTAKNLCFADGDPSSDIMFIGEAPGRDEDMEGL 153

Query: 127 PFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELIS 186
           PF GK+G +L++M+++I + R +++I+   PW PPGNR  + +E E+CRP I RQIEL +
Sbjct: 154 PFVGKSGQLLNRMIEAIGLKREEVYIANTIPWRPPGNRAPTPLETELCRPFIERQIELAA 213

Query: 187 PKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSI-IPTLATVHPQELIQYPLIKK 245
           PK+L+ +G           A+   +  G W    TP  + IP + T+HP  L++ P  K+
Sbjct: 214 PKVLVALGGPAGK-ALTGAAEGILRLRGNWKIHRTPTGMEIPVMPTLHPAYLLRTPAQKR 272

Query: 246 NTWHALITLKKALKNL 261
             W   + +K  L  L
Sbjct: 273 FAWRDFLAVKLKLAEL 288


>gi|306845226|ref|ZP_07477802.1| uracil-DNA glycosylase, family 4 [Brucella sp. BO1]
 gi|306274385|gb|EFM56192.1| uracil-DNA glycosylase, family 4 [Brucella sp. BO1]
          Length = 290

 Score =  135 bits (339), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 107/196 (54%), Gaps = 2/196 (1%)

Query: 67  ADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGK 126
           A   A +A +L EL+  L +F  C+L  T+ +   A      D+M IG  P   +++ G 
Sbjct: 94  AREAASQAETLEELREKLAAFDGCNLKFTAKNLCFADGDPSSDIMFIGEAPGRDEDMEGL 153

Query: 127 PFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELIS 186
           PF GK+G +L++M+++I + R +++I+   PW PPGNR  + +E E+CRP I RQIEL +
Sbjct: 154 PFVGKSGQLLNRMIEAIGLKREEVYIANTIPWRPPGNRAPTPLETELCRPFIERQIELAA 213

Query: 187 PKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSI-IPTLATVHPQELIQYPLIKK 245
           PK+L+ +G           A+   +  G W    TP  + IP + T+HP  L++ P  K+
Sbjct: 214 PKVLVALGGPAGK-ALTGTAEGILRLRGNWKIHRTPTGMEIPVMPTLHPAYLLRTPAQKR 272

Query: 246 NTWHALITLKKALKNL 261
             W   + +K  L  L
Sbjct: 273 FAWRDFLAVKLKLAEL 288


>gi|306842110|ref|ZP_07474780.1| uracil-DNA glycosylase, family 4 [Brucella sp. BO2]
 gi|306287783|gb|EFM59211.1| uracil-DNA glycosylase, family 4 [Brucella sp. BO2]
          Length = 290

 Score =  135 bits (339), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 107/196 (54%), Gaps = 2/196 (1%)

Query: 67  ADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGK 126
           A   A +A +L EL+  L +F  C+L  T+ +   A      D+M IG  P   +++ G 
Sbjct: 94  AREAASQAETLEELREKLAAFDGCNLKFTAKNLCFADGDPSSDIMFIGEAPGRDEDMEGL 153

Query: 127 PFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELIS 186
           PF GK+G +L++M+++I + R +++I+   PW PPGNR  + +E E+CRP I RQIEL +
Sbjct: 154 PFVGKSGQLLNRMIEAIGLKREEVYIANTIPWRPPGNRAPTPLETELCRPFIERQIELAA 213

Query: 187 PKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSI-IPTLATVHPQELIQYPLIKK 245
           PK+L+ +G           A+   +  G W    TP  + IP + T+HP  L++ P  K+
Sbjct: 214 PKVLVALGGPAGK-ALTGAAEGILRLRGNWKIHRTPTGMEIPVMPTLHPAYLLRTPAQKR 272

Query: 246 NTWHALITLKKALKNL 261
             W   + +K  L  L
Sbjct: 273 FAWRDFLAVKLKLAEL 288


>gi|254718769|ref|ZP_05180580.1| uracil-DNA glycosylase, family 4 [Brucella sp. 83/13]
 gi|265983747|ref|ZP_06096482.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|306840191|ref|ZP_07472971.1| uracil-DNA glycosylase, family 4 [Brucella sp. NF 2653]
 gi|264662339|gb|EEZ32600.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|306404722|gb|EFM61021.1| uracil-DNA glycosylase, family 4 [Brucella sp. NF 2653]
          Length = 290

 Score =  135 bits (339), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 107/196 (54%), Gaps = 2/196 (1%)

Query: 67  ADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGK 126
           A   A +A +L EL+  L +F  C+L  T+ +   A      D+M IG  P   +++ G 
Sbjct: 94  AREAASQAETLEELREKLAAFDGCNLKFTAKNLCFADGDPSSDIMFIGEAPGRDEDMEGL 153

Query: 127 PFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELIS 186
           PF GK+G +L++M+++I + R +++I+   PW PPGNR  + +E E+CRP I RQIEL +
Sbjct: 154 PFVGKSGQLLNRMIEAIGLKREEVYIANTIPWRPPGNRAPTPLETELCRPFIERQIELAA 213

Query: 187 PKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSI-IPTLATVHPQELIQYPLIKK 245
           PK+L+ +G           A+   +  G W    TP  + IP + T+HP  L++ P  K+
Sbjct: 214 PKVLVALGGPAGK-ALTGAAEGILRLRGNWKIHRTPTGMEIPVMPTLHPAYLLRTPAQKR 272

Query: 246 NTWHALITLKKALKNL 261
             W   + +K  L  L
Sbjct: 273 FAWRDFLAVKLKLAEL 288


>gi|75676780|ref|YP_319201.1| phage SPO1 DNA polymerase-related protein [Nitrobacter winogradskyi
           Nb-255]
 gi|74421650|gb|ABA05849.1| phage SPO1 DNA polymerase-related protein [Nitrobacter winogradskyi
           Nb-255]
          Length = 301

 Score =  135 bits (339), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 102/187 (54%), Gaps = 1/187 (0%)

Query: 74  ACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTG 133
           A SL  L++LL  F  C L  T+   + A       LM +G  P   ++I G PF G++G
Sbjct: 105 APSLEALRALLEGFEGCALKFTASRLVFADGNPQARLMFVGEAPGRDEDIEGLPFVGRSG 164

Query: 134 NMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFI 193
            +L++M+ +I + R  ++I+ + PW PPGNR  +  E +IC P I RQIEL++P +L+ +
Sbjct: 165 QLLNRMIAAIGLKRGDVYIANVIPWRPPGNRTPTPQETQICLPFIRRQIELVNPDVLVTL 224

Query: 194 GNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALIT 253
           GN +         +   +  G+W +  T    I  +AT HP  L++ P  K+  WH L  
Sbjct: 225 GNPSTQTLLQTR-EGIMKTRGRWFDYDTGARTIRAMATFHPAYLLRSPSYKRMAWHDLRA 283

Query: 254 LKKALKN 260
           + KAL++
Sbjct: 284 IAKALED 290


>gi|49475280|ref|YP_033321.1| DNA polymerase [Bartonella henselae str. Houston-1]
 gi|49238086|emb|CAF27293.1| DNA polymerase, bacteriophage type [Bartonella henselae str.
           Houston-1]
          Length = 275

 Score =  134 bits (338), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 91/272 (33%), Positives = 137/272 (50%), Gaps = 23/272 (8%)

Query: 7   LSQEQILTIALFYADSGVYWVF-----DEPNNEATYE-----------SQRKEKSIDSAI 50
           ++ E++L+   FY +SGV         D  +  A+ E           +Q+   SI    
Sbjct: 9   ITYEELLS---FYKESGVDTALTDLPIDRFSQSASLEKKSTQVVKISHNQQTSPSIKLDN 65

Query: 51  QPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDL 110
            P++N   I   L   A   A+ A +L ELKS L +F+ C L  T+ +T  +  T G  L
Sbjct: 66  HPLSNSTIIQGEL--SAIESAKNANTLDELKSALLAFNGCSLKLTAKNTCFSDGTAGSPL 123

Query: 111 MIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIE 170
           M+IG  P   ++I G PF GK G +L+K+L SI + R  ++I+   PW PPGNR  +  E
Sbjct: 124 MLIGEAPGREEDIQGIPFVGKAGMLLNKILASIGLTRNSVYIANTIPWRPPGNRTPTPRE 183

Query: 171 MEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSI-IPTL 229
           + +CRP I RQI L +P+IL+ +G      F         +  GKW    + ++I IP +
Sbjct: 184 VALCRPFIERQIYLANPRILIALGGVATQ-FLTGAQNGIIRTRGKWLTYKSENNIKIPVM 242

Query: 230 ATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
            T HP  L++ P  KK TW   + +K  L +L
Sbjct: 243 PTFHPAYLLRTPSQKKLTWLDFLEVKNRLDSL 274


>gi|190571317|ref|YP_001975675.1| putative DNA glycosylase [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|190357589|emb|CAQ55030.1| putative DNA glycosylase [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
          Length = 257

 Score =  134 bits (338), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 80/252 (31%), Positives = 136/252 (53%), Gaps = 11/252 (4%)

Query: 13  LTIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQ 72
           L +  FY + GV     E   E   E++R  +S  S I+    +    S  + +A  +A 
Sbjct: 6   LELLKFYHEVGVDCTLTEGEEEKKVENERAAQS--SVIEQKKAM--FPSDWIIEARKLAS 61

Query: 73  KACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKT 132
           +  S+ EL+S ++SF  C +  T+ +T+ +       +M++G  P  ++++ G PF G +
Sbjct: 62  ECGSVDELRSAVKSFEGCEIKKTATNTVFSDGNPNAKIMLVGEAPGANEDLKGIPFCGAS 121

Query: 133 GNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLF 192
           G +LDKML +I + RT+++IS    W PPGNR  +++E+++CRP + + I L+ P+IL+F
Sbjct: 122 GMLLDKMLGAINLDRTKVYISNTVFWRPPGNRKPTDLELDMCRPFVEKHIALVLPQILIF 181

Query: 193 IGNKTKNFFFNNDAQKTYQNL-GK---WSNLCTPHSIIPTLATVHPQELIQYPLIKKNTW 248
           +G        +N   KT  NL GK   ++N    H+I  T A  HP  L++ P  K+  W
Sbjct: 182 VGGIACYSLLDN--TKTISNLRGKFHTYTNQYLSHAIT-TAAIFHPAYLLRQPAQKRLAW 238

Query: 249 HALITLKKALKN 260
             L  +++ L N
Sbjct: 239 EDLKKIREYLDN 250


>gi|163796468|ref|ZP_02190428.1| Phage SPO1 DNA polymerase-related protein [alpha proteobacterium
           BAL199]
 gi|159178318|gb|EDP62862.1| Phage SPO1 DNA polymerase-related protein [alpha proteobacterium
           BAL199]
          Length = 285

 Score =  134 bits (338), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 82/266 (30%), Positives = 137/266 (51%), Gaps = 31/266 (11%)

Query: 18  FYADSGVYWVFDEPNNE------ATYESQRKEKSIDSAIQPITNIRHIHSPLVQ------ 65
           +Y D+GV    DEP  +      A+     +  ++ +A +P+  +     P  +      
Sbjct: 14  WYVDAGV----DEPMGDIAVDRFASVRPPPQIPTVAAAAKPVATVAQQAEPQARPTRPAR 69

Query: 66  ---------QADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYT 116
                     A S A  A +L EL+ +L++F  C L  T+ +T+ A    G  +M++G  
Sbjct: 70  AAPVDGSLGAARSAAFSAKTLEELRGILQAFDGCPLKVTATNTVFADGVPGAPVMVVGEA 129

Query: 117 PSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICR 175
           P   ++ +G+PF G +G +LD+ML +I + R + ++IS + PW PPGNRN ++ EM +C 
Sbjct: 130 PGADEDRAGRPFVGLSGQLLDRMLATIGLDRQRNVYISNVLPWRPPGNRNPTDNEMAMCL 189

Query: 176 PIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNL-GKWSNLCTPH--SIIPTLATV 232
           P I R IEL +P++L+ +G  +       D Q+    L G+W +   P   + +P LAT 
Sbjct: 190 PFIQRHIELAAPRVLVLVGGTSVKTLL--DRQEGITRLRGRWFDWQGPSAAAAVPALATY 247

Query: 233 HPQELIQYPLIKKNTWHALITLKKAL 258
           HP  L++ P  K + W  L+ LK+ L
Sbjct: 248 HPAYLLRSPGQKASAWKDLLALKRWL 273


>gi|90425831|ref|YP_534201.1| phage SPO1 DNA polymerase-related protein [Rhodopseudomonas
           palustris BisB18]
 gi|90107845|gb|ABD89882.1| phage SPO1 DNA polymerase-related protein [Rhodopseudomonas
           palustris BisB18]
          Length = 277

 Score =  134 bits (338), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 66/195 (33%), Positives = 104/195 (53%), Gaps = 1/195 (0%)

Query: 67  ADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGK 126
           A   A+ A SL  L+ LL +F  C L +T+   + A       +M++G  P   ++I G 
Sbjct: 80  AREAARTAPSLQALRELLAAFDGCALKATATQLVFADGNPQARIMLVGEAPGREEDIEGL 139

Query: 127 PFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELIS 186
           PF G++G +LD+ML SI + R+ ++I+ + PW PPGNR  +  E + C P   RQIEL+ 
Sbjct: 140 PFVGRSGKLLDRMLASIGLDRSTVYIANVIPWRPPGNRTPTPQETQTCLPFTQRQIELVD 199

Query: 187 PKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKN 246
           P +L+ +GN +         +   +  G+W +  T    I  L T HP  L++ P  K+ 
Sbjct: 200 PDLLVTLGNPSTQTLLAT-REGIMKTRGRWVDYDTGSRRIRALPTFHPAYLLRSPSYKRM 258

Query: 247 TWHALITLKKALKNL 261
            W  L  + KAL++L
Sbjct: 259 AWQDLRAIAKALEDL 273


>gi|163867968|ref|YP_001609172.1| phage SPO1 DNA polymerase-related protein [Bartonella tribocorum
           CIP 105476]
 gi|161017619|emb|CAK01177.1| phage SPO1 DNA polymerase-related protein [Bartonella tribocorum
           CIP 105476]
          Length = 279

 Score =  134 bits (337), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 91/276 (32%), Positives = 139/276 (50%), Gaps = 27/276 (9%)

Query: 7   LSQEQILTIALFYADSGVYWVF-DEPNN--EATYESQRKEKSIDSAI------------- 50
           +S E++L+   FY +SG   V  D P +  + ++ S++K   + S               
Sbjct: 9   ISYEELLS---FYKESGADAVLADLPIDRFKQSFSSEKKSTPVVSVSHHQQRSPTTSPTV 65

Query: 51  ----QPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTE 106
               QP+ N R I +     A   A+ A +L ELKS L +F+ C L  T+ +T  +  T 
Sbjct: 66  KLDHQPLHNSRAIQNE--PAAIESAKSAKTLDELKSALLAFNGCSLKLTAKNTCFSDGTA 123

Query: 107 GQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNL 166
           G  LM+IG  P   ++I G PF GK G +L+K+L SI + R  ++I+   PW PPGNR  
Sbjct: 124 GSPLMLIGEAPGREEDIQGVPFVGKAGMLLNKILASIGLTRNNVYIANTIPWRPPGNRTP 183

Query: 167 SNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSI- 225
           +  E+ +CRP I R I L  P++L+ +G     F   + +    +  GKW    +  +I 
Sbjct: 184 TPREIALCRPFIERHIYLARPRVLIALGGVAAQFLTGSQS-GIIRTRGKWHIYESEDNIK 242

Query: 226 IPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
           IP + T HP  L++ P  KK TW   + +K  L NL
Sbjct: 243 IPVMPTFHPAYLLRTPSQKKLTWIDFLEVKNRLDNL 278


>gi|91975690|ref|YP_568349.1| phage SPO1 DNA polymerase-related protein [Rhodopseudomonas
           palustris BisB5]
 gi|91682146|gb|ABE38448.1| phage SPO1 DNA polymerase-related protein [Rhodopseudomonas
           palustris BisB5]
          Length = 282

 Score =  134 bits (336), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 89/282 (31%), Positives = 137/282 (48%), Gaps = 26/282 (9%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVF-DEPNN----EATYESQRKEKSIDSAIQPITN 55
           MT +   S +Q+L    FY ++GV     DEP N    +A     + E S ++A +P T 
Sbjct: 1   MTPEPAPSLQQLLA---FYLEAGVDCALNDEPINRLLDDAIAVPIQAETS-EAAPRPDTE 56

Query: 56  -IRHIHS-PLVQQADSI--------------AQKACSLHELKSLLRSFHDCHLCSTSLST 99
            IR +   P  Q A +I              A  A SL  L++L+  F  C L ST+   
Sbjct: 57  KIRSLAPRPRAQPAGAIPPLPEAAIVSAREAAATAPSLDALRALMEQFDGCALRSTATRL 116

Query: 100 ICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWH 159
           + A       +M++G  P   ++I G PF G++G +LD ML +I + R++++I+ + PW 
Sbjct: 117 VFADGNPKASIMLVGEAPGREEDIEGLPFVGRSGKLLDLMLAAIGLDRSKVYIANVIPWR 176

Query: 160 PPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNL 219
           PPGNR  +  E +IC P I RQIEL+ P IL+ +GN +     +       +  G+W + 
Sbjct: 177 PPGNRTPTPQETQICLPFIRRQIELVDPAILVTLGNPSTQALLSTR-DGIMRTRGRWFDY 235

Query: 220 CTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
                 I  L T+HP  L++ P  K+  W  L  +  A   L
Sbjct: 236 HNGARTIRALPTLHPAYLLRQPTYKRLAWQDLRAIATAFAAL 277


>gi|146339065|ref|YP_001204113.1| putative DNA polymerases [Bradyrhizobium sp. ORS278]
 gi|146191871|emb|CAL75876.1| putative DNA polymerases [Bradyrhizobium sp. ORS278]
          Length = 273

 Score =  134 bits (336), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 63/188 (33%), Positives = 102/188 (54%), Gaps = 1/188 (0%)

Query: 71  AQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSG 130
           A+ A +L  L+ LL +F  C L  T+   + A       +M++G  P   ++I G PF G
Sbjct: 85  ARTAPTLQALRELLETFDGCALKQTASRLVFADGNPEARVMLVGEAPGRDEDIEGLPFVG 144

Query: 131 KTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKIL 190
           ++G +LD+M+ +I + RT+++I+ + PW PPGNR  +  E +IC P I RQIEL+ P +L
Sbjct: 145 RSGKLLDRMIGAIGLDRTKVYIANVIPWRPPGNRTPTPQETQICLPFIRRQIELVDPDVL 204

Query: 191 LFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHA 250
           + +GN +         +   +  GKW +  T    I  +AT HP  L++ P  K+ +W  
Sbjct: 205 VTLGNPSTQALLGT-TEGIMRTRGKWRDYDTGKRTIRAIATFHPAYLLRSPSYKRLSWQD 263

Query: 251 LITLKKAL 258
           L  +   L
Sbjct: 264 LRAIATVL 271


>gi|153009985|ref|YP_001371200.1| phage SPO1 DNA polymerase-like protein [Ochrobactrum anthropi ATCC
           49188]
 gi|151561873|gb|ABS15371.1| phage SPO1 DNA polymerase-related protein [Ochrobactrum anthropi
           ATCC 49188]
          Length = 285

 Score =  133 bits (334), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 81/269 (30%), Positives = 125/269 (46%), Gaps = 26/269 (9%)

Query: 18  FYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQP------------ITNIRHIHSPLVQ 65
           FYA++G+     E   +   E QR   S  +A  P                    S  VQ
Sbjct: 16  FYAEAGIDMPLSETPIDRFAEPQRPASSQPTAQMPNSPERARQQQPRPAPAPAPTSKPVQ 75

Query: 66  QADSIAQKA------------CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMII 113
            A  +   A             +L EL+  L +F  C+L  T+ +   A      D+M I
Sbjct: 76  AAADLPDTAQIALAREAAAQASTLEELREKLAAFDGCNLKFTAKNLCFADGDPSSDIMFI 135

Query: 114 GYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEI 173
           G  P   +++ G PF GK+G +L++M++SI++ R  ++I+   PW PPGNR  + +E E+
Sbjct: 136 GQAPGRDEDMEGLPFVGKSGQLLNRMIESIDLKRESVYIANTIPWRPPGNRTPTPLETEL 195

Query: 174 CRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSI-IPTLATV 232
           CRP I RQIEL SPK+L+ +G            +   +  G W    TP+ + IP + T+
Sbjct: 196 CRPFIERQIELASPKVLVALGGPAGK-ALTGATEGILRLRGNWKIHRTPNGLEIPVMPTL 254

Query: 233 HPQELIQYPLIKKNTWHALITLKKALKNL 261
           HP  L++ P  K+  W   + +K  L  L
Sbjct: 255 HPAYLLRTPAQKRFAWRDFLAVKLKLAEL 283


>gi|90420838|ref|ZP_01228743.1| uracil-DNA glycosylase, phage SPO1 DNA polymerase-related protein
           [Aurantimonas manganoxydans SI85-9A1]
 gi|90334813|gb|EAS48585.1| uracil-DNA glycosylase, phage SPO1 DNA polymerase-related protein
           [Aurantimonas manganoxydans SI85-9A1]
          Length = 306

 Score =  132 bits (333), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 70/234 (29%), Positives = 117/234 (50%), Gaps = 10/234 (4%)

Query: 31  PNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDC 90
           P  EA     R  +  +    P   I       V  A   A+ A +L EL++ L  F  C
Sbjct: 70  PAQEARVAPARTPQPAEEPGFPAPRIAVPDDIAVADARERARSATTLAELRAALDDFDGC 129

Query: 91  HLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQI 150
           +L  ++ ST+    +E  D+M++G  P   ++ +G PF G++G +L++ML+SI + R  +
Sbjct: 130 NLRISARSTVFGDGSETADVMLVGEAPGREEDTAGVPFVGRSGQLLNRMLESIGLEREAV 189

Query: 151 HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTY 210
            ++   PW PPGNR  +  E +IC P + R IEL++PKIL+ +G+ +         +   
Sbjct: 190 RVTNTVPWRPPGNRPPTPAETQICLPFVQRHIELVAPKILVCLGSPSAKAILGAQ-EGIL 248

Query: 211 QNLGKWSNL------CTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
           +  G+W+        C     I  +A +HP  L++ P  K+  W  LI L++ L
Sbjct: 249 RVRGRWTTYSFGLEQC---DAIDAVAMLHPAYLLRQPAQKRLAWRDLIALRERL 299


>gi|118590804|ref|ZP_01548205.1| hypothetical protein SIAM614_06538 [Stappia aggregata IAM 12614]
 gi|118436780|gb|EAV43420.1| hypothetical protein SIAM614_06538 [Stappia aggregata IAM 12614]
          Length = 320

 Score =  132 bits (332), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 63/184 (34%), Positives = 104/184 (56%), Gaps = 3/184 (1%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L EL++ L +F  C+L  T+   + A       LM +G  P   +++ G PF G++G +
Sbjct: 133 TLDELRNCLSAFEGCNLKLTAKKLVFADGNPEAKLMFVGEAPGRDEDLQGLPFVGRSGQL 192

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           LD+ML +I + R+  +I+ + PW PPGNR  +  E EIC+P I+RQIEL++P +L+F+G 
Sbjct: 193 LDRMLAAIGLDRSSAYIANVVPWRPPGNRTPTPQETEICKPFILRQIELVNPDVLVFLGA 252

Query: 196 KT-KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITL 254
            + K      D  +  +  G+W         I  +AT HP  L++ PL K+ +W   + +
Sbjct: 253 ASAKTLLGVQDGIRKMR--GRWMTYPCKGREISAIATYHPAYLLRSPLEKRLSWRDFLAI 310

Query: 255 KKAL 258
           K+ L
Sbjct: 311 KQKL 314


>gi|148253838|ref|YP_001238423.1| putative DNA polymerase [Bradyrhizobium sp. BTAi1]
 gi|146406011|gb|ABQ34517.1| putative DNA polymerase [Bradyrhizobium sp. BTAi1]
          Length = 274

 Score =  131 bits (330), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 61/185 (32%), Positives = 102/185 (55%), Gaps = 1/185 (0%)

Query: 74  ACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTG 133
           A +L  L+ LL +F  C L  T+   + A       +M++G  P   ++I G PF G++G
Sbjct: 89  APTLEALRELLENFDGCALKQTATRLVFADGNPQARIMLVGEAPGRDEDIEGLPFVGRSG 148

Query: 134 NMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFI 193
            +LD+M+ +I + R++++I+ + PW PPGNR  +  E +IC P I RQIEL+ P +L+ +
Sbjct: 149 KLLDRMIGAIGLDRSKVYIANVIPWRPPGNRTPTPQETQICLPFIRRQIELVDPDVLVTL 208

Query: 194 GNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALIT 253
           GN +         +   ++ GKW +  T    I  +AT HP  L++ P  K+ +W  L  
Sbjct: 209 GNPSTQAILGT-TEGIMRSRGKWRDYDTGKRTIRAIATFHPAYLLRSPSYKRLSWQDLRA 267

Query: 254 LKKAL 258
           + K +
Sbjct: 268 IAKVM 272


>gi|239831462|ref|ZP_04679791.1| uracil-DNA glycosylase, family 4 [Ochrobactrum intermedium LMG
           3301]
 gi|239823729|gb|EEQ95297.1| uracil-DNA glycosylase, family 4 [Ochrobactrum intermedium LMG
           3301]
          Length = 284

 Score =  131 bits (329), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 65/187 (34%), Positives = 101/187 (54%), Gaps = 2/187 (1%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L EL+  L +F  C+L  T+ +   A      D+M IG  P   +++ G PF GK+G +
Sbjct: 97  TLDELREKLAAFDGCNLKFTAKNLCFADGDPSSDIMFIGEAPGRDEDMEGLPFVGKSGQL 156

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           L++M++SI + R  ++I+   PW PPGNR  + +E E+CRP I RQIEL +PK+L+ +G 
Sbjct: 157 LNRMIESIGLKRESVYIANTIPWRPPGNRTPTPLETELCRPFIERQIELAAPKVLVALGG 216

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSI-IPTLATVHPQELIQYPLIKKNTWHALITL 254
                      +   +  G W    TP  I IP + T+HP  L++ P  K+  W   + +
Sbjct: 217 PAGK-ALTGATEGILRLRGNWKIHRTPSGIEIPVMPTLHPAYLLRTPAQKRFAWRDFLAV 275

Query: 255 KKALKNL 261
           K  L  L
Sbjct: 276 KLKLAEL 282


>gi|254471665|ref|ZP_05085066.1| bacteriophage-type DNA polymerase N-terminal domain protein
           [Pseudovibrio sp. JE062]
 gi|211958867|gb|EEA94066.1| bacteriophage-type DNA polymerase N-terminal domain protein
           [Pseudovibrio sp. JE062]
          Length = 331

 Score =  131 bits (329), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 60/184 (32%), Positives = 105/184 (57%), Gaps = 3/184 (1%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L EL+ +L  F  C+L  T+ + +    +    +M +G  P   ++I G PF G++G++L
Sbjct: 147 LDELRKILSGFEGCNLRLTAKNLVFGDGSSKARVMFVGEAPGREEDIQGVPFVGRSGHLL 206

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
           D+ML+++ + R+ ++I+ + PW PPGNR  +  E EICRP I RQIEL+ P+I++F+G  
Sbjct: 207 DRMLKAVGLDRSNVYIANVVPWRPPGNRTPTPHETEICRPFIQRQIELVDPEIVVFLGAA 266

Query: 197 TKNFFFNNDAQKTYQNL-GKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
           +      + A+   + L GKW       +    +AT HP  L++ P  K+  W  ++ ++
Sbjct: 267 SAKTL--SGARDGIRKLRGKWLTYNGEGTQRKAIATYHPAYLLRSPAEKRYAWRDMLQIR 324

Query: 256 KALK 259
             L+
Sbjct: 325 AELE 328


>gi|170743515|ref|YP_001772170.1| phage SPO1 DNA polymerase-related protein [Methylobacterium sp.
           4-46]
 gi|168197789|gb|ACA19736.1| phage SPO1 DNA polymerase-related protein [Methylobacterium sp.
           4-46]
          Length = 300

 Score =  131 bits (329), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 67/193 (34%), Positives = 102/193 (52%), Gaps = 3/193 (1%)

Query: 67  ADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGK 126
           A  +A+ A +L EL+ LL  F  C L  T+ + + A       +M +G  P   ++  GK
Sbjct: 106 ARELARTAATLEELEQLLARFESCPLRFTAKNLVFADGEPTARVMFVGEAPGADEDRVGK 165

Query: 127 PFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELIS 186
           PF G++G +LD+M+ +I + RT  ++  + PW PPGNRN +  E+  C+P I RQI L  
Sbjct: 166 PFMGRSGQLLDRMMAAIGLDRTNAYVGNVVPWRPPGNRNPTPQEIATCKPFIERQIALAD 225

Query: 187 PKILLFIGN-KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKK 245
           P IL+ +G   T+      D     ++ G+W    T    I  LAT+HP  L++ PL K+
Sbjct: 226 PDILVCLGGVATQTLAATKDG--ILKSRGRWFPYRTERREIRLLATLHPAYLLRQPLQKR 283

Query: 246 NTWHALITLKKAL 258
             W     L+ AL
Sbjct: 284 LAWRDFRVLRAAL 296


>gi|256113158|ref|ZP_05454035.1| uracil-DNA glycosylase, family 4 [Brucella melitensis bv. 3 str.
           Ether]
 gi|265994572|ref|ZP_06107129.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|262765685|gb|EEZ11474.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
          Length = 290

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 66/196 (33%), Positives = 106/196 (54%), Gaps = 2/196 (1%)

Query: 67  ADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGK 126
           A   A +A +L EL+  L +F  C+L  T+ +   A      D+M IG  P   +++ G 
Sbjct: 94  AREAASQAETLEELREKLAAFDGCNLKFTAKNLCFADGDPSSDIMFIGEAPGRDEDMEGL 153

Query: 127 PFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELIS 186
           PF GK+G +L++M+++I + R +++I+   PW PPGNR  + +E E+ RP I RQIEL +
Sbjct: 154 PFVGKSGQLLNRMIEAIGLKREEVYIANTIPWRPPGNRAPTPLETELYRPFIERQIELAA 213

Query: 187 PKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSI-IPTLATVHPQELIQYPLIKK 245
           PK+L+ +G           A+   +  G W    TP  + IP + T+HP  L++ P  K+
Sbjct: 214 PKVLVALGGPAGK-ALTGAAEGILRLRGNWKIHRTPTGMEIPVMPTLHPAYLLRTPAQKR 272

Query: 246 NTWHALITLKKALKNL 261
             W   + +K  L  L
Sbjct: 273 FAWRDFLAVKLKLAEL 288


>gi|83945346|ref|ZP_00957694.1| hypothetical protein OA2633_14206 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83851180|gb|EAP89037.1| hypothetical protein OA2633_14206 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 261

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 65/198 (32%), Positives = 106/198 (53%), Gaps = 2/198 (1%)

Query: 65  QQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNIS 124
           Q   ++AQ A ++ ELK  L +F  C L +T+  T+ A      D+M++G  P   ++  
Sbjct: 65  QNGRAMAQAAQTVGELKQALDAFDGCPLKATATQTVYARGNPQADVMVVGEAPGRDEDRE 124

Query: 125 GKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIEL 184
           G PF G+ G +LD+ML +I +  T  +I+ +  W PPGNR  ++ E+E C P   R IEL
Sbjct: 125 GAPFIGQAGQLLDRMLAAIGLNETSAYITNVVFWRPPGNRKPTDAEIEACLPFAERHIEL 184

Query: 185 ISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLC-TPHSIIPTLATVHPQELIQYPLI 243
           + PK+++F G  +     ++ A       G+W +   +  ++IP L   HP  L++ P  
Sbjct: 185 VRPKVIVFAGGISAQSLLHSKA-GIMALRGRWHDYTLSDGTMIPALPMYHPAFLLRRPQE 243

Query: 244 KKNTWHALITLKKALKNL 261
           K  +W  L++LK  L  L
Sbjct: 244 KAKSWQDLLSLKAKLAAL 261


>gi|316932577|ref|YP_004107559.1| phage SPO1 DNA polymerase-like protein [Rhodopseudomonas palustris
           DX-1]
 gi|315600291|gb|ADU42826.1| phage SPO1 DNA polymerase-related protein [Rhodopseudomonas
           palustris DX-1]
          Length = 275

 Score =  130 bits (326), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 66/193 (34%), Positives = 103/193 (53%), Gaps = 3/193 (1%)

Query: 67  ADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGK 126
           A   A  A +L  L+ L++ F  C L  T+   + A       LM++G  P   ++I G 
Sbjct: 80  AREAAATAPTLEALRDLMQQFDGCALRGTAKQLVFADGNPQAKLMLVGEAPGRDEDIEGL 139

Query: 127 PFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELIS 186
           PF G++G +LD ML +I + R++++I+ + PW PPGNR  +  E +IC P I RQIEL++
Sbjct: 140 PFVGRSGKLLDLMLAAIGLDRSKVYIANVIPWRPPGNRTPTPQETQICLPFIKRQIELVN 199

Query: 187 PKILLFIGN-KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKK 245
           P +L+ +GN  T+      D     +  G+W +  T    I  L T+HP  L++ P  K+
Sbjct: 200 PDLLVTLGNPSTQALLGTRDG--IMRTRGRWFDYDTGTRTIRALPTLHPAYLLRQPTYKR 257

Query: 246 NTWHALITLKKAL 258
             W  L  +  AL
Sbjct: 258 LAWQDLRAIATAL 270


>gi|220925901|ref|YP_002501203.1| phage SPO1 DNA polymerase-like protein [Methylobacterium nodulans
           ORS 2060]
 gi|219950508|gb|ACL60900.1| phage SPO1 DNA polymerase-related protein [Methylobacterium
           nodulans ORS 2060]
          Length = 278

 Score =  129 bits (325), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 103/196 (52%), Gaps = 3/196 (1%)

Query: 64  VQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNI 123
              A  +A+ A SL EL++LL  F  C L  T+ + + A       +M +G  P   ++ 
Sbjct: 81  ADDARELARAAGSLAELEALLARFESCPLRFTAKNLVFADGEPSARVMFVGEAPGADEDR 140

Query: 124 SGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIE 183
            GKPF G++G +LD+M+ +I + R+  ++  I PW PPGNR+ +  E+  C+P I RQI 
Sbjct: 141 VGKPFMGRSGQLLDRMMAAIGLDRSNAYVGNIVPWRPPGNRSPTPQEVATCKPFIERQIA 200

Query: 184 LISPKILLFIGN-KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPL 242
           L  P IL+ +G   T+      D     ++ G+W    T    I  LAT+HP  L++ PL
Sbjct: 201 LADPDILVCLGGVATQTLAGTRDG--ILKSRGRWFPYQTGRREIRLLATLHPAYLLRQPL 258

Query: 243 IKKNTWHALITLKKAL 258
            K+  W     L+ AL
Sbjct: 259 QKRLAWRDFRALRAAL 274


>gi|192289638|ref|YP_001990243.1| phage SPO1 DNA polymerase-related protein [Rhodopseudomonas
           palustris TIE-1]
 gi|192283387|gb|ACE99767.1| phage SPO1 DNA polymerase-related protein [Rhodopseudomonas
           palustris TIE-1]
          Length = 276

 Score =  128 bits (322), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 80/275 (29%), Positives = 124/275 (45%), Gaps = 21/275 (7%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVF----------DEPNNEATYESQRKEKSIDSAI 50
           MT     S  Q+L    FY D+GV              D P+  A   +      +  A+
Sbjct: 1   MTPDPAPSLRQLLA---FYLDAGVDCALAEGPVNRMLDDAPDPAAREAAPEPRPIVKPAL 57

Query: 51  Q-----PITNIRHIHSP--LVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICAT 103
                 P+       SP   +  A   A  A +L  L+ L++ F  C L +T+   + A 
Sbjct: 58  HAKPPPPLAFGAPPASPDAAIISAREAAATAPTLEALRELMQRFDGCALRATATQLVFAD 117

Query: 104 QTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGN 163
                 +M +G  P   ++I G PF G++G +LD ML +I + R  ++I+ + PW PPGN
Sbjct: 118 GNPQAKVMFVGEAPGRDEDIEGLPFVGRSGKLLDLMLAAIGLNRGNVYIANVIPWRPPGN 177

Query: 164 RNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPH 223
           R  +  E +IC P I RQIEL++P +L+ +GN +             +  G+W +  T  
Sbjct: 178 RTPTPQETQICLPFIRRQIELVNPDLLVTLGNPSTQALLGTR-DGIMRTRGRWFDYDTGT 236

Query: 224 SIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
             I  L T+HP  L++ P  K+  W  L  +  AL
Sbjct: 237 RTIRALPTLHPAYLLRQPTYKRLAWQDLRAIATAL 271


>gi|27377634|ref|NP_769163.1| hypothetical protein bll2523 [Bradyrhizobium japonicum USDA 110]
 gi|27350779|dbj|BAC47788.1| bll2523 [Bradyrhizobium japonicum USDA 110]
          Length = 271

 Score =  128 bits (322), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 62/195 (31%), Positives = 100/195 (51%), Gaps = 1/195 (0%)

Query: 64  VQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNI 123
           +  A   A+ A +L  L+ L++ F  C L  T+   + A       +M +G  P   ++I
Sbjct: 73  IASAREAARTAPTLEALRELMQGFEGCALKHTATRLVFADGNPQARIMFVGEAPGRDEDI 132

Query: 124 SGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIE 183
            G PF G++G +LD M+ +I + RT  +I+ + PW PPGNR  +  E ++C P I RQIE
Sbjct: 133 EGLPFVGRSGKLLDLMIGAIGLNRTTAYIANVIPWRPPGNRTPTPQETQVCLPFIQRQIE 192

Query: 184 LISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLI 243
           L++P +L+ +GN +         +   +  G+W +  T    I  L T HP  L++ P  
Sbjct: 193 LVNPDVLVTLGNPSTQTLLGTR-EGIMRTRGRWFDYETAGRTIRALPTFHPAYLLRSPSY 251

Query: 244 KKNTWHALITLKKAL 258
           K+  W  L  + K L
Sbjct: 252 KRLAWQDLRAIAKVL 266


>gi|154251174|ref|YP_001411998.1| phage SPO1 DNA polymerase-like protein [Parvibaculum
           lavamentivorans DS-1]
 gi|154155124|gb|ABS62341.1| phage SPO1 DNA polymerase-related protein [Parvibaculum
           lavamentivorans DS-1]
          Length = 290

 Score =  128 bits (321), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 98/183 (53%), Gaps = 1/183 (0%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L EL+  L +F  C L  T+ + + A       +M++G  P   +++ G PF G++G +
Sbjct: 103 TLEELRQTLAAFEGCPLRYTAKNLVFADGNPQARIMLVGEAPGRDEDLQGLPFVGRSGQL 162

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           LD+ML +I + RT ++I+   PW PPGNR  +  E  IC P I R IEL++PK+LL +G 
Sbjct: 163 LDRMLAAIGLDRTSVYIANTLPWRPPGNRTPTPAEHAICMPFIERHIELMAPKVLLLLGG 222

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
            +       D     +  G+W+        IP L T+HP  L++ P  K+  W  L++ +
Sbjct: 223 VSAKQLLRTDT-GIMRLRGRWTTARIGECDIPALPTLHPAYLLRQPAQKRLAWRDLMSFR 281

Query: 256 KAL 258
             L
Sbjct: 282 AWL 284


>gi|213018713|ref|ZP_03334521.1| putative DNA glycosylase [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|212995664|gb|EEB56304.1| putative DNA glycosylase [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 211

 Score =  128 bits (321), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 68/204 (33%), Positives = 117/204 (57%), Gaps = 7/204 (3%)

Query: 61  SPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDS 120
           S  + +A  +A +  S+ EL+S ++SF  C +  T+ +T+ +       +M++G  P  +
Sbjct: 4   SDWIIEARKLASECGSVDELRSAVKSFEGCEIKKTATNTVFSDGNPNAKIMLVGEAPGAN 63

Query: 121 DNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMR 180
           +++ G PF G +G +LDKML +I + RT+++IS    W PPGNR  +++E+++CRP + +
Sbjct: 64  EDLKGIPFCGASGMLLDKMLGAINLDRTKVYISNTVFWRPPGNRKPTDLELDMCRPFVEK 123

Query: 181 QIELISPKILLFIGNKTKNFFFNNDAQKTYQNL-GK---WSNLCTPHSIIPTLATVHPQE 236
            I L+ P+IL+F+G        +N   KT  NL GK   ++N    H+I  T A  HP  
Sbjct: 124 HIALVLPQILIFVGGIACYSLLDN--TKTISNLRGKFHTYTNQYLSHAIT-TAAIFHPAY 180

Query: 237 LIQYPLIKKNTWHALITLKKALKN 260
           L++ P  K+  W  L  +++ L N
Sbjct: 181 LLRQPAQKRLAWEDLKKIREYLDN 204


>gi|218532502|ref|YP_002423318.1| phage SPO1 DNA polymerase-related protein [Methylobacterium
           chloromethanicum CM4]
 gi|218524805|gb|ACK85390.1| phage SPO1 DNA polymerase-related protein [Methylobacterium
           chloromethanicum CM4]
          Length = 334

 Score =  127 bits (319), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 67/190 (35%), Positives = 99/190 (52%), Gaps = 10/190 (5%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L EL+ LLR F  C L  T+ + + A       +M +G  P   ++  GKPF G++G +
Sbjct: 145 TLDELEELLRGFEGCGLRFTAKNLVFADGNPQARVMFVGEAPGADEDRIGKPFMGRSGQL 204

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           LD+M+ +I + RT  +IS + PW PPGNRN +  E+ ICRP + RQIEL +P IL+ +G 
Sbjct: 205 LDRMMAAIGLDRTSAYISNVVPWRPPGNRNPTPQEISICRPFVERQIELANPDILVCLGA 264

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSI-----IPTLATVHPQELIQYPLIKKNTWHA 250
                        T   + K      P+ +     I  LAT+HP  L++ P+ K+  W  
Sbjct: 265 PATQTLTG-----TKDGILKARGRFYPYRLGDGREIRALATLHPAYLLRQPVQKRLAWRD 319

Query: 251 LITLKKALKN 260
              LK AL  
Sbjct: 320 FRMLKSALDG 329


>gi|163853643|ref|YP_001641686.1| phage SPO1 DNA polymerase-related protein [Methylobacterium
           extorquens PA1]
 gi|163665248|gb|ABY32615.1| phage SPO1 DNA polymerase-related protein [Methylobacterium
           extorquens PA1]
          Length = 323

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 68/192 (35%), Positives = 99/192 (51%), Gaps = 14/192 (7%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L EL+ LLR F  C L  T+ + + A       +M +G  P   ++  GKPF G++G +
Sbjct: 134 TLDELEELLRGFEGCGLRFTAKNLVFADGNPQARVMFVGEAPGADEDRIGKPFMGRSGQL 193

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG- 194
           LD+M+ +I + RT  +IS + PW PPGNRN +  E+ ICRP + RQIEL +P IL+ +G 
Sbjct: 194 LDRMMAAIGLDRTSAYISNVVPWRPPGNRNPTPQEISICRPFVERQIELANPDILVCLGA 253

Query: 195 ------NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTW 248
                   TK+       +     LG           I  LAT+HP  L++ P+ K+  W
Sbjct: 254 PATQTLTGTKDGILKARGRFYPYRLGDGRE-------IRALATLHPAYLLRQPVQKRLAW 306

Query: 249 HALITLKKALKN 260
                LK AL  
Sbjct: 307 RDFRMLKSALDG 318


>gi|188583952|ref|YP_001927397.1| phage SPO1 DNA polymerase-related protein [Methylobacterium populi
           BJ001]
 gi|179347450|gb|ACB82862.1| phage SPO1 DNA polymerase-related protein [Methylobacterium populi
           BJ001]
          Length = 309

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 67/190 (35%), Positives = 100/190 (52%), Gaps = 10/190 (5%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L EL++LLR F  C L  T+ + + A       +M +G  P   ++  GKPF G++G +
Sbjct: 120 TLEELEALLRGFEGCTLRFTAKNLVFADGNPQARVMFVGEAPGADEDRIGKPFMGRSGQL 179

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           LD+M+ +I + RT  +IS + PW PPGNRN +  E+ ICRP + RQIEL +P IL+ +G 
Sbjct: 180 LDRMMAAIGLDRTSAYISNVVPWRPPGNRNPTPQEISICRPFVERQIELANPDILVCLGA 239

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSI-----IPTLATVHPQELIQYPLIKKNTWHA 250
                        T   + K      P+ +     I  LAT+HP  L++ P+ K+  W  
Sbjct: 240 PATQTLTG-----TKDGILKARGRFYPYRLSDGREIRALATLHPAYLLRQPVQKRLAWRD 294

Query: 251 LITLKKALKN 260
              LK AL  
Sbjct: 295 FRMLKTALDG 304


>gi|158425118|ref|YP_001526410.1| phage SPO1 DNA polymerase-related protein [Azorhizobium caulinodans
           ORS 571]
 gi|158332007|dbj|BAF89492.1| phage SPO1 DNA polymerase-related protein [Azorhizobium caulinodans
           ORS 571]
          Length = 297

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 59/185 (31%), Positives = 100/185 (54%), Gaps = 1/185 (0%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           SL EL+++L +F  C L  T+   + A       +M +G  P   +++ G PF G++G +
Sbjct: 110 SLDELRAMLEAFEGCPLKRTATRLVFADGNPAAKVMFVGEAPGRDEDVQGLPFVGRSGRL 169

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           LD ML +I + RT+ +I+ + PW PPGNR  +  E  IC P I RQ+EL +P +L+ +G 
Sbjct: 170 LDLMLGAIGLDRTKAYIANVIPWRPPGNRTPTPQETAICLPFIRRQVELANPDVLVCLGG 229

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
            +     +   +   +  G++ +  T    I  +AT HP  L++ PL K+  W  ++ ++
Sbjct: 230 PSAQALLST-TEGITKLRGRFMSYDTGSRTIKAIATFHPAYLLRTPLGKRLAWRDMLAVE 288

Query: 256 KALKN 260
            AL  
Sbjct: 289 AALNG 293


>gi|83591606|ref|YP_425358.1| phage SPO1 DNA polymerase-like protein [Rhodospirillum rubrum ATCC
           11170]
 gi|83574520|gb|ABC21071.1| Phage SPO1 DNA polymerase-related protein [Rhodospirillum rubrum
           ATCC 11170]
          Length = 315

 Score =  126 bits (316), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 66/200 (33%), Positives = 105/200 (52%), Gaps = 4/200 (2%)

Query: 65  QQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNIS 124
           + A  +A +A SL +L++ L SF  C L  T+  T+ A       +MIIG  P   ++  
Sbjct: 113 RAASFLAAQAGSLEDLRTALDSFRSCALRRTATQTVFADGCPQSGMMIIGEAPGADEDRL 172

Query: 125 GKPFSGKTGNMLDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIE 183
           G+PF G +G +LD ML SI + R    +I+ + PW PPGNR  +  E+ +C P + R I 
Sbjct: 173 GRPFVGVSGKLLDAMLGSIGLDRADSCYITNVVPWRPPGNRKPTADEVALCLPFLERHIA 232

Query: 184 LISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTP--HSIIPTLATVHPQELIQYP 241
           L+ P+++L +G       F   ++   +  G W +   P     +P LAT HP  L++ P
Sbjct: 233 LVRPRLILAVGGLAAQALFGR-SEGITRLRGHWHDYEGPGLDRSVPVLATFHPAYLLRTP 291

Query: 242 LIKKNTWHALITLKKALKNL 261
             K+  W  L+ L++ L +L
Sbjct: 292 AQKRLAWRDLLALRQRLDSL 311


>gi|225677066|ref|ZP_03788071.1| uracil-DNA glycosylase-like protein [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
 gi|225590888|gb|EEH12110.1| uracil-DNA glycosylase-like protein [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
          Length = 273

 Score =  126 bits (316), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 64/203 (31%), Positives = 116/203 (57%), Gaps = 5/203 (2%)

Query: 61  SPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDS 120
           S  + +A  +A K  S+ EL+S+++SF  C +  T+ +T+ +       +M++G  P  +
Sbjct: 66  SDWIIEARKLASKCNSVDELRSVVKSFEGCEIKKTATNTVFSDGNPNAKVMLVGEAPGAN 125

Query: 121 DNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMR 180
           +++ G PF G +G +LDKML +I + RT+++IS    W PPGNR  +++E+++CRP + +
Sbjct: 126 EDLQGIPFCGASGMLLDKMLNAINLDRTKVYISNTVFWRPPGNRKPTDLELDMCRPFVEK 185

Query: 181 QIELISPKILLFIGNKTKNFFFNNDAQKTYQNL-GKWSNLCTPH--SIIPTLATVHPQEL 237
            + L+SP+IL+ +G          D+ +T  NL G++      +  + I T A  HP  L
Sbjct: 186 HVALVSPQILILVGGIACYSLL--DSTETISNLRGRFHTYTNQYLSNSITTAAIFHPAYL 243

Query: 238 IQYPLIKKNTWHALITLKKALKN 260
           ++ P  K+  W  L  +++ L N
Sbjct: 244 LRQPAQKRLAWEDLKKIREYLDN 266


>gi|99034822|ref|ZP_01314738.1| hypothetical protein Wendoof_01000436 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
          Length = 273

 Score =  125 bits (315), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 65/203 (32%), Positives = 114/203 (56%), Gaps = 5/203 (2%)

Query: 61  SPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDS 120
           S  + +A  +A K  S+ EL+S + SF  C +  T+ +T+ +       +M++G  P  +
Sbjct: 66  SDWIIEARKLASKCNSVDELRSAVESFEGCEIKKTATNTVFSDGNPNAKVMLVGEAPGAN 125

Query: 121 DNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMR 180
           +++ G PF G +G +LDKML +I + RT+++IS    W PPGNR  +++E+++CRP + +
Sbjct: 126 EDLQGIPFCGASGMLLDKMLNAINLDRTKVYISNTVFWRPPGNRKPTDLELDMCRPFVEK 185

Query: 181 QIELISPKILLFIGNKTKNFFFNNDAQKTYQNL-GKWSNLCTPH--SIIPTLATVHPQEL 237
            + L+SP+IL+ +G          D+ KT  NL G++      +  + I T A  HP  L
Sbjct: 186 HVALVSPQILILVGGIACYSLL--DSTKTISNLRGRFHTYTNQYLSNSITTAAIFHPAYL 243

Query: 238 IQYPLIKKNTWHALITLKKALKN 260
           ++ P  K+  W  L  +++ L N
Sbjct: 244 LRQPAQKRLAWEDLKKIREYLDN 266


>gi|240850173|ref|YP_002971566.1| phage SPO1 DNA polymerase-related protein [Bartonella grahamii
           as4aup]
 gi|240267296|gb|ACS50884.1| phage SPO1 DNA polymerase-related protein [Bartonella grahamii
           as4aup]
          Length = 276

 Score =  125 bits (314), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 86/271 (31%), Positives = 128/271 (47%), Gaps = 20/271 (7%)

Query: 7   LSQEQILTIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAI------QPITNIRHIH 60
           +S E++L    FY +SG   V          +S   E  + S +      Q    ++  H
Sbjct: 9   ISYEELLN---FYKESGADAVLTNFPINRFKQSACSESKLISVVNISHNQQTSPTVKLDH 65

Query: 61  SPLVQQADSI---------AQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLM 111
            PL     +I         A  A +L ELKS L +F+ C L  T+ +T  +  T G  LM
Sbjct: 66  RPLHNSRGAIQNEPTAIESANNAKTLDELKSALLAFNGCSLKLTAKNTCFSDGTAGSPLM 125

Query: 112 IIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEM 171
           +IG  P   ++I G PF GK G +L+K+L SI + R  ++I+   PW PPGNR  +  E+
Sbjct: 126 LIGEAPGREEDIQGIPFVGKAGMLLNKILASIGLTRNNVYIANTIPWRPPGNRTPTPREV 185

Query: 172 EICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSI-IPTLA 230
            +CRP I R I L  P++L+ +G                +  GKW    +  +I IP + 
Sbjct: 186 ALCRPFIERHIYLARPRVLIALGGIAAQ-LLTGSQNGIIRTRGKWHIYESEDNIKIPVMP 244

Query: 231 TVHPQELIQYPLIKKNTWHALITLKKALKNL 261
           T HP  L++ P  KK TW   + +K  L +L
Sbjct: 245 TFHPAYLLRTPSQKKLTWIDFLEVKNRLDSL 275


>gi|217976632|ref|YP_002360779.1| phage SPO1 DNA polymerase-related protein [Methylocella silvestris
           BL2]
 gi|217502008|gb|ACK49417.1| phage SPO1 DNA polymerase-related protein [Methylocella silvestris
           BL2]
          Length = 281

 Score =  125 bits (314), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 76/264 (28%), Positives = 124/264 (46%), Gaps = 13/264 (4%)

Query: 10  EQILTIALFYADSGVYWVFDE-PNNEATYESQRKEKSIDSAIQPITNIRHIHSP----LV 64
           E ++ +  +YA+ GV    DE P++     +Q   +    AI        + +P     +
Sbjct: 3   ESLIALLRWYAEMGVDIALDEIPHDRTRAPAQPPPERPAIAINAPPQAPAMSAPRQPVAI 62

Query: 65  QQADSIAQKAC-------SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTP 117
             ADS+ + A        +L +L++ L +F  C L +T+   +      G  +M +G  P
Sbjct: 63  AGADSLERDAREAAAAAKTLEKLRAELLAFEGCGLKTTATQLVFGDGEAGAKVMFVGEAP 122

Query: 118 SDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPI 177
              ++  G PF G+ G +L++ML +I + R  ++I+ + PW PPGNR  + IE   C P 
Sbjct: 123 GADEDRQGVPFVGRAGQLLNRMLAAIGLDRRDVYIANVVPWRPPGNRTPTPIETAACLPF 182

Query: 178 IMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQEL 237
             RQIEL+ PKIL+ +G  +           T    G+W       + I  LA  HP  L
Sbjct: 183 TRRQIELVGPKILVCLGLPSAQTLLGAKDSMTRIR-GRWLTYDCGGTPIRALAMFHPAYL 241

Query: 238 IQYPLIKKNTWHALITLKKALKNL 261
           ++ P  KK  W  L  L +AL ++
Sbjct: 242 LRQPGQKKLAWQDLRMLARALADM 265


>gi|58697041|ref|ZP_00372503.1| putative phage DNA polymerase [Wolbachia endosymbiont of Drosophila
           simulans]
 gi|58536691|gb|EAL59977.1| putative phage DNA polymerase [Wolbachia endosymbiont of Drosophila
           simulans]
          Length = 249

 Score =  124 bits (312), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 65/203 (32%), Positives = 114/203 (56%), Gaps = 5/203 (2%)

Query: 61  SPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDS 120
           S  + +A  +A K  S+ EL+S ++SF  C +  T+ +T+ +       +M++G  P  +
Sbjct: 42  SDWIIEARKLAGKCGSVDELRSAVKSFEGCEIKKTATNTVFSDGNPNAKIMLVGEAPGAN 101

Query: 121 DNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMR 180
           +++ G PF G +G +LDKML +I + RT+++IS    W PPGNR  +++E+++CRP + +
Sbjct: 102 EDLQGIPFCGASGMLLDKMLNAINLDRTKVYISNTVFWRPPGNRKPTDLELDMCRPFVEK 161

Query: 181 QIELISPKILLFIGNKTKNFFFNNDAQKTYQNL-GKWSNLCTPH--SIIPTLATVHPQEL 237
            I L+SP+IL+ +G          D+ KT  NL G++      +  + I T A  HP  L
Sbjct: 162 HIALVSPQILILVGGIACYSLL--DSTKTISNLRGRFHTYTNQYLSNSITTAAIFHPAYL 219

Query: 238 IQYPLIKKNTWHALITLKKALKN 260
           ++ P  K+  W     +++ L N
Sbjct: 220 LRQPAQKRLAWEDSKKIREYLDN 242


>gi|58698049|ref|ZP_00372973.1| phage SPO1 DNA polymerase domain protein [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|225629945|ref|YP_002726736.1| uracil-DNA glycosylase-like protein [Wolbachia sp. wRi]
 gi|58535406|gb|EAL59481.1| phage SPO1 DNA polymerase domain protein [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|225591926|gb|ACN94945.1| uracil-DNA glycosylase-like protein [Wolbachia sp. wRi]
          Length = 270

 Score =  124 bits (312), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 65/203 (32%), Positives = 114/203 (56%), Gaps = 5/203 (2%)

Query: 61  SPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDS 120
           S  + +A  +A K  S+ EL+S ++SF  C +  T+ +T+ +       +M++G  P  +
Sbjct: 63  SDWIIEARKLAGKCGSVDELRSAVKSFEGCEIKKTATNTVFSDGNPNAKIMLVGEAPGAN 122

Query: 121 DNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMR 180
           +++ G PF G +G +LDKML +I + RT+++IS    W PPGNR  +++E+++CRP + +
Sbjct: 123 EDLQGIPFCGASGMLLDKMLNAINLDRTKVYISNTVFWRPPGNRKPTDLELDMCRPFVEK 182

Query: 181 QIELISPKILLFIGNKTKNFFFNNDAQKTYQNL-GKWSNLCTPH--SIIPTLATVHPQEL 237
            I L+SP+IL+ +G          D+ KT  NL G++      +  + I T A  HP  L
Sbjct: 183 HIALVSPQILILVGGIACYSLL--DSTKTISNLRGRFHTYTNQYLSNSITTAAIFHPAYL 240

Query: 238 IQYPLIKKNTWHALITLKKALKN 260
           ++ P  K+  W     +++ L N
Sbjct: 241 LRQPAQKRLAWEDSKKIREYLDN 263


>gi|42520066|ref|NP_965981.1| phage SPO1 DNA polymerase-related protein [Wolbachia endosymbiont
           of Drosophila melanogaster]
 gi|42409803|gb|AAS13915.1| phage SPO1 DNA polymerase-related protein [Wolbachia endosymbiont
           of Drosophila melanogaster]
          Length = 273

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 65/203 (32%), Positives = 113/203 (55%), Gaps = 5/203 (2%)

Query: 61  SPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDS 120
           S  + +A  +A K  S+ EL+S + SF  C +  T+ +T+ +       +M++G  P  +
Sbjct: 66  SDWIIEARKLASKCNSVDELRSAVESFEGCEIKKTATNTVFSDGNPNAKVMLVGEAPGAN 125

Query: 121 DNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMR 180
           +++ G PF G +G +LDKML +I + RT+++IS    W PPGNR  +++E+++CRP + +
Sbjct: 126 EDLQGIPFCGASGMLLDKMLNAINLDRTKVYISNTVFWRPPGNRKPTDLELDMCRPFVEK 185

Query: 181 QIELISPKILLFIGNKTKNFFFNNDAQKTYQNL-GKWSNLCTPH--SIIPTLATVHPQEL 237
            + L SP+IL+ +G          D+ KT  NL G++      +  + I T A  HP  L
Sbjct: 186 HVALASPQILILVGGIACYSLL--DSTKTISNLRGRFHTYTNQYLSNSITTAAIFHPAYL 243

Query: 238 IQYPLIKKNTWHALITLKKALKN 260
           ++ P  K+  W  L  +++ L N
Sbjct: 244 LRQPAQKRLAWEDLKKIREYLDN 266


>gi|58584375|ref|YP_197948.1| Uracil-DNA glycosylase [Wolbachia endosymbiont strain TRS of Brugia
           malayi]
 gi|58418691|gb|AAW70706.1| Uracil-DNA glycosylase [Wolbachia endosymbiont strain TRS of Brugia
           malayi]
          Length = 266

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 69/218 (31%), Positives = 120/218 (55%), Gaps = 7/218 (3%)

Query: 45  SIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQ 104
           +I + +Q         S  + +A  +A K  S+ EL+S ++SF  C +  TS +T+ +  
Sbjct: 43  TIQAEVQKKEQQSMFPSDWIIEARKLASKCNSMDELRSAVKSFEGCEIKKTSTNTVFSDG 102

Query: 105 TEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNR 164
            +   +M++G  P  ++++ G PF G +G +LDKML +I + RT+++IS    W PPGNR
Sbjct: 103 NQSAKIMLVGEAPGANEDLKGIPFCGASGMLLDKMLSAINLDRTKVYISNTVFWRPPGNR 162

Query: 165 NLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNL-GK---WSNLC 220
             +++E+++CRP + + I LISP IL+ +G  +     +N   KT   L G+   ++N  
Sbjct: 163 KPTDLELDMCRPFVEKHIALISPHILILVGGISCYSLLDN--TKTISTLRGRFHTYTNQY 220

Query: 221 TPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
             +SI  T    HP  L++ P  K+  W  L  +++ L
Sbjct: 221 LSYSIT-TAVIFHPAYLLRQPAQKRLAWEDLKKIREYL 257


>gi|269958378|ref|YP_003328165.1| putative DNA glycosylase [Anaplasma centrale str. Israel]
 gi|269848207|gb|ACZ48851.1| putative DNA glycosylase [Anaplasma centrale str. Israel]
          Length = 289

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 73/260 (28%), Positives = 125/260 (48%), Gaps = 11/260 (4%)

Query: 6   ILSQEQILTIALFYADSGVYWVFDEPNNEA---TYESQRKEKSIDSAIQ-----PITNIR 57
           +   E++L +  FY ++GV  V +E   EA      SQ ++     A +           
Sbjct: 19  VAGGEELLEVLRFYHENGVDCVLEEGGLEARTPAVVSQEQDVGTSRAGRLSEQGADKGES 78

Query: 58  HIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTP 117
              +  V  A  IA     L EL++ + SF  C +   +++T+ +       +M+IG  P
Sbjct: 79  QFSTDWVTAARKIAGGCSDLAELRAAIESFEGCEIKKAAMNTVFSDGNPDARIMLIGEAP 138

Query: 118 SDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPI 177
             +++  G+PF G +G +LDKML +I + R   +IS  + W PPGNR  ++ E+EIC+P 
Sbjct: 139 GSNEDREGRPFCGASGMLLDKMLAAIGLNRKSTYISNTTFWRPPGNRRPTDFELEICKPF 198

Query: 178 IMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATV--HPQ 235
           + + I LI+P IL+ +G+ T      N  +   +  G++     P    P    V  HP 
Sbjct: 199 VEKHIALIAPSILVLVGS-TACCALLNTPESISRLRGRFHEYTNPFLAHPVTTAVIFHPA 257

Query: 236 ELIQYPLIKKNTWHALITLK 255
            L++ P+ K+  W  L  ++
Sbjct: 258 YLLRQPMQKRLAWEDLKMIR 277


>gi|39934111|ref|NP_946387.1| phage SPO1 DNA polymerase-like protein [Rhodopseudomonas palustris
           CGA009]
 gi|39647959|emb|CAE26479.1| possible phage DNA polymerases [Rhodopseudomonas palustris CGA009]
          Length = 276

 Score =  123 bits (308), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 60/185 (32%), Positives = 96/185 (51%), Gaps = 1/185 (0%)

Query: 67  ADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGK 126
           A   A  A +L  L+ L++ F  C L +T+   + A       ++ +G  P   ++I G 
Sbjct: 81  AREAAATAPTLEALRELMQRFDGCALRATATQLVFADGNPQAKVVFVGEAPGRDEDIEGL 140

Query: 127 PFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELIS 186
           PF G++G +LD ML +I + R  ++I+ + PW PPGNR  +  E +IC P I RQIEL++
Sbjct: 141 PFVGRSGKLLDLMLAAIGLNRGNVYIANVIPWRPPGNRTPTPQETQICLPFIRRQIELVN 200

Query: 187 PKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKN 246
           P +L+ +GN +             +  G+W +  T    I  L T+HP  L++ P  K+ 
Sbjct: 201 PDLLVTLGNPSTQALLGT-RDGIMRTRGRWFDYDTGTRTIRALPTLHPAYLLRQPTYKRL 259

Query: 247 TWHAL 251
            W  L
Sbjct: 260 AWQDL 264


>gi|15604675|ref|NP_221193.1| hypothetical protein RP845 [Rickettsia prowazekii str. Madrid E]
 gi|3861370|emb|CAA15269.1| unknown [Rickettsia prowazekii]
 gi|292572506|gb|ADE30421.1| Uracil-DNA glycosylase, family 4 [Rickettsia prowazekii Rp22]
          Length = 258

 Score =  122 bits (307), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 65/196 (33%), Positives = 112/196 (57%), Gaps = 7/196 (3%)

Query: 69  SIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPF 128
           S+A KA ++ EL+  L +F+ C L   + +T+        ++M+IG  P +++++ G PF
Sbjct: 61  SLADKANNIVELRESLLNFNGCELKKFATNTVFGDGNPQANIMLIGEAPGNTEDLKGIPF 120

Query: 129 SGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPK 188
            G++GN+LD ML +I I R   +I+ +  W PP NR  +  E++ICRP + + I LI+PK
Sbjct: 121 CGESGNLLDNMLYAIGISRNNFYITNMVFWRPPANRQPTLEEVDICRPFVEKHIALINPK 180

Query: 189 ILLFIGNKTKNFFFNNDA--QKTYQNLGKWSN--LCTPHSIIPTLATVHPQELIQYPLIK 244
           +L+ +G+         +A   K  Q    ++N  + TP   I T A  HP  L++ P+ K
Sbjct: 181 LLILVGSTAATSLLGKNACITKIRQEYYFYTNKYISTP---IQTTAIFHPAYLLRQPMQK 237

Query: 245 KNTWHALITLKKALKN 260
           + +W+ L+ +K+ L N
Sbjct: 238 RTSWYDLLKIKEYLVN 253


>gi|254995400|ref|ZP_05277590.1| hypothetical protein AmarM_05693 [Anaplasma marginale str.
           Mississippi]
 gi|255003587|ref|ZP_05278551.1| hypothetical protein AmarPR_05168 [Anaplasma marginale str. Puerto
           Rico]
 gi|255004718|ref|ZP_05279519.1| hypothetical protein AmarV_05513 [Anaplasma marginale str.
           Virginia]
          Length = 279

 Score =  122 bits (307), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 75/273 (27%), Positives = 132/273 (48%), Gaps = 14/273 (5%)

Query: 1   MTSKR---ILSQEQILTIALFYADSGVYWVFDE-------PNNEATYESQRKEKSIDSAI 50
           MT K     +   ++L +  FY ++GV  V +E       P   A  E +     + S  
Sbjct: 1   MTGKEKDAAVGSGELLEVLKFYHENGVDCVLEEDGPGTCAPPVAALQEQEGCTLQVGSPS 60

Query: 51  QPI-TNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQD 109
           + +        +  V  A SIA K  +L EL+  + +F  C +   +++T+ +       
Sbjct: 61  EQMDAGASQFSTDWVAAAKSIADKCGTLAELREAVEAFEGCEIKKAAMNTVFSDGNPNAK 120

Query: 110 LMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNI 169
           +M+IG  P  +++  G+PF G +G +LDKML +I + R   +IS  + W PPGNR  ++ 
Sbjct: 121 IMLIGEAPGSNEDREGRPFCGASGMLLDKMLAAIGLDRKSTYISNTTFWRPPGNRRPTDF 180

Query: 170 EMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIP-- 227
           E+EIC+P + + I LI+P IL+ +G+ T      +  +   +  G++     P    P  
Sbjct: 181 ELEICKPFVEKHIALIAPSILVLVGS-TACCSLLSTPESISRLRGRFHEYANPFLAHPIK 239

Query: 228 TLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
           T    HP  L++ P+ K+  W  L  ++  ++N
Sbjct: 240 TAVIFHPAYLLRQPMQKRLAWEDLKMIRSHIEN 272


>gi|154246315|ref|YP_001417273.1| phage SPO1 DNA polymerase-related protein [Xanthobacter
           autotrophicus Py2]
 gi|154160400|gb|ABS67616.1| phage SPO1 DNA polymerase-related protein [Xanthobacter
           autotrophicus Py2]
          Length = 307

 Score =  122 bits (307), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 62/197 (31%), Positives = 100/197 (50%), Gaps = 1/197 (0%)

Query: 64  VQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNI 123
           V  A   A+ A SL  L+++L  F  C L  T+   + A       +M +G  P   ++ 
Sbjct: 110 VMSAREAARNAESLDALRAILDGFEGCALKRTATRLVFADGNPKAKVMFVGEAPGRDEDQ 169

Query: 124 SGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIE 183
            G PF G++G +LD M+ +I + RT  +I+ + PW PPGNR  +  E  +C P I RQIE
Sbjct: 170 QGLPFVGRSGRLLDLMMAAIGLDRTSAYIANVIPWRPPGNRTPTPQETAVCLPFIKRQIE 229

Query: 184 LISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLI 243
           L  P IL+ +G  +         +   +  G++ +  +    I  +AT HP  L++ PL 
Sbjct: 230 LADPDILVCLGGPSAQALLAT-TEGITRLRGRFMDYESGTRTIRAIATFHPAYLLRTPLG 288

Query: 244 KKNTWHALITLKKALKN 260
           K+  W  ++ ++ AL N
Sbjct: 289 KRLAWRDMLAVEAALAN 305


>gi|56417232|ref|YP_154306.1| hypothetical protein AM1237 [Anaplasma marginale str. St. Maries]
 gi|222475596|ref|YP_002564013.1| hypothetical protein AMF_934 [Anaplasma marginale str. Florida]
 gi|56388464|gb|AAV87051.1| hypothetical protein AM1237 [Anaplasma marginale str. St. Maries]
 gi|222419734|gb|ACM49757.1| Conserved hypothetical protein [Anaplasma marginale str. Florida]
          Length = 290

 Score =  122 bits (307), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 75/273 (27%), Positives = 132/273 (48%), Gaps = 14/273 (5%)

Query: 1   MTSKR---ILSQEQILTIALFYADSGVYWVFDE-------PNNEATYESQRKEKSIDSAI 50
           MT K     +   ++L +  FY ++GV  V +E       P   A  E +     + S  
Sbjct: 12  MTGKEKDAAVGSGELLEVLKFYHENGVDCVLEEDGPGTCAPPVAALQEQEGCTLQVGSPS 71

Query: 51  QPI-TNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQD 109
           + +        +  V  A SIA K  +L EL+  + +F  C +   +++T+ +       
Sbjct: 72  EQMDAGASQFSTDWVAAAKSIADKCGTLAELREAVEAFEGCEIKKAAMNTVFSDGNPNAK 131

Query: 110 LMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNI 169
           +M+IG  P  +++  G+PF G +G +LDKML +I + R   +IS  + W PPGNR  ++ 
Sbjct: 132 IMLIGEAPGSNEDREGRPFCGASGMLLDKMLAAIGLDRKSTYISNTTFWRPPGNRRPTDF 191

Query: 170 EMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIP-- 227
           E+EIC+P + + I LI+P IL+ +G+ T      +  +   +  G++     P    P  
Sbjct: 192 ELEICKPFVEKHIALIAPSILVLVGS-TACCSLLSTPESISRLRGRFHEYANPFLAHPIK 250

Query: 228 TLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
           T    HP  L++ P+ K+  W  L  ++  ++N
Sbjct: 251 TAVIFHPAYLLRQPMQKRLAWEDLKMIRSHIEN 283


>gi|144897951|emb|CAM74815.1| Uracil DNA glycosylase [Magnetospirillum gryphiswaldense MSR-1]
          Length = 250

 Score =  122 bits (306), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 97/189 (51%), Gaps = 3/189 (1%)

Query: 70  IAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFS 129
           +  K   L +L+  + +F    L  T++ST+ A      D+M IG  P   ++  G PF 
Sbjct: 57  LGGKVSDLAQLRQAMEAFDALPLKRTAMSTVFADGNPDADIMCIGEAPGQEEDRQGLPFV 116

Query: 130 GKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKI 189
           GK+G +LD+ML SI + R  ++IS + PW P  NR  +  E+ +C P I R IEL+ PK+
Sbjct: 117 GKSGKLLDRMLASIGLDRGSVYISNVVPWRPVDNRKPTADEVAVCLPFITRHIELVDPKL 176

Query: 190 LLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIP--TLATVHPQELIQYPLIKKNT 247
           L+  G    +      ++   +  G+W +  +P    P   + T HP  L++ P  K+  
Sbjct: 177 LILFGGAAASALLGR-SEGINRLRGRWFDYSSPGLPRPVAVMPTFHPAYLLRTPAAKREA 235

Query: 248 WHALITLKK 256
           W  L+ ++K
Sbjct: 236 WRDLLAVRK 244


>gi|170750469|ref|YP_001756729.1| phage SPO1 DNA polymerase-related protein [Methylobacterium
           radiotolerans JCM 2831]
 gi|170656991|gb|ACB26046.1| phage SPO1 DNA polymerase-related protein [Methylobacterium
           radiotolerans JCM 2831]
          Length = 295

 Score =  122 bits (306), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 62/186 (33%), Positives = 100/186 (53%), Gaps = 3/186 (1%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           SL EL+ +L  F  C L  T+ + + A       +M +G  P   ++  GKPF G++G +
Sbjct: 110 SLDELERILADFDACPLRFTAKNLVFADGNPEARVMFLGEAPGADEDRIGKPFMGRSGQL 169

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           LDKM++++ + RT  +I  I PW PPGNRN +  E+ +CRP + RQIEL+ P I++ +G 
Sbjct: 170 LDKMMKAVGLDRTSAYIGNIVPWRPPGNRNPTPQEVAVCRPFVERQIELVDPDIIVCLGA 229

Query: 196 -KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITL 254
             T+      D     +  G+      P+  +  LAT+HP  L++ P+ K+  W    +L
Sbjct: 230 PATQTLTGTKDG--ILRTRGRLFPYKLPNREVKLLATLHPAFLLRQPVQKRLAWRDFRSL 287

Query: 255 KKALKN 260
           +  L  
Sbjct: 288 RALLDG 293


>gi|157804236|ref|YP_001492785.1| N-terminus of bacteriophage-type DNA polymerase [Rickettsia
           canadensis str. McKiel]
 gi|157785499|gb|ABV74000.1| N-terminus of bacteriophage-type DNA polymerase [Rickettsia
           canadensis str. McKiel]
          Length = 262

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 74/238 (31%), Positives = 127/238 (53%), Gaps = 12/238 (5%)

Query: 28  FDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSF 87
           FD+P  E    +    K+ID  ++  T+  H +   +  A S+A K  ++ EL+  L +F
Sbjct: 26  FDKPQ-ENNQINPMPRKTIDKILEVDTDKMHTN---ISLARSLADKVNNIEELRESLLNF 81

Query: 88  HDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR 147
           + C L   S +T+     +   +M+IG  P  ++++ G PF G++GN+LD ML SI I R
Sbjct: 82  NGCKLKKFSTNTVFGDGNQKAQVMLIGEAPGSTEDLKGIPFCGESGNLLDNMLHSIGISR 141

Query: 148 -TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFF--NN 204
               +I+    W PP NR  +  E++ICRP + + I LI+PK+++ +G+         N+
Sbjct: 142 KNNAYITNTVFWRPPANRQPTLEEVDICRPFVEKHIALINPKLIILVGSTAATSLLGKNS 201

Query: 205 DAQKTYQNLGKWSN--LCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
              K  Q    ++N  L +P   I T    HP  L+++P+ K+ +W+ L+ +K+ L N
Sbjct: 202 GITKIRQEYYFYTNKYLSSP---IQTTTIFHPAYLLRHPMQKRTSWYDLLKIKEYLVN 256


>gi|163745656|ref|ZP_02153016.1| uracil-DNA glycosylase, C-terminal [Oceanibulbus indolifex HEL-45]
 gi|161382474|gb|EDQ06883.1| uracil-DNA glycosylase, C-terminal [Oceanibulbus indolifex HEL-45]
          Length = 254

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 63/198 (31%), Positives = 105/198 (53%), Gaps = 7/198 (3%)

Query: 64  VQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNI 123
           V  A   AQ A +L EL++ ++ F  C L   + + + +    G  LMI G +P   ++ 
Sbjct: 62  VALARRAAQGAQTLDELRAAIQGFEACELHKGARNLVFSDGVPGAPLMIFGESPDRDEDR 121

Query: 124 SGKPFSGKTGNMLDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQI 182
           +GKPF G+TG MLD+ML +I++ R + +++S I PW  P  R+    E+ + RP + R I
Sbjct: 122 AGKPFVGRTGQMLDRMLAAIDMGRDRNVYLSNILPWRTPQGRDPKPDEIAMMRPFVQRHI 181

Query: 183 ELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPL 242
           EL  PK+L+  GN +         +   +  G W    T  + +P +  VHP  L++ P 
Sbjct: 182 ELAKPKVLILFGNWSCQSLLEK--RSIMRLRGNW----TKAADLPCMPMVHPAYLLRNPE 235

Query: 243 IKKNTWHALITLKKALKN 260
            K+  W  L++++  L+N
Sbjct: 236 AKREAWADLLSVQAKLRN 253


>gi|209966444|ref|YP_002299359.1| uracil-DNA glycosylase, family 4 protein, putative [Rhodospirillum
           centenum SW]
 gi|209959910|gb|ACJ00547.1| uracil-DNA glycosylase, family 4 protein, putative [Rhodospirillum
           centenum SW]
          Length = 298

 Score =  119 bits (298), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 58/194 (29%), Positives = 102/194 (52%), Gaps = 9/194 (4%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L ELK+ L +F  C L  T+ S + A       +M++G  P + ++  G+PF G  G +
Sbjct: 102 TLPELKAALAAFEGCALRHTATSLVFADGDPAARVMLVGEAPGEQEDRQGRPFVGPAGLL 161

Query: 136 LDKMLQSIEIMR------TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKI 189
           LD+ML +I + R        ++I+ +  W PPGNR+ ++ E+  C P + R I+L++P +
Sbjct: 162 LDRMLAAIGLDRRADTPDRAVYITNVVNWRPPGNRSPTDGEIAACLPFVQRHIDLVNPAV 221

Query: 190 LLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPH--SIIPTLATVHPQELIQYPLIKKNT 247
           L+F+G  +           T    G+W +  +P     +P L  +HP  L++ P  K+  
Sbjct: 222 LVFLGGISAKSLLQRTEGITRLR-GRWFDYASPGLSRPLPALPMLHPAYLLRNPAAKREA 280

Query: 248 WHALITLKKALKNL 261
           W  L+ L++ L+ L
Sbjct: 281 WKDLLALQERLEAL 294


>gi|148260066|ref|YP_001234193.1| phage SPO1 DNA polymerase-related protein [Acidiphilium cryptum
           JF-5]
 gi|146401747|gb|ABQ30274.1| phage SPO1 DNA polymerase-related protein [Acidiphilium cryptum
           JF-5]
          Length = 276

 Score =  119 bits (297), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 63/188 (33%), Positives = 91/188 (48%), Gaps = 3/188 (1%)

Query: 71  AQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSG 130
           A  A SL EL++ L +F  C L  T+   + A   E   +MIIG  P   ++  G+PF G
Sbjct: 68  APGAASLAELRAALDAFDQCALKRTATQLVFADGAEDARIMIIGEAPGGEEDRIGRPFVG 127

Query: 131 KTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKIL 190
             G +LDKML SI + R  + I  + PW PPGNR  S+ E+  C P + R I L+ P+ L
Sbjct: 128 PAGQLLDKMLGSIGLDRGTVRIVNVVPWRPPGNRTPSDTEIAQCLPFLHRHIALVRPERL 187

Query: 191 LFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTP--HSIIPTLATVHPQELIQYPLIKKNTW 248
           + +G              T    GKW  +        +  L T HP  L++ P  K+  W
Sbjct: 188 VLLGAVAVRALIGGKDGITRLR-GKWREVTIEGLDQTLRALPTYHPAYLLRQPAAKRLAW 246

Query: 249 HALITLKK 256
             L+ L++
Sbjct: 247 ADLLELRR 254


>gi|68171577|ref|ZP_00544951.1| Phage SPO1 DNA polymerase-related protein [Ehrlichia chaffeensis
           str. Sapulpa]
 gi|88657868|ref|YP_506904.1| uracil-DNA glycosylase [Ehrlichia chaffeensis str. Arkansas]
 gi|67999003|gb|EAM85680.1| Phage SPO1 DNA polymerase-related protein [Ehrlichia chaffeensis
           str. Sapulpa]
 gi|88599325|gb|ABD44794.1| uracil-DNA glycosylase, family 4 [Ehrlichia chaffeensis str.
           Arkansas]
          Length = 261

 Score =  119 bits (297), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 75/271 (27%), Positives = 132/271 (48%), Gaps = 26/271 (9%)

Query: 7   LSQEQILTIALFYADSGV--------YWVFDEPN------NEATYESQRKEKSIDSAIQP 52
           +S   +L +  FY ++G+        Y VF   N      ++  Y  + K+ SI      
Sbjct: 1   MSDLDLLEVLKFYHENGIDCTLEDVQYNVFTSKNLSLQNSSDTGYCMKEKQASIK----- 55

Query: 53  ITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMI 112
                +     + +A S+A++  ++ +LKS + SF  C + + + +T+ A       +M+
Sbjct: 56  ----ENTEDYYLLKAQSLAEQCNTIEQLKSAVESFDGCDIKNLATNTVFADGNPKARVML 111

Query: 113 IGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEME 172
           IG  P  ++++ G PF G +G +LDKMLQ+I   RT ++IS    W PPGNR  ++ E+ 
Sbjct: 112 IGEAPGANEDLKGIPFCGASGMLLDKMLQAIGFDRTTVYISNAVFWRPPGNRRPTDFEIA 171

Query: 173 ICRPIIMRQIELISPKILLFIGNKTKNFFFN--NDAQKTYQNLGKWSNLCTPHSIIPTLA 230
           +C+P + + I LI P++L+ +G+       +  N   +       +SN    HSI  T  
Sbjct: 172 VCKPFVEKHIALIVPQMLVLVGSTACYAMLDSKNPISRLRGRFHSYSNQFLQHSIT-TGI 230

Query: 231 TVHPQELIQYPLIKKNTWHALITLKKALKNL 261
             HP  L++ P+ K+  W  L  +K+    L
Sbjct: 231 IFHPSYLLRQPMQKRLAWEDLKQIKRYFDTL 261


>gi|114328513|ref|YP_745671.1| uracil DNA glycosylase superfamily protein [Granulibacter
           bethesdensis CGDNIH1]
 gi|114316687|gb|ABI62747.1| uracil DNA glycosylase superfamily protein [Granulibacter
           bethesdensis CGDNIH1]
          Length = 282

 Score =  118 bits (296), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 61/191 (31%), Positives = 102/191 (53%), Gaps = 4/191 (2%)

Query: 73  KACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKT 132
           +A +L  L++ +  F  C L +T+   + +  T    LM+IG  P   ++ +GKPF G +
Sbjct: 93  EASTLDALRAAMEQFDACPLKATATQLVFSDGTYEAGLMLIGEAPGAEEDRAGKPFVGPS 152

Query: 133 GNMLDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILL 191
           G  LD+ML S  + R +   I+ + PW PPGNRN +  E+  C P ++R I L  P++L+
Sbjct: 153 GKFLDRMLASAGMTRERDFVIANLIPWRPPGNRNPTETEILQCLPFLLRHIALARPRMLV 212

Query: 192 FIGNKTKNFFFNNDAQKTYQNLGKWSNLCTP--HSIIPTLATVHPQELIQYPLIKKNTWH 249
            +G  +      +      +  GKW+++  P   S +P L  +HP  L++ P  K+  W 
Sbjct: 213 CLGGVSAKALTGSTV-GIRRLRGKWTDITIPGLDSPLPMLPMLHPAYLLRNPGAKREAWA 271

Query: 250 ALITLKKALKN 260
            ++TL+KAL  
Sbjct: 272 DILTLRKALDG 282


>gi|326402981|ref|YP_004283062.1| uracil-DNA glycosylase [Acidiphilium multivorum AIU301]
 gi|325049842|dbj|BAJ80180.1| uracil-DNA glycosylase [Acidiphilium multivorum AIU301]
          Length = 276

 Score =  118 bits (295), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 62/188 (32%), Positives = 90/188 (47%), Gaps = 3/188 (1%)

Query: 71  AQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSG 130
           A  A S  EL++ L +F  C L  T+   + A   E   +MIIG  P   ++  G+PF G
Sbjct: 68  APGAASFAELRAALEAFDQCALKRTATQLVFADGAEDARIMIIGEAPGGEEDRIGRPFVG 127

Query: 131 KTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKIL 190
             G +LDKML SI + R  + I  + PW PPGNR  S+ E+  C P + R I L+ P+ L
Sbjct: 128 PAGQLLDKMLGSIGLDRGTVRIVNVVPWRPPGNRTPSDTEIAQCLPFLHRHIALVRPERL 187

Query: 191 LFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTP--HSIIPTLATVHPQELIQYPLIKKNTW 248
           + +G              T    GKW  +        +  L T HP  L++ P  K+  W
Sbjct: 188 VLLGAVAVRALIGGKDGITRLR-GKWREVTIEGLDQTLRALPTYHPAYLLRQPAAKRLAW 246

Query: 249 HALITLKK 256
             L+ L++
Sbjct: 247 ADLLELRR 254


>gi|240141067|ref|YP_002965547.1| putative phage DNA polymerase [Methylobacterium extorquens AM1]
 gi|240011044|gb|ACS42270.1| putative phage DNA polymerase [Methylobacterium extorquens AM1]
          Length = 337

 Score =  118 bits (295), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 63/183 (34%), Positives = 92/183 (50%), Gaps = 14/183 (7%)

Query: 85  RSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIE 144
           R F  C L  T+ + + A       +M +G  P   ++  GKPF G++G +LD+M+ +I 
Sbjct: 157 RGFEGCGLRFTAKNLVFADGNPQARVMFVGEAPGADEDRIGKPFMGRSGQLLDRMMAAIG 216

Query: 145 IMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG-------NKT 197
           + RT  +IS + PW PPGNRN +  E+ ICRP + RQIEL +P IL+ +G         T
Sbjct: 217 LDRTSAYISNVVPWRPPGNRNPTPQEISICRPFVERQIELANPDILVCLGAPATQTLTGT 276

Query: 198 KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKA 257
           K+       +     LG           I  LAT+HP  L++ P+ K+  W     LK A
Sbjct: 277 KDGILKARGRFYPYRLGDGRE-------IRALATLHPAYLLRQPVQKRLAWRDFRMLKSA 329

Query: 258 LKN 260
           L  
Sbjct: 330 LDG 332


>gi|254563580|ref|YP_003070675.1| phage DNA polymerase [Methylobacterium extorquens DM4]
 gi|254270858|emb|CAX26863.1| putative phage DNA polymerase [Methylobacterium extorquens DM4]
          Length = 344

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 63/183 (34%), Positives = 92/183 (50%), Gaps = 14/183 (7%)

Query: 85  RSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIE 144
           R F  C L  T+ + + A       +M +G  P   ++  GKPF G++G +LD+M+ +I 
Sbjct: 164 RGFEGCGLRFTAKNLVFADGNPQARVMFVGEAPGADEDRIGKPFMGRSGQLLDRMMAAIG 223

Query: 145 IMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG-------NKT 197
           + RT  +IS + PW PPGNRN +  E+ ICRP + RQIEL +P IL+ +G         T
Sbjct: 224 LDRTSAYISNVVPWRPPGNRNPTPQEISICRPFVERQIELANPDILVCLGAPATQTLTGT 283

Query: 198 KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKA 257
           K+       +     LG           I  LAT+HP  L++ P+ K+  W     LK A
Sbjct: 284 KDGILKARGRFYPYRLGDGRE-------IRALATLHPAYLLRQPVQKRLAWRDFRMLKSA 336

Query: 258 LKN 260
           L  
Sbjct: 337 LDG 339


>gi|163732348|ref|ZP_02139794.1| uracil-DNA glycosylase, C-terminal [Roseobacter litoralis Och 149]
 gi|161394646|gb|EDQ18969.1| uracil-DNA glycosylase, C-terminal [Roseobacter litoralis Och 149]
          Length = 261

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 59/201 (29%), Positives = 102/201 (50%), Gaps = 10/201 (4%)

Query: 64  VQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNI 123
           V+ A   A  A  L +L++ L +F  C L   + + + +    G  +MIIG  P   +++
Sbjct: 66  VEAARKAALGAQDLEQLRAALAAFDHCDLKRGARNLVFSDGVAGAKVMIIGEAPGREEDM 125

Query: 124 SGKPFSGKTGNMLDKMLQSIEIMRTQ----IHISMISPWHPPGNRNLSNIEMEICRPIIM 179
            G+PF G+ G +LD+ML +I++ R      ++I+ + PW PP NR+ S+ E+ + RP + 
Sbjct: 126 QGRPFVGRAGQLLDRMLAAIDMGREHQSDPVYITNVLPWRPPQNRDPSSEEIAMMRPFVE 185

Query: 180 RQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ 239
           R I L  P++L+ +GN +             +  G W         +P L   HP  L++
Sbjct: 186 RHIALAKPQVLVIMGNISAQTLLGKRGITRLR--GHWVEAFG----VPALPMFHPAYLLR 239

Query: 240 YPLIKKNTWHALITLKKALKN 260
            P  K+  W  L++L+  L+N
Sbjct: 240 TPTAKREAWADLLSLQARLQN 260


>gi|73666677|ref|YP_302693.1| DNA polymerase-related protein [Ehrlichia canis str. Jake]
 gi|72393818|gb|AAZ68095.1| DNA polymerase-related protein [Ehrlichia canis str. Jake]
          Length = 261

 Score =  116 bits (291), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 61/198 (30%), Positives = 109/198 (55%), Gaps = 3/198 (1%)

Query: 66  QADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISG 125
           +A S+A+K  ++ +LKS + SF  C + + + +T+ A      ++M+IG  P  ++++ G
Sbjct: 65  KAQSLAEKCNNIEQLKSAIESFDGCDIKNLATNTVFADGNPKAEMMLIGEAPGANEDLKG 124

Query: 126 KPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELI 185
            PF G +G +LDKML++I   RT ++IS    W PPGNR  ++ E+ +C+P + + I LI
Sbjct: 125 IPFCGASGMLLDKMLKAIGFDRTTVYISNAVFWRPPGNRRPTDFEIAVCKPFVEKHIALI 184

Query: 186 SPKILLFIGNKTKNFFFN--NDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLI 243
            PK+L+ +G+       +  N   K       ++N    +SI  ++   HP  L++ P+ 
Sbjct: 185 IPKMLVLVGSTACYAMLDSKNPISKLRGRFHLYNNQFLQNSITTSI-IFHPSYLLRQPMQ 243

Query: 244 KKNTWHALITLKKALKNL 261
           K+  W  L  +K+    L
Sbjct: 244 KRIAWEDLKQIKRYFDGL 261


>gi|51474012|ref|YP_067769.1| DNA polymerase [Rickettsia typhi str. Wilmington]
 gi|51460324|gb|AAU04287.1| DNA polymerase, bacteriophage-type [Rickettsia typhi str.
           Wilmington]
          Length = 258

 Score =  116 bits (290), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 66/199 (33%), Positives = 111/199 (55%), Gaps = 12/199 (6%)

Query: 69  SIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPF 128
           S+A KA ++ EL+  L +F+ C L   + +T+         +M+IG  P +++++ G PF
Sbjct: 60  SLADKANNIAELRESLLNFNGCELKKFATNTVFGDGNPQAKIMLIGEAPGNTEDLKGIPF 119

Query: 129 SGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISP 187
            G++GN+LD ML +I I R    +I+ +  W PP NR  +  E++ICRP + + I LI+P
Sbjct: 120 CGESGNLLDNMLYAIGISRKNNFYITNMVFWRPPANRQPTLEEVDICRPFVEKHIALINP 179

Query: 188 KILLFIGNKT------KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
           K+L+ +G+        KN       Q+ Y    K+  + TP   I T A  HP  L++ P
Sbjct: 180 KLLILVGSTAATSLLGKNSCITKIRQEYYFYTNKY--ISTP---IQTTAIFHPAYLLRQP 234

Query: 242 LIKKNTWHALITLKKALKN 260
           + K+ +W+ L+ +K+ L N
Sbjct: 235 MQKRTSWYDLLKIKEYLVN 253


>gi|254511671|ref|ZP_05123738.1| uracil-DNA glycosylase [Rhodobacteraceae bacterium KLH11]
 gi|221535382|gb|EEE38370.1| uracil-DNA glycosylase [Rhodobacteraceae bacterium KLH11]
          Length = 257

 Score =  116 bits (290), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 58/194 (29%), Positives = 101/194 (52%), Gaps = 7/194 (3%)

Query: 67  ADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGK 126
           A  +A+ A SL  L++ + +F  C L   +   + A  T G  +MIIG  P   ++  GK
Sbjct: 67  AQQVAKSAGSLPALQAAMDAFEHCDLKRGARQLVFADGTPGARVMIIGEAPGRDEDREGK 126

Query: 127 PFSGKTGNMLDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELI 185
           PF G+ G +LD+ML +I++ R Q ++I+ + PW PP NR+    E+ + +P + R + L 
Sbjct: 127 PFVGRAGQLLDRMLAAIDLDRKQNVYITNVLPWRPPQNRDPKPEEIGMMKPFLERHVALA 186

Query: 186 SPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKK 245
            P++L+ +GN +         +   +  G+W         +P +   HP  L++ P +K+
Sbjct: 187 QPEVLVVMGNISCQAVLGK--RGITRLRGRWDQALN----LPVIPMFHPAYLLRQPQMKR 240

Query: 246 NTWHALITLKKALK 259
             W  L+ LK  L+
Sbjct: 241 QAWADLLELKSRLE 254


>gi|239948113|ref|ZP_04699866.1| uracil-DNA glycosylase, family 4 [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239922389|gb|EER22413.1| uracil-DNA glycosylase, family 4 [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 304

 Score =  115 bits (288), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 76/245 (31%), Positives = 126/245 (51%), Gaps = 18/245 (7%)

Query: 29  DEPNNEATYESQRKEKSIDSAIQ--------PITNIRHIHSPLVQQADSIAQKACSLHEL 80
           D  +  A Y S R++ S  S  +         I+N + +H   +  A S+A KA ++ EL
Sbjct: 60  DTEHRTAAYTSVREDSSTGSTYKLPLEVEFGKISNDK-VHDN-ITLARSLADKANNIEEL 117

Query: 81  KSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKML 140
           K  L +F+ C L   + +T+         +M+IG  P   +++ G PF G++GN+LD ML
Sbjct: 118 KESLLNFNGCELKKFATNTVFGDGNLEAKIMLIGEAPGSIEDLKGIPFCGESGNLLDNML 177

Query: 141 QSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKN 199
            +I I R    +I+    W PP NR  +  E++ICRP + + I LI+PK+++ +G+    
Sbjct: 178 HAIGISRKNNAYITNTVFWRPPANRQPTLEEVDICRPFVEKHIALINPKLIILVGSTAAT 237

Query: 200 FFF--NNDAQKTYQNLGKWSN--LCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
                N+   K  Q    ++N  L  P   I T A  HP  L++ P+ K+ +W+ L+ +K
Sbjct: 238 SLLGKNSGITKIRQEYYFYTNKYLSAP---IQTTAIFHPAYLLRQPMQKRTSWYDLLKIK 294

Query: 256 KALKN 260
           + L N
Sbjct: 295 EYLVN 299


>gi|67459732|ref|YP_247356.1| uracil-DNA glycosylase [Rickettsia felis URRWXCal2]
 gi|67005265|gb|AAY62191.1| Uracil-DNA glycosylase, family 4 [Rickettsia felis URRWXCal2]
          Length = 262

 Score =  115 bits (288), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 66/199 (33%), Positives = 109/199 (54%), Gaps = 8/199 (4%)

Query: 67  ADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGK 126
           A S+A KA ++ ELK  L +F+ C L   + +T+         +M+IG  P  ++++ G 
Sbjct: 61  ARSLADKANNIEELKESLLNFNGCELKKFATNTVFGDGNLEAKIMLIGEAPGSTEDLKGI 120

Query: 127 PFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELI 185
           PF G++GN+LD ML +I I R    +I+    W PP NR  +  E++ICRP + + I LI
Sbjct: 121 PFCGESGNLLDNMLYAIGISRKNNAYITNTVFWRPPANRQPTLEEVDICRPFVEKHIALI 180

Query: 186 SPKILLFIGNKTKNFFF--NNDAQKTYQNLGKWSN--LCTPHSIIPTLATVHPQELIQYP 241
           +PK+++ +G+         N+   K  Q    ++N  L  P   I T A  HP  L++ P
Sbjct: 181 NPKLIILVGSTAATSLLGKNSGITKIRQEYYFYTNKYLSAP---IQTTAIFHPAYLLRQP 237

Query: 242 LIKKNTWHALITLKKALKN 260
           + K+ +W+ L+ +K+ L N
Sbjct: 238 MQKRTSWYDLLKIKEYLVN 256


>gi|34581100|ref|ZP_00142580.1| N-terminus of bacteriophage-type DNA polymerase [Rickettsia
           sibirica 246]
 gi|238651090|ref|YP_002916948.1| N-terminus of bacteriophage-type DNA polymerase [Rickettsia
           peacockii str. Rustic]
 gi|28262485|gb|EAA25989.1| N-terminus of bacteriophage-type DNA polymerase [Rickettsia
           sibirica 246]
 gi|238625188|gb|ACR47894.1| N-terminus of bacteriophage-type DNA polymerase [Rickettsia
           peacockii str. Rustic]
          Length = 261

 Score =  115 bits (288), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 65/199 (32%), Positives = 109/199 (54%), Gaps = 8/199 (4%)

Query: 67  ADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGK 126
           A S+A KA ++ ELK  L +F+ C L   + +T+         +M+IG  P  ++++ G 
Sbjct: 61  ARSLADKANNIEELKESLLNFNGCELKKFATNTVFGDGNLEAKIMLIGEAPGSTEDLKGI 120

Query: 127 PFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELI 185
           PF G++GN+LD ML +I I R    +I+    W PP NR  +  E++ICRP + + I LI
Sbjct: 121 PFYGESGNLLDNMLHAIGISRKNNAYITNTVFWRPPANRQPTFEEVDICRPFVEKHIALI 180

Query: 186 SPKILLFIGNKTKNFFF--NNDAQKTYQNLGKWSN--LCTPHSIIPTLATVHPQELIQYP 241
           +P++++ +G+         N+   K  Q    ++N  L  P   I T A  HP  L++ P
Sbjct: 181 NPQLIILVGSTAATSLLGKNSGITKIRQEYYFYTNKYLSAP---IQTTAIFHPAYLLRQP 237

Query: 242 LIKKNTWHALITLKKALKN 260
           + K+ +W+ L+ +K+ L N
Sbjct: 238 MQKRTSWYDLLKIKEYLVN 256


>gi|148284759|ref|YP_001248849.1| Uracil-DNA glycosylase [Orientia tsutsugamushi str. Boryong]
 gi|146740198|emb|CAM80476.1| Uracil-DNA glycosylase [Orientia tsutsugamushi str. Boryong]
          Length = 268

 Score =  115 bits (288), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 65/214 (30%), Positives = 112/214 (52%), Gaps = 4/214 (1%)

Query: 46  IDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQT 105
           ID       N ++ H  ++  +  +A    +L +LKS + SF  C L  T+L+T+     
Sbjct: 47  IDQNSAGFNNNQNTHLAVLSDSRQLADSVHTLEDLKSSVTSFDGCLLKKTALNTVFGDGI 106

Query: 106 EGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ-IHISMISPWHPPGNR 164
               +M+IG  P  +++  G PF G++G +LD MLQSI + RT+ ++I+    W PP NR
Sbjct: 107 PSAPIMLIGEAPGQNEDKHGIPFCGESGKLLDNMLQSINLSRTKNVYITNTVFWRPPANR 166

Query: 165 NLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQ--KTYQNLGKWSNLCTP 222
             ++ E+ ICRP + + I +I+PK+++ +G+        +  +  K  Q    + N C  
Sbjct: 167 RPTSDELVICRPFVEKHIAIINPKLIILVGSTAATSMLGDHVKISKIRQEYFLYKN-CYL 225

Query: 223 HSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
              IP  A  HP  +++ PL KK  W  L+ +++
Sbjct: 226 TFSIPITAIFHPAYMLRQPLQKKACWFDLLKIQQ 259


>gi|15893232|ref|NP_360946.1| N-terminus of bacteriophage-type DNA polymerase [Rickettsia conorii
           str. Malish 7]
 gi|15620449|gb|AAL03847.1| N-terminus of bacteriophage-type DNA polymerase [Rickettsia conorii
           str. Malish 7]
          Length = 279

 Score =  115 bits (287), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 65/199 (32%), Positives = 109/199 (54%), Gaps = 8/199 (4%)

Query: 67  ADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGK 126
           A S+A KA ++ ELK  L +F+ C L   + +T+         +M+IG  P  ++++ G 
Sbjct: 79  ARSLADKANNIEELKESLLNFNGCELKKFATNTVFGDGNLEAKIMLIGEAPGSTEDLKGI 138

Query: 127 PFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELI 185
           PF G++GN+LD ML +I I R    +I+    W PP NR  +  E++ICRP + + I LI
Sbjct: 139 PFYGESGNLLDNMLHAIGISRKNNAYITNTVFWRPPANRQPTFEEVDICRPFVEKHIALI 198

Query: 186 SPKILLFIGNKTKNFFF--NNDAQKTYQNLGKWSN--LCTPHSIIPTLATVHPQELIQYP 241
           +P++++ +G+         N+   K  Q    ++N  L  P   I T A  HP  L++ P
Sbjct: 199 NPQLIILVGSTAATSLLGKNSGITKIRQEYYFYTNKYLSAP---IQTTAIFHPAYLLRQP 255

Query: 242 LIKKNTWHALITLKKALKN 260
           + K+ +W+ L+ +K+ L N
Sbjct: 256 MQKRTSWYDLLKIKEYLVN 274


>gi|157964995|ref|YP_001499819.1| uracil-DNA glycosylase [Rickettsia massiliae MTU5]
 gi|157844771|gb|ABV85272.1| Uracil-DNA glycosylase, family 4 [Rickettsia massiliae MTU5]
          Length = 294

 Score =  115 bits (287), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 73/234 (31%), Positives = 122/234 (52%), Gaps = 11/234 (4%)

Query: 32  NNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCH 91
           N E T + Q K KS       + +  H +  L   + S+A KA ++ ELK  L +F+ C 
Sbjct: 62  NTELTEKPQVKLKSTKETAFNMNDKVHENITL---SRSLADKANNIEELKESLLNFNGCE 118

Query: 92  LCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQI 150
           L   + +T+         +M+IG  P  ++++ G PF G++GN+LD ML +I I R    
Sbjct: 119 LKKFATNTVFGDGNLEAKIMLIGEAPGSTEDLKGIPFYGESGNLLDNMLHAIGISRKNNA 178

Query: 151 HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFF--NNDAQK 208
           +I+    W PP NR  +  E++ICRP + + I LI+PK+++ +G+         N+   K
Sbjct: 179 YITNTVFWRPPANRQPTFEEVDICRPFVEKHIALINPKLIILVGSTAATSLLGKNSGITK 238

Query: 209 TYQNLGKWSN--LCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
             Q    ++N  L  P   I T A  HP  L++ P+ K+ +W+ L+ +K+ + N
Sbjct: 239 IRQEYYFYTNKYLSAP---IQTTAIFHPAYLLRQPMQKRTSWYDLLKIKEYVVN 289


>gi|157829143|ref|YP_001495385.1| N-terminus of bacteriophage-type DNA polymerase [Rickettsia
           rickettsii str. 'Sheila Smith']
 gi|165933872|ref|YP_001650661.1| uracil DNA glycosylase superfamily protein [Rickettsia rickettsii
           str. Iowa]
 gi|157801624|gb|ABV76877.1| N-terminus of bacteriophage-type DNA polymerase [Rickettsia
           rickettsii str. 'Sheila Smith']
 gi|165908959|gb|ABY73255.1| uracil DNA glycosylase superfamily protein [Rickettsia rickettsii
           str. Iowa]
          Length = 261

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 65/199 (32%), Positives = 108/199 (54%), Gaps = 8/199 (4%)

Query: 67  ADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGK 126
           A S+A KA ++ ELK  L  F+ C L   + +T+         +M+IG  P  ++++ G 
Sbjct: 61  ARSLADKANNIEELKESLLHFNGCELKKFATNTVFGDGNLEAKIMLIGEAPGSTEDLKGI 120

Query: 127 PFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELI 185
           PF G++GN+LD ML +I I R    +I+    W PP NR  +  E++ICRP + + I LI
Sbjct: 121 PFYGESGNLLDNMLHAIGISRKNNAYITNTVFWRPPANRQPTFEEVDICRPFVEKHIALI 180

Query: 186 SPKILLFIGNKTKNFFF--NNDAQKTYQNLGKWSN--LCTPHSIIPTLATVHPQELIQYP 241
           +P++++ +G+         N+   K  Q    ++N  L  P   I T A  HP  L++ P
Sbjct: 181 NPQLIILVGSTAATSLLGKNSGITKIRQEYYFYTNKYLSAP---IQTTAIFHPAYLLRQP 237

Query: 242 LIKKNTWHALITLKKALKN 260
           + K+ +W+ L+ +K+ L N
Sbjct: 238 MQKRTSWYDLLKIKEYLVN 256


>gi|56695203|ref|YP_165551.1| uracil-DNA glycosylase [Ruegeria pomeroyi DSS-3]
 gi|56676940|gb|AAV93606.1| uracil-DNA glycosylase [Ruegeria pomeroyi DSS-3]
          Length = 261

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 56/198 (28%), Positives = 101/198 (51%), Gaps = 7/198 (3%)

Query: 64  VQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNI 123
            Q+A   A+   SL  L++ L  F  C L   + + + A    G  +MIIG  P   ++ 
Sbjct: 69  AQEAVRAARAVGSLDALRTALAEFEHCELKRGARNLVFADGVPGARVMIIGEAPGRDEDR 128

Query: 124 SGKPFSGKTGNMLDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQI 182
            G+PF G+ G +LD+ML +I + R++ ++I+ + PW PP NR+   +E+ + +P + R +
Sbjct: 129 EGRPFVGRAGQLLDRMLAAIGLSRSESVYITNVLPWRPPQNRDPLPVEIGMMKPFLERHV 188

Query: 183 ELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPL 242
            L  P++L+ +GN +             +  G+W+        +P L   HP  L++ P 
Sbjct: 189 ALAKPEVLVLMGNISCETVLGRRGITRLR--GQWTQAMG----LPVLPMFHPAYLLRQPQ 242

Query: 243 IKKNTWHALITLKKALKN 260
           +K+  W  L+ L+  L+ 
Sbjct: 243 MKRQAWADLLELQAKLRE 260


>gi|189183624|ref|YP_001937409.1| bacteriophage-type DNA polymerase [Orientia tsutsugamushi str.
           Ikeda]
 gi|189180395|dbj|BAG40175.1| bacteriophage-type DNA polymerase [Orientia tsutsugamushi str.
           Ikeda]
          Length = 268

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 63/205 (30%), Positives = 110/205 (53%), Gaps = 4/205 (1%)

Query: 55  NIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIG 114
           N ++ H  ++  +  +A    +L +LKS + SF  C L  T+L+T+         +M+IG
Sbjct: 56  NNQNTHLAVLSNSRQLADSVHTLEDLKSSVTSFDGCLLKKTALNTVFGDGIPSAQIMLIG 115

Query: 115 YTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEI 173
             P  +++  G PF G++G +LD MLQSI + RT+ ++I+    W PP NR  ++ E+ I
Sbjct: 116 EAPGQNEDKHGIPFCGESGKLLDNMLQSINLSRTKNVYITNTVFWRPPANRRPTSDELVI 175

Query: 174 CRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQ--KTYQNLGKWSNLCTPHSIIPTLAT 231
           CRP + + I +I+PK+++ +G+        +  +  K  Q    + N C     IP  A 
Sbjct: 176 CRPFVEKHIAIINPKLIILVGSTAATSMLGDHVKISKIRQEYFLYKN-CYLTFSIPITAI 234

Query: 232 VHPQELIQYPLIKKNTWHALITLKK 256
            HP  +++ PL KK  W  L+ +++
Sbjct: 235 FHPAYMLRQPLQKKACWFDLLKIQQ 259


>gi|157826560|ref|YP_001495624.1| Uracil-DNA glycosylase [Rickettsia bellii OSU 85-389]
 gi|157801864|gb|ABV78587.1| Uracil-DNA glycosylase [Rickettsia bellii OSU 85-389]
          Length = 263

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 66/207 (31%), Positives = 111/207 (53%), Gaps = 14/207 (6%)

Query: 64  VQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNI 123
           +  A S+A KA ++ ELK  L +F+ C L   + +T+         +M+IG  P  ++++
Sbjct: 59  ISLARSLADKANNIAELKESLLNFNGCDLKKLATNTVFGDGNPAAKIMLIGEAPGSNEDL 118

Query: 124 SGKPFSGKTGNMLDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQI 182
            G PF G++GN+LD ML++I I R    +I+    W PP NR  +  E+++CRP + + I
Sbjct: 119 KGIPFCGESGNLLDNMLRAIGISRKDNAYITNTVFWRPPANRQPTLEEVDVCRPFVEKHI 178

Query: 183 ELISPKILLFIGNKTKNFFFNNDA------QKTYQNLGKWSNLCTPHSIIPTLATVHPQE 236
            L++PK+++ +G+         +A      Q+ Y    K+  L  P   I T A  HP  
Sbjct: 179 ALVNPKLIILVGSTAATSLLGKNAGITKIRQEYYFYTNKY--LAAP---IQTTAMFHPAY 233

Query: 237 LIQYPLIKKNTWHALITLKKAL--KNL 261
           L++ P  K+ +W+ L+ +K  L  KNL
Sbjct: 234 LLRQPSQKRTSWYDLLKIKDYLESKNL 260


>gi|91206062|ref|YP_538417.1| Uracil-DNA glycosylase [Rickettsia bellii RML369-C]
 gi|91069606|gb|ABE05328.1| Uracil-DNA glycosylase [Rickettsia bellii RML369-C]
          Length = 262

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 66/205 (32%), Positives = 111/205 (54%), Gaps = 10/205 (4%)

Query: 64  VQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNI 123
           +  A S+A KA ++ ELK  L +F+ C L   + +T+         +M+IG  P  ++++
Sbjct: 58  ISLARSLADKADNIAELKESLLNFNGCDLKKLATNTVFGDGNPAAKIMLIGEAPGSNEDL 117

Query: 124 SGKPFSGKTGNMLDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQI 182
            G PF G++GN+LD ML++I I R    +I+    W PP NR  +  E+++CRP + + I
Sbjct: 118 KGIPFCGESGNLLDNMLRAIGISRKDNAYITNTVFWRPPANRQPTLEEVDVCRPFVEKHI 177

Query: 183 ELISPKILLFIGNKTKNFFFNNDA--QKTYQNLGKWSN--LCTPHSIIPTLATVHPQELI 238
            L++PK+++ +G+         +A   K  Q    ++N  L  P   I T A  HP  L+
Sbjct: 178 ALVNPKLIILVGSTAATSLLGKNAGITKIRQEYYFYTNKYLAAP---IQTTAMFHPAYLL 234

Query: 239 QYPLIKKNTWHALITLKKAL--KNL 261
           + P  K+ +W+ L+ +K  L  KNL
Sbjct: 235 RQPSQKRTSWYDLLKIKDYLESKNL 259


>gi|294675958|ref|YP_003576573.1| uracil-DNA glycosylase [Rhodobacter capsulatus SB 1003]
 gi|294474778|gb|ADE84166.1| uracil-DNA glycosylase [Rhodobacter capsulatus SB 1003]
          Length = 270

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 100/204 (49%), Gaps = 12/204 (5%)

Query: 64  VQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNI 123
           V  A  +A +A +L +L+  +  F  C L   + +T+         +M+IG  P   ++ 
Sbjct: 73  VAVARGLAARAATLDDLREAILGFDHCPLKRGARNTVFCDGNPKARVMLIGEAPGKDEDA 132

Query: 124 SGKPFSGKTGNMLDKMLQSIEIMR------TQIHISMISPWHPPGNRNLSNIEMEICRPI 177
            GKPF G+ G +LD+ML ++ + R      T ++I+ + PW PPGNR     E+ +  P 
Sbjct: 133 QGKPFVGRAGQLLDRMLAAVGLDRAAPDPGTAVYITNVMPWRPPGNREPEPAEIAMMGPF 192

Query: 178 IMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQEL 237
           + R +EL+ P +++ +GN       N+      +  G W+         P L T+HP  L
Sbjct: 193 LARHVELVDPDLIVLMGNTACAAALNSRGITRLR--GSWTQAFG----RPALPTLHPANL 246

Query: 238 IQYPLIKKNTWHALITLKKALKNL 261
           ++ P+ K+  W  L+ L+  L  L
Sbjct: 247 LRTPINKRLVWADLLELRAKLNAL 270


>gi|229587212|ref|YP_002845713.1| Uracil-DNA glycosylase, family 4 [Rickettsia africae ESF-5]
 gi|228022262|gb|ACP53970.1| Uracil-DNA glycosylase, family 4 [Rickettsia africae ESF-5]
          Length = 279

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 65/199 (32%), Positives = 108/199 (54%), Gaps = 8/199 (4%)

Query: 67  ADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGK 126
           A S+A KA ++ ELK  L +F+ C L   + +T+         +M+IG  P   +++ G 
Sbjct: 79  ARSLADKADNIEELKESLLNFNGCELKKFATNTVFGDGNLEAKIMLIGEAPGSIEDLKGI 138

Query: 127 PFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELI 185
           PF G++GN+LD ML +I I R    +I+    W PP NR  +  E++ICRP + + I LI
Sbjct: 139 PFYGESGNLLDNMLHAIGISRKNNAYITNTVFWRPPANRQPTFEEVDICRPFVEKHIALI 198

Query: 186 SPKILLFIGNKTKNFFF--NNDAQKTYQNLGKWSN--LCTPHSIIPTLATVHPQELIQYP 241
           +P++++ +G+         N+   K  Q    ++N  L  P   I T A  HP  L++ P
Sbjct: 199 NPQLIILVGSTAATSLLGKNSGITKIRQEYYFYTNKYLSAP---IQTTAIFHPAYLLRQP 255

Query: 242 LIKKNTWHALITLKKALKN 260
           + K+ +W+ L+ +K+ L N
Sbjct: 256 MQKRTSWYDLLKIKEYLVN 274


>gi|58616770|ref|YP_195969.1| hypothetical protein ERGA_CDS_00430 [Ehrlichia ruminantium str.
           Gardel]
 gi|58416382|emb|CAI27495.1| Conserved hypothetical protein [Ehrlichia ruminantium str. Gardel]
          Length = 263

 Score =  113 bits (283), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 69/265 (26%), Positives = 126/265 (47%), Gaps = 12/265 (4%)

Query: 7   LSQEQILTIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQ 66
           +S   +L    F+ ++GV  +  E  N+ +  +Q    ++      +       S L + 
Sbjct: 1   MSDSDLLEALKFFYENGVDCIL-ETENQVSISNQDTYLNLKGGNNDVEEYNMERSSLKED 59

Query: 67  AD--------SIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPS 118
           A+        S A++  +L EL+S +  F  C + + + +T+ +       +M+IG  P 
Sbjct: 60  AEAYYLLKAQSAAEQCSTLEELRSAIEYFDGCDIKNLATNTVFSDGNPNAKMMLIGEAPG 119

Query: 119 DSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPII 178
            +++I G PF G +G +L+KML++I   R  ++IS    W PPGNR  ++ E+ +CRP +
Sbjct: 120 ANEDIHGIPFCGNSGMLLNKMLEAIGFNRNTVYISNSVFWRPPGNRRPTDFEIAVCRPFV 179

Query: 179 MRQIELISPKILLFIGNKTKNFFFN--NDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQE 236
            + I L+ PK+L+ +G+       +  N   K       ++N    HSI  T    HP  
Sbjct: 180 EKHIALVMPKMLVLVGSTACYAILDSKNPISKLRGRFHMYNNRFLQHSIT-TGIIFHPSY 238

Query: 237 LIQYPLIKKNTWHALITLKKALKNL 261
           L++ P+ K+  W  L  ++     L
Sbjct: 239 LLRQPMQKRIAWEDLKQIRDCFNTL 263


>gi|57238783|ref|YP_179919.1| hypothetical protein Erum0530 [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58578708|ref|YP_196920.1| hypothetical protein ERWE_CDS_00440 [Ehrlichia ruminantium str.
           Welgevonden]
 gi|57160862|emb|CAH57764.1| putative uracil DNA glycosylase [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58417334|emb|CAI26538.1| Conserved hypothetical protein [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 263

 Score =  113 bits (282), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 69/265 (26%), Positives = 126/265 (47%), Gaps = 12/265 (4%)

Query: 7   LSQEQILTIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQ 66
           +S   +L    F+ ++GV  +  E  N+ +  +Q    ++      +       S L + 
Sbjct: 1   MSDSDLLEALKFFYENGVDCIL-ETENQVSISNQDTYLNLKGGNNDVEEYNMERSSLKED 59

Query: 67  AD--------SIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPS 118
           A+        S A++  +L EL+S +  F  C + + + +T+ +       +M+IG  P 
Sbjct: 60  AEAYYLLKAQSAAEQCSTLEELRSAIEYFDGCDIKNLATNTVFSDGNPNAKMMLIGEAPG 119

Query: 119 DSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPII 178
            +++I G PF G +G +L+KML++I   R  ++IS    W PPGNR  ++ E+ +CRP +
Sbjct: 120 ANEDIHGIPFCGTSGMLLNKMLEAIGFNRNTVYISNSVFWRPPGNRRPTDFEIAVCRPFV 179

Query: 179 MRQIELISPKILLFIGNKTKNFFFN--NDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQE 236
            + I L+ PK+L+ +G+       +  N   K       ++N    HSI  T    HP  
Sbjct: 180 EKHIALVMPKMLVLVGSTACYAILDSKNPISKLRGRFHMYNNRFLQHSIT-TGIIFHPSY 238

Query: 237 LIQYPLIKKNTWHALITLKKALKNL 261
           L++ P+ K+  W  L  ++     L
Sbjct: 239 LLRQPMQKRIAWEDLKQIRDCFNTL 263


>gi|99078039|ref|YP_611297.1| phage SPO1 DNA polymerase-related protein [Ruegeria sp. TM1040]
 gi|99035177|gb|ABF62035.1| phage SPO1 DNA polymerase-related protein [Ruegeria sp. TM1040]
          Length = 255

 Score =  112 bits (281), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 68/236 (28%), Positives = 112/236 (47%), Gaps = 8/236 (3%)

Query: 27  VFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRS 86
           + D P +    E Q K K   +A  P T ++      V +A  +A+ A +L  L++ L  
Sbjct: 26  MMDTPIDRYGLEDQ-KPKPARAADTPPTPVKPKTVDPVAEAAKLAKTAQALPSLRAALEQ 84

Query: 87  FHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIM 146
           F  C L   + + + +    G  +MIIG  P   +++ GKPF G+ G +LDKML +IE+ 
Sbjct: 85  FEHCDLKRGARNLVFSDGQAGARVMIIGEAPGRDEDLQGKPFVGRAGQLLDKMLDAIELS 144

Query: 147 RTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNND 205
           R + ++I+ + PW PP NR+    E+ +  P + R + L  P IL+ +GN +        
Sbjct: 145 REKNVYITNVLPWRPPQNRDPLPAEISMLVPFLERHVALAEPDILVLMGNISCQAVLGKR 204

Query: 206 AQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
                +  G WS         P +   HP  L++    K+  W  L+ L+  L +L
Sbjct: 205 GITRLR--GTWSEAWG----KPVIPMFHPAYLLRQAHAKRQAWADLLELRARLNSL 254


>gi|83313537|ref|YP_423801.1| Uracil-DNA glycosylase [Magnetospirillum magneticum AMB-1]
 gi|82948378|dbj|BAE53242.1| Uracil-DNA glycosylase [Magnetospirillum magneticum AMB-1]
          Length = 254

 Score =  112 bits (281), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 59/200 (29%), Positives = 97/200 (48%), Gaps = 3/200 (1%)

Query: 61  SPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDS 120
           S L   A  +A     L  L+  +  F    L   + ST+         +M IG  P   
Sbjct: 51  SALPGTAAHLAAGCADLQALRHAMEGFEGLQLKQAASSTVFGDGNPESAVMCIGEAPGQE 110

Query: 121 DNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMR 180
           ++  G PF G +G +LD+ML SI + R+  +I+ + PW PP NR  +  E+ +C P + R
Sbjct: 111 EDRRGLPFVGPSGKLLDRMLGSIGLDRSTCYITNVVPWRPPANRKPTPDEVAVCMPFLTR 170

Query: 181 QIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPH--SIIPTLATVHPQELI 238
            IEL+ P++L+ +G  +        A    +  G+W    +P     IP LAT HP  L+
Sbjct: 171 HIELVDPQVLILLGGASAAAVLAK-ADGINRLRGRWFEFNSPGLPRPIPALATFHPAYLL 229

Query: 239 QYPLIKKNTWHALITLKKAL 258
           + P  K++ W  L+ +++ +
Sbjct: 230 RTPEAKRDAWRDLLMIRRRM 249


>gi|171057063|ref|YP_001789412.1| phage SPO1 DNA polymerase-like protein [Leptothrix cholodnii SP-6]
 gi|170774508|gb|ACB32647.1| phage SPO1 DNA polymerase-related protein [Leptothrix cholodnii
           SP-6]
          Length = 294

 Score =  112 bits (280), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 103/203 (50%), Gaps = 11/203 (5%)

Query: 63  LVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDN 122
           L+Q A + A  A    EL++++ +   C LC +   T+          M++G  P + ++
Sbjct: 94  LIQAAPAGAVSALDWPELQAVVEACRACGLCESRRQTVFGVGHHQAHWMLVGEAPGEQED 153

Query: 123 ISGKPFSGKTGNMLDKMLQSIEIMR------TQIHISMISPWHPPGNRNLSNIEMEICRP 176
           + G+PF GK G +LD ML+++ + R       Q++I+ +    PPGNRN    E++ C P
Sbjct: 154 LQGEPFVGKAGQLLDNMLRAVGLTREQAEPARQVYIANVLKCRPPGNRNPDPQEVQRCEP 213

Query: 177 IIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQE 236
            + RQ+EL+ P+++L +G      F      KT + +G+       +  +P + T HP  
Sbjct: 214 FLQRQVELVRPRLILAMGR-----FAVQSLLKTSEPIGRLRGKSHHYHGVPVVVTYHPAY 268

Query: 237 LIQYPLIKKNTWHALITLKKALK 259
           L++ PL K   W  L   ++ ++
Sbjct: 269 LLRNPLDKARAWEDLCLARELIQ 291


>gi|209543453|ref|YP_002275682.1| phage SPO1 DNA polymerase-like protein [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209531130|gb|ACI51067.1| phage SPO1 DNA polymerase-related protein [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 274

 Score =  112 bits (280), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 89/174 (51%), Gaps = 3/174 (1%)

Query: 87  FHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIM 146
           F  C L  T+  T+      G  L++IG  P  +++ SG  F+G  G +LD+ML SI + 
Sbjct: 95  FGGCALRDTATHTVVPEGPAGARLLLIGEPPDAAEDRSGTAFAGPAGQILDRMLTSIGLA 154

Query: 147 RTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDA 206
           RT + ++ + PW PPG R  S  E++IC P + R I L +P+ ++ +GN T       + 
Sbjct: 155 RTDMLLAPVIPWRPPGERPPSAAELQICAPFLHRLIVLANPRRIILMGN-TPARLLTGEQ 213

Query: 207 QKTYQNLGKWSNLCTP--HSIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
               +  G+W ++  P     IP L   HP +L   P  +++ W  ++ L+  L
Sbjct: 214 GGIARLRGRWRDVAIPGLGRAIPILPMRHPSQLGASPAARRDAWKDIVLLRTTL 267


>gi|88608041|ref|YP_506799.1| uracil-DNA glycosylase [Neorickettsia sennetsu str. Miyayama]
 gi|88600210|gb|ABD45678.1| uracil-DNA glycosylase, family 4 [Neorickettsia sennetsu str.
           Miyayama]
          Length = 255

 Score =  112 bits (279), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 66/211 (31%), Positives = 112/211 (53%), Gaps = 13/211 (6%)

Query: 53  ITNIRHIHSPLVQQADSIAQK----------ACSLHELKSLLRSFHDCHLCSTSLSTICA 102
           IT +  +   + + A+S A+K            +L ELK+L+ +F  C L  ++ +T+  
Sbjct: 34  ITQVGGMPIDMKESAESTARKHKTPERDLTYVTTLGELKALVYNFEGCQLKKSAKNTVFC 93

Query: 103 TQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPG 162
                  +M+IG  P + ++  G PF G++GN+LDKMLQ+I + RT+++I+    W PPG
Sbjct: 94  DGNPDAKIMLIGEAPGEQEDKLGIPFCGRSGNLLDKMLQAIGLDRTKVYITNAVFWRPPG 153

Query: 163 NRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNN-DAQKTYQN-LGKWSNLC 220
           NR  +  E+EIC+P +   I L+ PK+++ +G+   +    + D   T +N L ++ N  
Sbjct: 154 NRRPTPEEIEICKPFLEHHIRLVLPKLIVLLGSTAASSVLKSQDRISTLRNKLHEYKNPF 213

Query: 221 TPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
               I  T+   HP  L++ P  KK  W  L
Sbjct: 214 IREGITTTV-MFHPSYLLRQPAQKKLAWEDL 243


>gi|162146549|ref|YP_001601008.1| uracil-DNA glycosylase [Gluconacetobacter diazotrophicus PAl 5]
 gi|161785124|emb|CAP54669.1| putative uracil-DNA glycosylase [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 309

 Score =  112 bits (279), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 89/174 (51%), Gaps = 3/174 (1%)

Query: 87  FHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIM 146
           F  C L  T+  T+      G  L++IG  P  +++ SG  F+G  G +LD+ML SI + 
Sbjct: 130 FGGCALRDTATHTVVPEGPAGARLLLIGEPPDAAEDRSGTAFAGPAGQILDRMLTSIGLA 189

Query: 147 RTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDA 206
           RT + ++ + PW PPG R  S  E++IC P + R I L +P+ ++ +GN T       + 
Sbjct: 190 RTDMLLAPVIPWRPPGERPPSAAELQICAPFLHRLIVLANPRRIILMGN-TPARLLTGEQ 248

Query: 207 QKTYQNLGKWSNLCTP--HSIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
               +  G+W ++  P     IP L   HP +L   P  +++ W  ++ L+  L
Sbjct: 249 GGIARLRGRWRDVAIPGLGRAIPILPMRHPSQLGASPAARRDAWKDIVLLRTTL 302


>gi|254487011|ref|ZP_05100216.1| uracil-DNA glycosylase, C-terminal domain protein [Roseobacter sp.
           GAI101]
 gi|214043880|gb|EEB84518.1| uracil-DNA glycosylase, C-terminal domain protein [Roseobacter sp.
           GAI101]
          Length = 257

 Score =  112 bits (279), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 97/187 (51%), Gaps = 10/187 (5%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L +L++ +++F  C L   + + + +  T G  +MI+G  P   ++  G+PF G  G +
Sbjct: 74  TLEDLRAAMQAFEHCELKRGARNMVFSDGTPGARVMIVGEAPGRDEDREGRPFVGAAGQL 133

Query: 136 LDKMLQSIEIMRTQ----IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILL 191
           LD+ML +I++ RT     ++I+ + PW PP NR+    E+ + +P ++R IEL  P++L+
Sbjct: 134 LDRMLAAIDMGRTHADAPVYITNVLPWRPPQNRDPKPDEIAMMKPFLIRHIELAKPEVLV 193

Query: 192 FIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
            +GN               +  G+W+ +      +  L   HP  L++ P  K+  W  L
Sbjct: 194 IVGNWAAQALLGKRGITRLR--GQWAQVQG----LAALPMFHPAYLLRSPEFKREAWADL 247

Query: 252 ITLKKAL 258
           + LK  L
Sbjct: 248 LELKARL 254


>gi|114570739|ref|YP_757419.1| phage SPO1 DNA polymerase-like protein [Maricaulis maris MCS10]
 gi|114341201|gb|ABI66481.1| phage SPO1 DNA polymerase-related protein [Maricaulis maris MCS10]
          Length = 286

 Score =  111 bits (278), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 62/199 (31%), Positives = 96/199 (48%), Gaps = 8/199 (4%)

Query: 67  ADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGK 126
           A S+A KA SL  L+  + +F  C L  T+ +T+ A       +M++G  P   ++  G+
Sbjct: 83  ARSVAAKADSLDALREAIEAFEGCALKRTARNTVFARGERAARVMLVGEAPGRDEDERGE 142

Query: 127 PFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELIS 186
           PF+G++G +LD+M  +I I R Q +I+ +  W PPGNR  +  E+  C P I R I L  
Sbjct: 143 PFAGQSGRLLDQMFAAIGIERDQAYIAHMLNWRPPGNRAPTQDEIAQCLPFIERHIALKK 202

Query: 187 PKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLC------TPHSI-IPTLATVHPQELIQ 239
           P IL+  G         +D   T    G+W +         P S  I  L    P+ L+ 
Sbjct: 203 PDILVLAGELGARALLRSDTAITRLR-GRWVDYVLRDAEGNPTSTSIKALPVFSPRYLLA 261

Query: 240 YPLIKKNTWHALITLKKAL 258
            P+ K+  W  ++ L   L
Sbjct: 262 RPVEKRLAWQDMLALADQL 280


>gi|157826321|ref|YP_001494041.1| N-terminus of bacteriophage-type DNA polymerase [Rickettsia akari
           str. Hartford]
 gi|157800279|gb|ABV75533.1| N-terminus of bacteriophage-type DNA polymerase [Rickettsia akari
           str. Hartford]
          Length = 329

 Score =  111 bits (278), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 65/202 (32%), Positives = 109/202 (53%), Gaps = 8/202 (3%)

Query: 64  VQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNI 123
           +  A S+A KA ++ ELK  L +F+ C L   + +T+         +M+IG  P  ++++
Sbjct: 125 ITLARSLADKANNIAELKESLLNFNGCALKKFATNTVFGDGNLEAKIMLIGEAPGITEDL 184

Query: 124 SGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQI 182
            G PF G++GN+LD ML +I I R    +I+    W PP NR  +  E++IC+P + + I
Sbjct: 185 KGIPFCGESGNLLDNMLHAIGISRKNNAYITNTVFWRPPANRQPTLEEVDICKPFVEKHI 244

Query: 183 ELISPKILLFIGNKTKNFFF--NNDAQKTYQNLGKWSN--LCTPHSIIPTLATVHPQELI 238
            LISP +++ +G+         N+   K  Q    ++N  L  P   I T A  HP  L+
Sbjct: 245 ALISPTLIILVGSTAATSLLGKNSGITKIRQEYYFYTNKYLSAP---IQTTAIFHPAYLL 301

Query: 239 QYPLIKKNTWHALITLKKALKN 260
           + P+ K+ +W+ L+ +K+ L N
Sbjct: 302 RQPMQKRTSWYDLLKIKEYLVN 323


>gi|83854882|ref|ZP_00948412.1| uracil-DNA glycosylase [Sulfitobacter sp. NAS-14.1]
 gi|83941405|ref|ZP_00953867.1| uracil-DNA glycosylase [Sulfitobacter sp. EE-36]
 gi|83842725|gb|EAP81892.1| uracil-DNA glycosylase [Sulfitobacter sp. NAS-14.1]
 gi|83847225|gb|EAP85100.1| uracil-DNA glycosylase [Sulfitobacter sp. EE-36]
          Length = 257

 Score =  111 bits (278), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 54/187 (28%), Positives = 96/187 (51%), Gaps = 10/187 (5%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L EL++ + +F  C L   +   + +  T G  +MI+G  P   ++  G+PF G+ G +
Sbjct: 74  TLDELRAAMAAFEHCELKRGARKMVFSDGTPGARVMIVGEAPGRDEDREGRPFVGRAGVL 133

Query: 136 LDKMLQSIEIMR----TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILL 191
           LDKML +I++ R    + ++I+ + PW PP NR+    E+ + +P + R I L  P++L+
Sbjct: 134 LDKMLAAIDMGRHHQTSPVYITNVLPWRPPQNRDPKPDEIAMMKPFLARHIALAKPEVLV 193

Query: 192 FIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
            +GN +             +  G+W+        +P L   HP  L++ P  K+  W  L
Sbjct: 194 IVGNWSAQALLGKRGITRLR--GQWTQA----EGLPALPMFHPAYLLRSPEFKREAWADL 247

Query: 252 ITLKKAL 258
           ++LK  L
Sbjct: 248 LSLKAKL 254


>gi|260431599|ref|ZP_05785570.1| uracil-DNA glycosylase [Silicibacter lacuscaerulensis ITI-1157]
 gi|260415427|gb|EEX08686.1| uracil-DNA glycosylase [Silicibacter lacuscaerulensis ITI-1157]
          Length = 279

 Score =  111 bits (278), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 54/186 (29%), Positives = 98/186 (52%), Gaps = 7/186 (3%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           SL +L++ + +F  C L   +   + A  T G  +MI+G  P   ++  G+PF G+ G +
Sbjct: 99  SLDQLRAAMETFAHCDLKRGARQLVFADGTAGAPVMIVGEAPGREEDRVGRPFVGRAGQL 158

Query: 136 LDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           LD+ML +I++ R + ++I+ + PW PP NR+    E+ + +P + R + L  PK+L+ +G
Sbjct: 159 LDRMLAAIDLDRAKNVYITNVLPWRPPQNRDPRPDEIAMMQPFVERHVALSKPKVLVVMG 218

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITL 254
           N +     N       +  G+W+        +P L  +HP  L++ P  K+  W  L+ L
Sbjct: 219 NISCQAVLNKRGITRLR--GQWNQALN----LPVLPMLHPAYLLRQPHAKRQAWADLLEL 272

Query: 255 KKALKN 260
           +  L+ 
Sbjct: 273 RAFLEG 278


>gi|297184210|gb|ADI20328.1| uracil-DNA glycosylase [uncultured alpha proteobacterium
           EB080_L27A02]
          Length = 264

 Score =  111 bits (278), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 61/199 (30%), Positives = 108/199 (54%), Gaps = 12/199 (6%)

Query: 67  ADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGK 126
           A  +A+K  +L EL+  +  F  C L   +   + +       +M+IG +PS  ++I GK
Sbjct: 71  AKMLAEKCNNLSELRDAMGLFEMCSLKKGAKKLVFSDGLSKSRVMVIGESPSREEDIEGK 130

Query: 127 PFSGKTGNMLDKMLQSIEIMRTQ------IHISMISPWHPPGNRNLSNIEMEICRPIIMR 180
           PF G  G ++DKM Q+I + R        I+I+   PW PP +R+ ++ E+ +  P + R
Sbjct: 131 PFVGTEGELVDKMFQAIGLSRDSNEPNEAIYITTAIPWRPPQSRDPNSDEIAMMLPFLKR 190

Query: 181 QIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQY 240
            IEL++P  ++ +GN   +   N      ++  G+W+       I+P L   HP+ L++ 
Sbjct: 191 HIELVNPDFIVLMGNIACSAVLNKVGINKFR--GEWTE-AFGKQILPML---HPRSLLKD 244

Query: 241 PLIKKNTWHALITLKKALK 259
           P+ K++TW+ L++LK+ LK
Sbjct: 245 PMRKRDTWNDLLSLKERLK 263


>gi|110680596|ref|YP_683603.1| uracil-DNA glycosylase, C-terminal [Roseobacter denitrificans OCh
           114]
 gi|109456712|gb|ABG32917.1| uracil-DNA glycosylase, C-terminal [Roseobacter denitrificans OCh
           114]
          Length = 259

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 53/189 (28%), Positives = 97/189 (51%), Gaps = 10/189 (5%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
            L +L++ L  F  C L   + + + +    G  +M+IG  P   +++ G+PF G+ G +
Sbjct: 76  DLDQLRAALAGFEHCDLKRGARNLVFSDGVAGARVMVIGEAPGREEDLQGRPFVGRAGQL 135

Query: 136 LDKMLQSIEIMRTQ----IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILL 191
           LD+ML +I++ R +    ++I+ + PW PP NR+ S+ E+ + RP + R I L  P++L+
Sbjct: 136 LDRMLAAIDMGRDRQSDPVYITNVVPWRPPQNRDPSSDEIAMMRPFVERHIALAKPEVLV 195

Query: 192 FIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
            +GN +         +   +  G+W         +P L   HP  L++    K+  W  L
Sbjct: 196 IMGNVSAQALLGK--RGITRLRGQWVEAFG----VPALPMFHPAYLLRNTAAKREAWADL 249

Query: 252 ITLKKALKN 260
           ++L+  L N
Sbjct: 250 LSLQARLHN 258


>gi|114771330|ref|ZP_01448750.1| hypothetical protein OM2255_08235 [alpha proteobacterium HTCC2255]
 gi|114548255|gb|EAU51142.1| hypothetical protein OM2255_08235 [alpha proteobacterium HTCC2255]
          Length = 264

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 61/199 (30%), Positives = 108/199 (54%), Gaps = 12/199 (6%)

Query: 67  ADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGK 126
           A  +A+K  +L EL+  +  F  C L   +   + +       +M+IG +PS  ++I GK
Sbjct: 71  AKMLAEKCNNLSELRDAMGLFEMCSLKKGAKKLVFSDGLSKSRVMVIGESPSREEDIEGK 130

Query: 127 PFSGKTGNMLDKMLQSIEIMRTQ------IHISMISPWHPPGNRNLSNIEMEICRPIIMR 180
           PF G  G ++DKM Q+I + R        I+I+   PW PP +R+ ++ E+ +  P + R
Sbjct: 131 PFVGTEGELVDKMFQAIGLSRDSNEPNEAIYITTAIPWRPPQSRDPNSDEIAMMLPFLKR 190

Query: 181 QIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQY 240
            IEL++P  ++ +GN   +   N      ++  G+W+       I+P L   HP+ L++ 
Sbjct: 191 HIELVNPDFIVLMGNIACSAVLNKVGINKFR--GEWTE-AFGKQILPML---HPRSLLKD 244

Query: 241 PLIKKNTWHALITLKKALK 259
           P+ K++TW+ L++LK+ LK
Sbjct: 245 PIRKRDTWNDLLSLKERLK 263


>gi|126727771|ref|ZP_01743601.1| hypothetical protein RB2150_10424 [Rhodobacterales bacterium
           HTCC2150]
 gi|126702898|gb|EBA02001.1| hypothetical protein RB2150_10424 [Rhodobacterales bacterium
           HTCC2150]
          Length = 264

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 64/235 (27%), Positives = 114/235 (48%), Gaps = 18/235 (7%)

Query: 30  EPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHD 89
           +P   AT E+ +  K       P   ++ +    V +A  +A +A +L EL  +   F  
Sbjct: 42  KPKATATVENGKPTK-------PAPPVKPVAVDAVAEAQKLADQATTLEELAKIQSEFEM 94

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRT- 148
           C L   +   + A       L+I+G  P   ++  G+PF+G+ G +LDKML +I++ RT 
Sbjct: 95  CDLKKGARKFVFADGNPKSRLLILGEAPGRDEDQQGRPFAGEAGQLLDKMLAAIDMDRTG 154

Query: 149 --QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDA 206
               +++ + PW PP NR+ S  E+ +  P + + IEL+SP +++ +GN          +
Sbjct: 155 ENSAYVTNVMPWRPPQNRDPSVEEIAMMMPFVSKHIELVSPDVVILMGNVA---CLAALS 211

Query: 207 QKTYQNL-GKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
           +K    L G W+         P +   HP  L++ P+ K++ W  L+ ++  LK 
Sbjct: 212 KKGITRLRGNWATAFE----RPVMPIFHPAYLLRTPVAKRDAWADLLAVQAKLKK 262


>gi|254797255|ref|YP_003082097.1| uracil-DNA glycosylase, family 4 [Neorickettsia risticii str.
           Illinois]
 gi|254590499|gb|ACT69861.1| uracil-DNA glycosylase, family 4 [Neorickettsia risticii str.
           Illinois]
          Length = 247

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 98/179 (54%), Gaps = 5/179 (2%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L ELK+L+ +F  C L + + +T+         +M+IG  P + ++  G PF G++GN+
Sbjct: 59  TLDELKTLVSNFEGCQLKNNAKNTVFCDGNPDAKIMLIGEAPGEQEDKLGIPFCGRSGNL 118

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           LDKMLQ+I + RT+++I+    W PPGNR  +  E+EICRP +   I L+ PK+++ +G+
Sbjct: 119 LDKMLQAIGLDRTKVYITNAVFWRPPGNRRPTPEEIEICRPFLEHHIRLVLPKLIVLLGS 178

Query: 196 -KTKNFFFNNDAQKTYQNLGKWSNLCTP--HSIIPTLATVHPQELIQYPLIKKNTWHAL 251
             T +   + D     +N  K+     P     I T    HP  L++ P  KK  W  L
Sbjct: 179 TATSSVLKSQDRISILRN--KFYEYKNPFIREGITTTVMFHPSYLLRQPAQKKLAWEDL 235


>gi|114762038|ref|ZP_01441506.1| uracil-DNA glycosylase [Pelagibaca bermudensis HTCC2601]
 gi|114545062|gb|EAU48065.1| uracil-DNA glycosylase [Roseovarius sp. HTCC2601]
          Length = 264

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 98/185 (52%), Gaps = 7/185 (3%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L +L+  + +F  C L   + + + +       +MI+G  P   +++ GKPF G+ G +
Sbjct: 83  TLDDLREAMAAFEHCELRRGARNLVFSDGVAQARVMIVGEAPGRDEDLQGKPFVGRAGQL 142

Query: 136 LDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           LD+ML +I + R + ++I+ + PW PP NR+    E+ +  P + R I L++P++L+ +G
Sbjct: 143 LDRMLGAIGLSRAENVYITNVLPWRPPQNRDPKPDEIAMLTPFLARHIALVAPEVLVVMG 202

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITL 254
           N + +       +   +  GKW+        +P L   HP  L++ P +K+  W  L+ L
Sbjct: 203 NISCDALLGR--RGITRLRGKWAE----AQGLPALPMFHPAYLLRQPQMKREAWADLLEL 256

Query: 255 KKALK 259
           K  L+
Sbjct: 257 KAKLR 261


>gi|260575952|ref|ZP_05843947.1| phage SPO1 DNA polymerase-related protein [Rhodobacter sp. SW2]
 gi|259021878|gb|EEW25179.1| phage SPO1 DNA polymerase-related protein [Rhodobacter sp. SW2]
          Length = 262

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 55/191 (28%), Positives = 102/191 (53%), Gaps = 14/191 (7%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L EL++ + +F  C L   + +T+ A       +M+IG  P   ++  G+PF G+ G +
Sbjct: 76  TLAELRAAMEAFDLCDLKRGARNTVFADGNPNARVMLIGEAPGRDEDAEGRPFVGRAGQL 135

Query: 136 LDKMLQSIEIMR------TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKI 189
           LD+ML +I + R        ++I+ + PW PP NR+ +  E+ + +P + R +EL +P++
Sbjct: 136 LDRMLAAIGLSRQSPDPAAAVYITNVLPWRPPQNRDPAPDEIAMMQPFLARHVELAAPEL 195

Query: 190 LLFIGNKTKNFFFNNDAQKTYQNL-GKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTW 248
           ++ +GN +         Q+    L G+W+     H  +P L   HP  L++ P  K+++W
Sbjct: 196 IVLMGNISCQAVLG---QRGITRLRGQWTEAFG-HPALPML---HPAYLLRTPAAKRDSW 248

Query: 249 HALITLKKALK 259
             L+ LK  L+
Sbjct: 249 ADLLALKARLR 259


>gi|296535656|ref|ZP_06897832.1| uracil-DNA glycosylase [Roseomonas cervicalis ATCC 49957]
 gi|296264007|gb|EFH10456.1| uracil-DNA glycosylase [Roseomonas cervicalis ATCC 49957]
          Length = 287

 Score =  108 bits (271), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 93/177 (52%), Gaps = 9/177 (5%)

Query: 89  DCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRT 148
           +  L  T+ + + A  +    LM+IG  P   ++  GKPF G +G +LD+ML SI + R 
Sbjct: 102 ESPLRDTATNLVFADGSPESGLMLIGEAPGGDEDRQGKPFVGVSGQLLDRMLASIGLDRG 161

Query: 149 Q------IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFF 202
           Q       +I+ I PW PPGNR  ++ E+ +  P+++R I L+ P+ ++ +G        
Sbjct: 162 QAAPGQGFYITNILPWRPPGNRTPTDAEIALFLPVVLRHIALVRPRHVVLLGGTAAKALL 221

Query: 203 NNDAQKTYQNL-GKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
              A++    L G+W +L      +P L T+HP  L++ P  K+  W  L+ L++ L
Sbjct: 222 R--AKEGITRLRGRWHDLPQEAGGLPALPTLHPAYLLRNPAAKREAWADLLMLRRTL 276


>gi|259415078|ref|ZP_05739000.1| uracil-DNA glycosylase [Silicibacter sp. TrichCH4B]
 gi|259348988|gb|EEW60742.1| uracil-DNA glycosylase [Silicibacter sp. TrichCH4B]
          Length = 255

 Score =  108 bits (271), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 63/233 (27%), Positives = 110/233 (47%), Gaps = 8/233 (3%)

Query: 27  VFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRS 86
           + D P N    + Q K K+   A  P   ++      V +A  +A+ A +L  L++ L +
Sbjct: 26  MMDAPINRYELQDQ-KPKAARGAEAPPAPVKPKSVDPVAEAVKLAKSADALPGLRAALET 84

Query: 87  FHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIM 146
           F  C L   + + + +    G  +MIIG  P   +++ GKPF G+ G +LDKML +I++ 
Sbjct: 85  FEHCDLKRGARNLVFSDGQAGARVMIIGEAPGRDEDLQGKPFVGRAGQLLDKMLAAIDLS 144

Query: 147 RTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNND 205
           R + ++I+ + PW PP NR+    E+ +  P + R + L  P +L+ +GN +        
Sbjct: 145 RDENVYITNVLPWRPPQNRDPLPAEIAMLVPFLERHVALAQPDVLVLMGNISCQAVLGKR 204

Query: 206 AQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
                +  G W+         P +   HP  L++    K+  W  L+ L+  L
Sbjct: 205 GITRLR--GNWAQAWGK----PVIPMFHPAYLLRQASAKRQAWADLLELRARL 251


>gi|89056392|ref|YP_511843.1| phage SPO1 DNA polymerase-related protein [Jannaschia sp. CCS1]
 gi|88865941|gb|ABD56818.1| phage SPO1 DNA polymerase-related protein [Jannaschia sp. CCS1]
          Length = 300

 Score =  108 bits (270), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 60/218 (27%), Positives = 103/218 (47%), Gaps = 14/218 (6%)

Query: 49  AIQPITNIRHIHSPLVQQ---ADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQT 105
           A  P+ + R    P V     A  +A+ A SL  L S +  F  C L   + + +    T
Sbjct: 88  AAAPVNSTRPATLPQVDAVAIARQLAEAAGSLEALSSAMEGFEHCELRRGARNFVFHDGT 147

Query: 106 EGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRT-----QIHISMISPWHP 160
               +MI+G  P   ++  GKPF G+ G +LD+M  +I + R       ++I+ + PW P
Sbjct: 148 PDARVMIVGEAPGREEDSQGKPFVGRAGQLLDRMFAAIGLDRAVEGGEGLYITNMLPWRP 207

Query: 161 PGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLC 220
           P NR+    E+ +  P + R I+L+ P++L+ +GN           +   +  G W ++ 
Sbjct: 208 PQNRDPKAEELAMMAPFVQRHIDLVDPEVLVLMGNHACAGLLGR--RGITRMRGTWEDV- 264

Query: 221 TPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
              +  PT+   HP  L++ P  K+  W  L+++K  L
Sbjct: 265 ---NGRPTMPMCHPAYLLRNPAAKREAWADLLSIKARL 299


>gi|91203817|emb|CAJ71470.1| conserved hypothetical protein [Candidatus Kuenenia
           stuttgartiensis]
          Length = 263

 Score =  108 bits (269), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 58/189 (30%), Positives = 96/189 (50%), Gaps = 5/189 (2%)

Query: 73  KACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKT 132
           KA  L ELK+     H C L  T  + +         LM +G  P   +++ G+PF G+ 
Sbjct: 77  KAKLLEELKNETLVCHKCPLGETRTNLVFGAGNPMASLMFVGEAPGRDEDLQGEPFVGRA 136

Query: 133 GNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLF 192
           G +L K++++I++ R+ ++I+ I    PPGNRN    E+ +C P++ +QI++I PK+L  
Sbjct: 137 GQLLTKIIEAIDMKRSDVYIANILKCRPPGNRNPLTDEIALCIPVLTKQIDIIKPKVLCA 196

Query: 193 IGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALI 252
           +G        N     T + +G        +  IPT+AT HP  L++ P  K   W  + 
Sbjct: 197 MGTFAAQTLLN-----TKEPIGFLRGKFHDYKGIPTMATFHPAYLLRNPGEKAKVWEDMK 251

Query: 253 TLKKALKNL 261
            ++  LK L
Sbjct: 252 KIRDLLKEL 260


>gi|297183987|gb|ADI20107.1| uracil-DNA glycosylase [uncultured alpha proteobacterium
           EB080_L06A09]
          Length = 264

 Score =  108 bits (269), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 73/263 (27%), Positives = 132/263 (50%), Gaps = 26/263 (9%)

Query: 16  ALFYADSGVYWVFDEPNNEATYESQRKEKSIDSA-----IQPITNIRHIHS-PLV----Q 65
           + + A   + W ++   +EA  ++      I++      I P +NI H+ S P +    +
Sbjct: 6   SFYEAKLALEWQYEFGVDEAISDAPINRYEIETVPPELKINPKSNIAHVSSMPDILSSRE 65

Query: 66  QADSIAQ---KAC-SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSD 121
            A  +A+   K C +L EL+  +  F  C L   + + + +       +M+IG  P+  +
Sbjct: 66  TASDVAKILAKNCDNLTELRDAIGLFEMCSLKKGAKNLVFSDGPSNSRVMVIGEAPTREE 125

Query: 122 NISGKPFSGKTGNMLDKMLQSIEIMR------TQIHISMISPWHPPGNRNLSNIEMEICR 175
           +  GKPF G  G ++DKM Q+I + R        I+I+   PW PP +R+ S+ E+ +  
Sbjct: 126 DSEGKPFVGAEGELVDKMFQAIGLSRRASDPNDAIYITTAIPWRPPQSRDPSSDEIAMMV 185

Query: 176 PIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQ 235
           P + R IELI+P  ++ +GN   +   N      ++  G+W+       IIP L   HP+
Sbjct: 186 PFLKRHIELINPDFIVLMGNIACSAVLNKVGINKFR--GEWTEALG-KKIIPML---HPR 239

Query: 236 ELIQYPLIKKNTWHALITLKKAL 258
            L++ P+ K++ W+ L++LK+ L
Sbjct: 240 SLLRDPMRKRDAWNDLLSLKEQL 262


>gi|254475928|ref|ZP_05089314.1| uracil-DNA glycosylase [Ruegeria sp. R11]
 gi|214030171|gb|EEB71006.1| uracil-DNA glycosylase [Ruegeria sp. R11]
          Length = 275

 Score =  108 bits (269), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 62/233 (26%), Positives = 110/233 (47%), Gaps = 9/233 (3%)

Query: 27  VFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRS 86
           + D P N    E+++ + +   A  P    + +    V+ A  IA+    L  LK+ L  
Sbjct: 48  ICDAPVNRYELEARQPKPTARQAEAPPPKPKEVDP--VEVARDIARGVRDLAGLKAALAQ 105

Query: 87  FHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIM 146
           F  C L   + + + +    G  +M+IG  P   +++ G+PF G+ G +LD+ML +I + 
Sbjct: 106 FEHCDLRKGARNLVFSDGKPGARVMVIGEAPGRDEDLEGRPFVGRAGQLLDRMLAAIGLS 165

Query: 147 RTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNND 205
           R   ++I+ + PW PP NR+    E+ +  P + R + L +P IL+ +GN + +      
Sbjct: 166 RQDNVYITNVLPWRPPQNRDPLPAEIAMMTPFLERHVALANPDILIAMGNISCDALMGK- 224

Query: 206 AQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
            +   +  G W          P +   HP  L++ PL K+  W  L+ +K  L
Sbjct: 225 -RGITRLRGTWGEAWG----KPVMPMFHPAYLLRQPLQKRAAWSDLLDIKSRL 272


>gi|254467145|ref|ZP_05080556.1| uracil-DNA glycosylase [Rhodobacterales bacterium Y4I]
 gi|206688053|gb|EDZ48535.1| uracil-DNA glycosylase [Rhodobacterales bacterium Y4I]
          Length = 250

 Score =  108 bits (269), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 58/196 (29%), Positives = 96/196 (48%), Gaps = 7/196 (3%)

Query: 67  ADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGK 126
           A   A+ A SL  L+  L +F  C L   + + + +    G  +MIIG  P   +++ GK
Sbjct: 60  AQKAARGAASLPALRDALAAFDHCDLKRGARNLVFSDGQPGARVMIIGEAPGRDEDLQGK 119

Query: 127 PFSGKTGNMLDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELI 185
           PF G+ G +LD+ML++I + R + ++I+ + PW PP NR+    E+ +  P + R + L 
Sbjct: 120 PFVGRAGQLLDRMLEAIGLSRAENVYITNVLPWRPPQNRDPLPAEIAMLTPFLERHVALA 179

Query: 186 SPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKK 245
            P IL+ +GN +             +  G+W          P +   HP  L++ P  K+
Sbjct: 180 EPDILVLMGNISCQAVLGKRGITRLR--GQWDQAWNK----PVIPMFHPAYLLRQPAQKR 233

Query: 246 NTWHALITLKKALKNL 261
             W  L+ LK  L +L
Sbjct: 234 LAWADLLELKARLGSL 249


>gi|258541499|ref|YP_003186932.1| bacteriophage-type DNA polymerase [Acetobacter pasteurianus IFO
           3283-01]
 gi|256632577|dbj|BAH98552.1| bacteriophage-type DNA polymerase [Acetobacter pasteurianus IFO
           3283-01]
 gi|256635634|dbj|BAI01603.1| bacteriophage-type DNA polymerase [Acetobacter pasteurianus IFO
           3283-03]
 gi|256638689|dbj|BAI04651.1| bacteriophage-type DNA polymerase [Acetobacter pasteurianus IFO
           3283-07]
 gi|256641743|dbj|BAI07698.1| bacteriophage-type DNA polymerase [Acetobacter pasteurianus IFO
           3283-22]
 gi|256644798|dbj|BAI10746.1| bacteriophage-type DNA polymerase [Acetobacter pasteurianus IFO
           3283-26]
 gi|256647853|dbj|BAI13794.1| bacteriophage-type DNA polymerase [Acetobacter pasteurianus IFO
           3283-32]
 gi|256650906|dbj|BAI16840.1| bacteriophage-type DNA polymerase [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256653897|dbj|BAI19824.1| bacteriophage-type DNA polymerase [Acetobacter pasteurianus IFO
           3283-12]
          Length = 284

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 57/198 (28%), Positives = 93/198 (46%), Gaps = 4/198 (2%)

Query: 64  VQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNI 123
           V+QA  +A  A +  EL   + SF  C L   ++ T+  +      LM+IG  P + ++ 
Sbjct: 85  VEQAQRLAAAANTPEELFEAMDSFTACPLRGAAMHTLMPSGPRNAPLMLIGEAPDEDEDR 144

Query: 124 SGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIE 183
           SG+ F+G  G MLD ML  + + R+Q+ ++   PW P G    + ++  ICRP + R I 
Sbjct: 145 SGQVFAGLCGTMLDTMLAPLPLERSQLALATALPWRPAGGTPPTEMDQRICRPFLERAIT 204

Query: 184 LISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPH-SIIPTLATVHPQELIQYPL 242
           L +P+ LL  G                +N   W N+  P    +P +   HP +L   P 
Sbjct: 205 LFAPQRLLLCGRLPARMLLGKTTDLPRRN---WQNITLPGLPPLPVMFMRHPLQLRASPA 261

Query: 243 IKKNTWHALITLKKALKN 260
            ++  W  L+T+   L+ 
Sbjct: 262 ARREIWTTLMTVMDTLRQ 279


>gi|254293439|ref|YP_003059462.1| phage SPO1 DNA polymerase-related protein [Hirschia baltica ATCC
           49814]
 gi|254041970|gb|ACT58765.1| phage SPO1 DNA polymerase-related protein [Hirschia baltica ATCC
           49814]
          Length = 268

 Score =  107 bits (267), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 68/210 (32%), Positives = 101/210 (48%), Gaps = 8/210 (3%)

Query: 57  RHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYT 116
           R + +  +  A  +A  A ++ +LK  +  F  C L +T+ ST+        D+MII   
Sbjct: 58  RRLRTDQILAAQKLADHALTIEDLKKSVNDFTGCDLRTTARSTVLCDGNINADMMIICGA 117

Query: 117 PSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICR 175
           P   ++ SG+P +G  G +LDKM  +I   R   ++I+ + PWH  G RN  + E  ICR
Sbjct: 118 PDREEDKSGRPAAGANGQLLDKMFAAINFTRQDNLYIASLMPWHMLGERNPDDQEWAICR 177

Query: 176 PIIMRQIELISPKILLFIGNKTKNFFFN---NDAQKTYQNLG-KWSNLCTPHSIIPTLAT 231
           P + RQIEL+SPKI++ IG  +     N   N A+   Q    K  +L      IP    
Sbjct: 178 PFLQRQIELVSPKIIVTIGKMSSQILLNKTDNIAKLRGQEFQYKQESLSQE---IPCFPL 234

Query: 232 VHPQELIQYPLIKKNTWHALITLKKALKNL 261
             P  L   P  K  TW  L  ++K  + L
Sbjct: 235 FAPSYLRVRPAEKAKTWKDLQLIRKRAEQL 264


>gi|23011683|ref|ZP_00051971.1| COG1573: Uracil-DNA glycosylase [Magnetospirillum magnetotacticum
           MS-1]
          Length = 152

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 82/155 (52%), Gaps = 14/155 (9%)

Query: 111 MIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIE 170
           M +G  P   ++  GKPF G++G +LD+M+ +I + RT  ++S I PW PPGNRN +  E
Sbjct: 1   MFVGEAPGADEDRIGKPFMGRSGQLLDRMMAAIGLDRTTSYVSNIVPWRPPGNRNPTPQE 60

Query: 171 MEICRPIIMRQIELISPKILLFIG-------NKTKNFFFNNDAQKTYQNLGKWSNLCTPH 223
           + ICRP I RQIEL +P IL+ +G         TK+       +     LG         
Sbjct: 61  VSICRPFIERQIELANPDILVCLGAPATQTLTGTKDGILKARGRFYPYRLGDGRE----- 115

Query: 224 SIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
             I  LAT+HP  L++ P+ K+  W     LK AL
Sbjct: 116 --IRALATLHPAYLLRQPVQKRLAWRDFRMLKAAL 148


>gi|149913413|ref|ZP_01901946.1| cytosine deaminase [Roseobacter sp. AzwK-3b]
 gi|149812533|gb|EDM72362.1| cytosine deaminase [Roseobacter sp. AzwK-3b]
          Length = 266

 Score =  106 bits (265), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 55/191 (28%), Positives = 97/191 (50%), Gaps = 12/191 (6%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L  L+  L  +  C L   + + + A       +MIIG  P   +++ G+PF G+ G +
Sbjct: 80  TLDALREALAGYEHCDLKRGARNLVFADGQPSARVMIIGEAPGRDEDLQGRPFVGRAGQL 139

Query: 136 LDKMLQSIEIMRT------QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKI 189
           LD+ML++I++ RT       ++I+ + PW PP NR+    E+ +  P + R ++L+ P+I
Sbjct: 140 LDRMLEAIDMSRTAPEAGQAVYITNVMPWRPPQNRDPKPEEIAMMLPFVQRHVDLVDPEI 199

Query: 190 LLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWH 249
           ++ +GN +         Q   +  G+W    T     PTL  VHP  L++ P  K+  W 
Sbjct: 200 VVLMGNISCQAGLGR--QGITRLRGQW----TESYGRPTLPMVHPAYLLRNPNAKREAWA 253

Query: 250 ALITLKKALKN 260
            L+ L+  L+ 
Sbjct: 254 DLLELQARLRG 264


>gi|82703240|ref|YP_412806.1| phage SPO1 DNA polymerase-related protein [Nitrosospira multiformis
           ATCC 25196]
 gi|82411305|gb|ABB75414.1| phage SPO1 DNA polymerase-related protein [Nitrosospira multiformis
           ATCC 25196]
          Length = 271

 Score =  106 bits (265), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 58/213 (27%), Positives = 99/213 (46%), Gaps = 12/213 (5%)

Query: 56  IRHIHSPLVQQADSIAQKACSL------HELKSLLRSFHDCHLCSTSLSTICATQTEGQD 109
           +  +  P     + +A+K  ++       +LK  +     C LCS+   T+        D
Sbjct: 60  VEQVCVPSANATEDVAEKRRAMILRMEWDQLKESVEGCVACRLCSSRTRTVFGVGDPNAD 119

Query: 110 LMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSN 168
            + +G  P   ++  G+PF G+ G +LD ML +I + R + + I+ I    PPGNR  S+
Sbjct: 120 WLYVGEGPGAQEDALGEPFVGQAGKLLDNMLMAIGLKRGRDVFIANIVKCRPPGNREPSD 179

Query: 169 IEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPT 228
            E + C P + RQIELI P++++ +G        N DA     ++G        H  IP 
Sbjct: 180 DEAQCCEPYLARQIELIKPRLIVALGKTAARNLLNTDA-----SIGSLRGKLHQHEGIPV 234

Query: 229 LATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
           + T HP  L++  + K   W  L   ++ ++ L
Sbjct: 235 IVTYHPAYLLRTLVAKAKAWEDLCFAQRTMQAL 267


>gi|332297808|ref|YP_004439730.1| phage SPO1 DNA polymerase-related protein [Treponema brennaborense
           DSM 12168]
 gi|332180911|gb|AEE16599.1| phage SPO1 DNA polymerase-related protein [Treponema brennaborense
           DSM 12168]
          Length = 258

 Score =  106 bits (265), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 62/196 (31%), Positives = 93/196 (47%), Gaps = 6/196 (3%)

Query: 67  ADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGK 126
           AD++ + A +L  +   +     C LC T  +T+         +M+IG  P   ++ SG 
Sbjct: 54  ADTLPETAAALERIVQKIAGCTRCQLCKTRKNTVPGIGVPNPAVMVIGEGPGADEDASGI 113

Query: 127 PFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELI 185
           PF G+ G +LDKML SI + R T  +I+ I    PPGNR+    E E C   +  QI L+
Sbjct: 114 PFVGRAGQLLDKMLASISLSRTTNCYIANIVKCRPPGNRDPLPEESEACAAFLEAQISLL 173

Query: 186 SPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKK 245
            P  +L +G             KT   +GK     T ++ IP LAT HP  L++   +K+
Sbjct: 174 KPAAILAVGRVAAQNLL-----KTTVGIGKLRGKFTEYNGIPFLATYHPSALLRNEDLKR 228

Query: 246 NTWHALITLKKALKNL 261
             W  L   +  L+ L
Sbjct: 229 PAWEDLKLFRSGLQQL 244


>gi|262276833|ref|ZP_06054626.1| uracil DNA glycosylase superfamily [alpha proteobacterium HIMB114]
 gi|262223936|gb|EEY74395.1| uracil DNA glycosylase superfamily [alpha proteobacterium HIMB114]
          Length = 217

 Score =  106 bits (264), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 60/189 (31%), Positives = 104/189 (55%), Gaps = 2/189 (1%)

Query: 70  IAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFS 129
           I+    +L++LK  + +  D +        + +       +MIIG  P  SD I+GKPFS
Sbjct: 25  ISNSCLTLNDLKKKINNLKDFY-NKKQDQIVFSDGNSKSKIMIIGDAPGVSDEINGKPFS 83

Query: 130 GKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKI 189
           G++G +LDKML +I + R +++++ I  +    N+ L  +E++  R II   I++I+PKI
Sbjct: 84  GESGELLDKMLMAINLDRNKVYLTNIINFRLQDNKKLGPVEIKNYRSIIFDHIKIINPKI 143

Query: 190 LLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWH 249
           +  +G+ T NFFF N  Q   ++ G W+ +   ++    L + HP  L++ P  KK +W 
Sbjct: 144 IFILGSVTFNFFFKN-TQSLTKSRGHWNKIKISNNEYDCLPSYHPAFLLRQPSQKKASWE 202

Query: 250 ALITLKKAL 258
            L  LK+ +
Sbjct: 203 DLKNLKQKI 211


>gi|254461237|ref|ZP_05074653.1| uracil-DNA glycosylase [Rhodobacterales bacterium HTCC2083]
 gi|206677826|gb|EDZ42313.1| uracil-DNA glycosylase [Rhodobacteraceae bacterium HTCC2083]
          Length = 263

 Score =  106 bits (264), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 64/235 (27%), Positives = 111/235 (47%), Gaps = 14/235 (5%)

Query: 25  YWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLL 84
           + V  EP   A   +  K   I++ I P+ +   +    +  A  +A  A  +  LK+ L
Sbjct: 38  FEVKPEPKKTAPVAAPPK---IEAGIAPVAD--KVDGAAL--ARDVAMAAQDIGALKTAL 90

Query: 85  RSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIE 144
             F  C L   + + + A  T G  +M+IG  PS  ++ SG PF+G TG +LD ML+SI+
Sbjct: 91  EGFEACELKRGARNMVFADGTFGGRVMVIGEAPSRDEDHSGLPFTGDTGVLLDNMLKSID 150

Query: 145 IMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFN 203
           + R + ++++ + PW  P   ++S  ++ +  P + R + L  P IL+ +GN        
Sbjct: 151 LSRAETVYLTNVLPWRLPRGADVSEADLAMMMPFVERHVALAKPDILVLMGNVACQAVLG 210

Query: 204 NDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
                  +  G+W         +P ++  HP+ L+  P  K+  W  L+ LK  L
Sbjct: 211 KRGITRLR--GQWGEAMG----LPVISMYHPEFLLNNPAKKREAWADLLALKAKL 259


>gi|114331290|ref|YP_747512.1| phage SPO1 DNA polymerase-related protein [Nitrosomonas eutropha
           C91]
 gi|114308304|gb|ABI59547.1| phage SPO1 DNA polymerase-related protein [Nitrosomonas eutropha
           C91]
          Length = 245

 Score =  106 bits (264), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 60/205 (29%), Positives = 105/205 (51%), Gaps = 9/205 (4%)

Query: 59  IHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPS 118
           + S +V    ++  +A +  +L+ ++ S   C LC T   T+     E  D + IG  P 
Sbjct: 45  VESSIVDDRSALIARA-NWEQLRQMVSSCTACPLCQTRKQTVFGVGDEQADWLFIGEGPG 103

Query: 119 DSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPI 177
             +++ G+PF G+ G +LD MLQ+I++ R Q ++I+ I    PP NRN   +E + CRP 
Sbjct: 104 AREDLLGEPFVGQAGKLLDSMLQAIDLGREQGVYIANIVKCRPPDNRNPLEMEAQQCRPY 163

Query: 178 IMRQIELISPKILLFIGN-KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQE 236
           ++RQI LI P++++ +G    +N     D+  + +  G+          IP +AT HP  
Sbjct: 164 LLRQIALIQPRLIITLGKVAAQNLLATGDSIASLR--GRLHEFAG----IPLIATYHPAY 217

Query: 237 LIQYPLIKKNTWHALITLKKALKNL 261
           L++    K   W  L   ++ ++ L
Sbjct: 218 LLRSLTDKAKAWEDLCFARRTMQAL 242


>gi|163738869|ref|ZP_02146282.1| phage SPO1 DNA polymerase-related protein [Phaeobacter
           gallaeciensis BS107]
 gi|163741885|ref|ZP_02149275.1| uracil-DNA glycosylase [Phaeobacter gallaeciensis 2.10]
 gi|161385058|gb|EDQ09437.1| uracil-DNA glycosylase [Phaeobacter gallaeciensis 2.10]
 gi|161387674|gb|EDQ12030.1| phage SPO1 DNA polymerase-related protein [Phaeobacter
           gallaeciensis BS107]
          Length = 253

 Score =  106 bits (264), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 58/196 (29%), Positives = 94/196 (47%), Gaps = 7/196 (3%)

Query: 64  VQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNI 123
           V+ A  +A  A SL  L   L  F  C L   + + + A    G  +M++G  P   ++I
Sbjct: 61  VEVARQMAGAAGSLEGLYEALGQFEHCELKKGARNLVFADGQPGARVMVVGEAPGRDEDI 120

Query: 124 SGKPFSGKTGNMLDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQI 182
           +GKPF G+ G +LD+ML +I + R   ++I+ + PW PP NR+    E+ +  P + R I
Sbjct: 121 AGKPFVGRAGQLLDRMLAAIGLSRKDSVYIANVLPWRPPQNRDPLPAEIAMMTPFLERHI 180

Query: 183 ELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPL 242
            L  P IL+ +GN + +       +   +  G W          P +   HP  L++ P 
Sbjct: 181 ALAKPDILIAMGNISCDALLGK--RGITRMRGTWQEAQGK----PVMPMFHPAYLLRQPA 234

Query: 243 IKKNTWHALITLKKAL 258
            K+  W  L+ +K  L
Sbjct: 235 QKRAAWADLLEIKARL 250


>gi|114798144|ref|YP_760609.1| uracil-DNA glycosylase [Hyphomonas neptunium ATCC 15444]
 gi|114738318|gb|ABI76443.1| uracil-DNA glycosylase, family 4 [Hyphomonas neptunium ATCC 15444]
          Length = 246

 Score =  105 bits (263), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 60/200 (30%), Positives = 100/200 (50%), Gaps = 3/200 (1%)

Query: 64  VQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNI 123
           V++A++IA    +L EL +    F    L ++  +T+    T G  L++IG  P   ++ 
Sbjct: 47  VREAETIAAGCANLDELTAAAGQFSGSPLRASCENTVVYDGTPGASLLVIGEGPGAQEDR 106

Query: 124 SGKPFSGKTGNMLDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQI 182
            GKPF GK G +LDKML +I   R +   I+ ++ W PPGNR+    E+ +CRP + R I
Sbjct: 107 QGKPFVGKAGQLLDKMLAAIGRNRAENALITNVNYWRPPGNRSPEADELAVCRPFVDRFI 166

Query: 183 ELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSI-IPTLATVHPQELIQYP 241
           E+  P++++  G         +  +   +  G      TP    +P +  +HP  L++ P
Sbjct: 167 EVSRPRLIVAAGGIPAVSLLGSR-EGIMKLRGNEYCYTTPGGYRVPLIPMLHPAYLLRRP 225

Query: 242 LIKKNTWHALITLKKALKNL 261
             K   W  L+ ++K L  L
Sbjct: 226 QDKSRAWRDLLLIEKRLGEL 245


>gi|329115091|ref|ZP_08243846.1| Phage SPO1 DNA Polymerase-Related Protein [Acetobacter pomorum
           DM001]
 gi|326695534|gb|EGE47220.1| Phage SPO1 DNA Polymerase-Related Protein [Acetobacter pomorum
           DM001]
          Length = 284

 Score =  105 bits (263), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 55/198 (27%), Positives = 91/198 (45%), Gaps = 4/198 (2%)

Query: 64  VQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNI 123
           V+QA  +A  A +  EL   + SF  C L   ++ T+         LM+IG  P + ++ 
Sbjct: 85  VEQAQRLAAAATTPEELFQAMDSFMACPLRGAAMHTLMPAGPHHAPLMLIGEAPDEDEDR 144

Query: 124 SGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIE 183
           SG+ F+G  G +LD ML  + + R+Q+ ++   PW P G    + ++  ICRP + R I 
Sbjct: 145 SGQVFAGLCGTLLDTMLAPLPLERSQLALATALPWRPAGGTAPTEMDQRICRPFLERAIT 204

Query: 184 LISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPH-SIIPTLATVHPQELIQYPL 242
           L +P+ LL  G                +N   W  +  P    +P +   HP +L   P 
Sbjct: 205 LFAPQRLLLCGRLPARMLLGKTTDLPRRN---WQEITLPGLPALPVMVMRHPLQLRASPA 261

Query: 243 IKKNTWHALITLKKALKN 260
            ++  W  L+T+   L+ 
Sbjct: 262 ARREIWATLMTVMDTLRQ 279


>gi|218442796|ref|YP_002381116.1| phage SPO1 DNA polymerase-related protein [Cyanothece sp. PCC 7424]
 gi|218175154|gb|ACK73886.1| phage SPO1 DNA polymerase-related protein [Cyanothece sp. PCC 7424]
          Length = 209

 Score =  105 bits (263), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 64/194 (32%), Positives = 96/194 (49%), Gaps = 13/194 (6%)

Query: 76  SLHELKSLLRSFHDCHLCS---TSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKT 132
           S   LK+L ++   C  C         +  + T   D+M+IG  P  +++ +GKPF+GK 
Sbjct: 15  STSPLKTLKKTCARCTQCGLHKNRTKVVFGSGTLEADIMLIGEAPGQTEDKTGKPFTGKA 74

Query: 133 GNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLF 192
           G +LDKML SI + R QI+++ I    PP NR  +  E+E CRP ++ QIE I+PK ++ 
Sbjct: 75  GKLLDKMLASINLERGQIYLTNIIKCRPPNNRTPTEKEIETCRPYLLAQIEFINPKFIVL 134

Query: 193 IGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKN-----T 247
            G            +   Q  GKW        I    +  HP  L++ P ++K      T
Sbjct: 135 AGGSAYR-GLTGKRKPISQVRGKWFKWHNSKCI----SIFHPAYLLRNPSLEKGSPKWLT 189

Query: 248 WHALITLKKALKNL 261
           W  LI+LK+ L  L
Sbjct: 190 WQDLISLKRKLNKL 203


>gi|23014826|ref|ZP_00054624.1| COG1573: Uracil-DNA glycosylase [Magnetospirillum magnetotacticum
           MS-1]
          Length = 279

 Score =  105 bits (263), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 95/202 (47%), Gaps = 3/202 (1%)

Query: 61  SPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDS 120
           S L   A  +A     L  L+  +  F    L   + ST+         +M IG  P   
Sbjct: 76  SALPGTAAHLAASCADLQALRHAMEGFEGLPLKQAASSTVFGDGNPEASVMCIGEAPGQE 135

Query: 121 DNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMR 180
           ++  G PF G +G +LD+ML SI + RT  +I+ + PW PP NR  +  E+ +C P + R
Sbjct: 136 EDRRGLPFVGPSGKLLDRMLASIGLDRTSCYITNVVPWRPPANRKPTPDEVAVCMPFLTR 195

Query: 181 QIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPH--SIIPTLATVHPQELI 238
            IEL+ P++L+ +            A    +  G+W    +P     IP LAT HP  L+
Sbjct: 196 HIELVDPQVLILL-GGAAAAAVLAKADGINRLRGQWFEFNSPGLPRPIPALATFHPAYLL 254

Query: 239 QYPLIKKNTWHALITLKKALKN 260
           + P  K++ W  L+ + K L +
Sbjct: 255 RTPDAKRDAWRDLLMIAKKLAS 276


>gi|254436695|ref|ZP_05050189.1| uracil-DNA glycosylase, family 4, putative [Octadecabacter
           antarcticus 307]
 gi|198252141|gb|EDY76455.1| uracil-DNA glycosylase, family 4, putative [Octadecabacter
           antarcticus 307]
          Length = 264

 Score =  105 bits (261), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 100/188 (53%), Gaps = 5/188 (2%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L  L++ + +F  C L + + + + +  T G  +MII   P   D+ +G+ F+G+TG +L
Sbjct: 78  LAGLRAAMGAFEGCALKAAARNLVFSGGTAGAPVMIIADAPDRDDDRAGELFAGRTGALL 137

Query: 137 DKMLQSIEIMRTQ---IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFI 193
           DKML +I + R+    I+ + + PW+PP NR+ +  EM +  P + R I L +PK+L+ +
Sbjct: 138 DKMLAAIGLGRSGDAPIYAAPVLPWNPPQNRDPNADEMAMMLPFLQRHITLAAPKVLILM 197

Query: 194 GNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALIT 253
           GN       N          G W+++    + +P +    P  L+  P  K++ W  L++
Sbjct: 198 GNGPCQALLNKSGMTRLH--GGWTDVQIGSASLPAIPMFAPSYLLTKPSAKRDAWSDLLS 255

Query: 254 LKKALKNL 261
           LK  LK+L
Sbjct: 256 LKAHLKDL 263


>gi|126734673|ref|ZP_01750419.1| phage SPO1 DNA polymerase-related protein [Roseobacter sp. CCS2]
 gi|126715228|gb|EBA12093.1| phage SPO1 DNA polymerase-related protein [Roseobacter sp. CCS2]
          Length = 263

 Score =  105 bits (261), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 96/203 (47%), Gaps = 12/203 (5%)

Query: 64  VQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNI 123
           V  A + A+ A  L+ L S +++F  C L   + S +         +MIIG  P   ++ 
Sbjct: 67  VALARTAAETAGDLNALSSAMQAFEHCELKKGARSFVFCDGNPAARVMIIGEAPGREEDR 126

Query: 124 SGKPFSGKTGNMLDKMLQSIEIMRT------QIHISMISPWHPPGNRNLSNIEMEICRPI 177
           +G+PF G+ G +LD+ML++I++ R        ++I+ + PW PP NR     E+ +  P 
Sbjct: 127 AGRPFVGRAGQLLDRMLEAIQMGRAADDAARSVYITNVLPWRPPSNRTPDKDEIAMMLPF 186

Query: 178 IMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQEL 237
           + R + L  P+I++ +GN               +  G W ++       P L   HP  L
Sbjct: 187 LERHVALADPEIVVLMGNTPCQALLGRTGITRMR--GNWVDVLGK----PCLPMFHPAYL 240

Query: 238 IQYPLIKKNTWHALITLKKALKN 260
           ++ P+ K+  W  L+ L   L+ 
Sbjct: 241 LRNPIAKREAWADLLDLNARLRG 263


>gi|58039995|ref|YP_191959.1| bacteriophage-type DNA polymerase [Gluconobacter oxydans 621H]
 gi|58002409|gb|AAW61303.1| Bacteriophage-type DNA polymerase [Gluconobacter oxydans 621H]
          Length = 281

 Score =  105 bits (261), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 65/230 (28%), Positives = 106/230 (46%), Gaps = 12/230 (5%)

Query: 40  QRKEKSIDSAIQPITNIRHIHSPLVQQADSIA---------QKACSLHELKSLLRSFHDC 90
           QR+ +   +A +P+  +     P   +   +A         +KA  L  L  L  +  D 
Sbjct: 49  QREGEGQRTAARPLPEMWDGTRPAGAKVTGVATGSLSLQALEKAPDLPTLMRLTEAPDDL 108

Query: 91  HLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQI 150
            L  T+   +     E    M+IG  P   ++ SG  F+G+ G +L+KML+S  + R QI
Sbjct: 109 FLARTATHRLEPVFVEDAPFMLIGEAPDADEDRSGTLFAGEAGALLEKMLRSAGLERGQI 168

Query: 151 HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTY 210
            ++   PW PPG R  S+ EM+ C P+++R I L  P+ L+ +G          DA    
Sbjct: 169 SMAPALPWRPPGGRTPSDTEMQACHPLLLRTIALCRPRFLVTMGVTPLKMLLGPDA-AVG 227

Query: 211 QNLGKWSNLCTPH--SIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
           +  GKW+ +  P   + +P L   HP +L      ++N W  L+ L + L
Sbjct: 228 RLRGKWTEVSVPGLATPVPLLPMRHPLQLRASAAARRNAWQDLLILMEKL 277


>gi|88606724|ref|YP_505870.1| uracil-DNA glycosylase [Anaplasma phagocytophilum HZ]
 gi|88597787|gb|ABD43257.1| uracil-DNA glycosylase, family 4 [Anaplasma phagocytophilum HZ]
          Length = 290

 Score =  105 bits (261), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 53/195 (27%), Positives = 99/195 (50%), Gaps = 4/195 (2%)

Query: 64  VQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNI 123
           V++A   A     L EL++ + +F  C +   +++T+ +       +M+IG  P  +++ 
Sbjct: 85  VEEARKAAANCVDLAELRAAVCAFEGCEIKKAAVNTVFSDGNPKSKIMLIGEAPGSTEDR 144

Query: 124 SGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQI 182
            G PF G +G +LDKM  +I + R + I+IS    W PPGNR  ++ E+E+CRP + + I
Sbjct: 145 EGIPFCGASGQLLDKMFAAINLNRSSNIYISNTVFWRPPGNRKPTDFELEVCRPFVEKHI 204

Query: 183 ELISPKILLFIGNKTKNFFFN--NDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQY 240
            L+ P +++ +G+          ++  +      +++N     SI   +   HP  L++ 
Sbjct: 205 SLVDPDVVVMVGSTACYSLLQTPDNISRLRGKFYEYTNSFLSRSIT-AMVIFHPAYLLRQ 263

Query: 241 PLIKKNTWHALITLK 255
           P  K+  W  L  L+
Sbjct: 264 PQQKRLAWEDLKMLR 278


>gi|149926134|ref|ZP_01914396.1| Phage SPO1 DNA polymerase-related protein [Limnobacter sp. MED105]
 gi|149824952|gb|EDM84164.1| Phage SPO1 DNA polymerase-related protein [Limnobacter sp. MED105]
          Length = 233

 Score =  104 bits (260), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 59/196 (30%), Positives = 99/196 (50%), Gaps = 14/196 (7%)

Query: 68  DSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKP 127
           D +   + SL  L+ ++     C LC T   T+ A       LM++G  P   ++ +G+P
Sbjct: 41  DEMLPASLSLESLQEMVAVCKKCGLCETRKQTVFADGIPHAPLMVVGEGPGVDEDATGRP 100

Query: 128 FSGKTGNMLDKMLQSIEIMRT-QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELIS 186
           F GK+G +LD+ML+++   RT   +I+ +   HPPGNRN    E++ C P +++QI+   
Sbjct: 101 FVGKSGQLLDRMLKAVGASRTNNTYIANVVKCHPPGNRNPEQAEIDQCSPYLVQQIKASR 160

Query: 187 PKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSI------IPTLATVHPQELIQY 240
           P++LL +G        N     T + +G+     T H +      IP + T HP  L++ 
Sbjct: 161 PQVLLLVGRFAIQTLLN-----TKKPVGELRG--TVHRVIVDGLDIPAVVTYHPAYLLRR 213

Query: 241 PLIKKNTWHALITLKK 256
              K+  W  L+ LK+
Sbjct: 214 SEEKQKAWDDLLLLKQ 229


>gi|73541626|ref|YP_296146.1| Phage SPO1 DNA polymerase-related protein [Ralstonia eutropha
           JMP134]
 gi|72119039|gb|AAZ61302.1| Phage SPO1 DNA polymerase-related protein [Ralstonia eutropha
           JMP134]
          Length = 285

 Score =  104 bits (259), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 57/199 (28%), Positives = 99/199 (49%), Gaps = 8/199 (4%)

Query: 59  IHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPS 118
           + +P+  +A +IA  A     L + + +   C LCST  +T+        + M+IG  P 
Sbjct: 85  VIAPVSDRAAAIA--AMDWPTLDAAVAACEACGLCSTRTNTVFGVGDREAEWMLIGEAPG 142

Query: 119 DSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPI 177
           +++++ G+PF G+ G +LD ML S+ + R + + I+ +    PPGNRN    E++ C P 
Sbjct: 143 ENEDLQGEPFVGQAGKLLDNMLASLGLRRGRNVFIANVLKCRPPGNRNPEPAEVDQCEPF 202

Query: 178 IMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQEL 237
           + RQI L+ PK+++ +G      F      +T   +GK       +  IP + T HP  L
Sbjct: 203 LKRQIALVRPKVIVVLGR-----FAAQSLLRTTTPIGKLRGTVHSYEGIPVVVTYHPAYL 257

Query: 238 IQYPLIKKNTWHALITLKK 256
           ++    K   W  L   ++
Sbjct: 258 LRTLTDKARAWEDLCLARE 276


>gi|295689039|ref|YP_003592732.1| phage SPO1 DNA polymerase-like protein [Caulobacter segnis ATCC
           21756]
 gi|295430942|gb|ADG10114.1| phage SPO1 DNA polymerase-related protein [Caulobacter segnis ATCC
           21756]
          Length = 272

 Score =  104 bits (259), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 69/263 (26%), Positives = 116/263 (44%), Gaps = 13/263 (4%)

Query: 7   LSQEQILTIALFYADSGVYWVF-DEPNNE-----ATYESQRKEKSIDSAIQP-ITNIRHI 59
           + Q  + ++  F+AD+GV   + D P +      A   ++ +        +P +  +R  
Sbjct: 5   VDQRAVESLLAFWADAGVEVSYADAPIDRLAEGVAMLRAKSQPPPPPPPTRPGLAAVRGP 64

Query: 60  HSPLVQQADSIAQKAC-SLHELKSLLRSFHDCHLCSTSLS-TICATQTEGQDLMIIGYTP 117
                  A   A  AC  L  L + + +F  C L +      + +       LMIIG  P
Sbjct: 65  DVGAAIAAAKAAAAACQDLDSLAAAIAAFDGCALKTQGAKQAVFSRGVADAPLMIIGEGP 124

Query: 118 SDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPI 177
              ++  G PF G+ G +LD+ML++  +   ++ I+    W PPGNR  +  E  +C P 
Sbjct: 125 GADEDAQGAPFVGRAGKLLDRMLKAAGL-EGRVFITNTVFWRPPGNRTPTPQEQAVCAPF 183

Query: 178 IMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSI--IPTLATVHPQ 235
           + R I L+ PK+LL  G  +       D +      G+W    +      +P + T+HP 
Sbjct: 184 VERAIALVKPKMLLLAGGASAKAMLKRD-EGILSMRGRWFEWLSEDKATELPAMPTLHPA 242

Query: 236 ELIQYPLIKKNTWHALITLKKAL 258
            L++ P  KK  W  L+TL + L
Sbjct: 243 FLLRTPAQKKKAWQDLLTLTERL 265


>gi|16125582|ref|NP_420146.1| phage SPO1 DNA polymerase-like protein [Caulobacter crescentus
           CB15]
 gi|221234331|ref|YP_002516767.1| uracil DNA glycosylase superfamily protein [Caulobacter crescentus
           NA1000]
 gi|13422678|gb|AAK23314.1| phage SPO1 DNA polymerase-related protein [Caulobacter crescentus
           CB15]
 gi|220963503|gb|ACL94859.1| uracil DNA glycosylase superfamily protein [Caulobacter crescentus
           NA1000]
          Length = 273

 Score =  103 bits (258), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 71/264 (26%), Positives = 120/264 (45%), Gaps = 14/264 (5%)

Query: 7   LSQEQILTIALFYADSGVYWVF-DEPNNE----ATYESQRKEKSIDSAIQPITNIRHIHS 61
           + Q  + ++  F+AD+GV  ++ D P +     A     + +     A      +  + S
Sbjct: 5   VDQRAVESLLAFWADAGVEALYADAPIDRLAEGAAMLRAKSQPPPPPAPVARPGMAMVRS 64

Query: 62  PLVQQADSIAQKA---CS-LHELKSLLRSFHDCHLCSTSLS-TICATQTEGQDLMIIGYT 116
           P +  A + A+ A   C+ L  L + + +F  C L S      + +       LMIIG  
Sbjct: 65  PDIASAVAAAKAAAAACNDLESLAAAIAAFEGCPLKSQGAKQAVFSRGVSDAQLMIIGEG 124

Query: 117 PSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRP 176
           P   ++  G+PF G+ G +LD+ML++  +   ++ I+    W PPGNR  +  E   C P
Sbjct: 125 PGADEDAQGQPFVGRAGKLLDRMLKAAGL-EERVFITNTVFWRPPGNRTPTPQEQATCAP 183

Query: 177 IIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSI--IPTLATVHP 234
            + R I L+ PK+LL  G  +       D +      G+W    +      +P + T+HP
Sbjct: 184 FVERAIALVKPKMLLLAGGASAKAMLKRD-EGILTMRGRWFEWVSEDQSLELPAMPTLHP 242

Query: 235 QELIQYPLIKKNTWHALITLKKAL 258
             L++ P  KK  W  L+TL + L
Sbjct: 243 AFLLRTPAQKKKAWQDLLTLTERL 266


>gi|149200965|ref|ZP_01877940.1| uracil-DNA glycosylase [Roseovarius sp. TM1035]
 gi|149145298|gb|EDM33324.1| uracil-DNA glycosylase [Roseovarius sp. TM1035]
          Length = 267

 Score =  103 bits (257), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 53/190 (27%), Positives = 94/190 (49%), Gaps = 14/190 (7%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L  L++ L ++  C L   + + +         +MIIG  P   ++  GKPF G+ G +L
Sbjct: 81  LEGLRAALGAYPHCDLRRGARNLVFGDGNPAARVMIIGEAPGRDEDQQGKPFVGRAGQLL 140

Query: 137 DKMLQSIEIMRT------QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKIL 190
           D+M+Q+I + R        ++I+ + PW PP NR+ +  E+ + RP + R + L++P ++
Sbjct: 141 DRMVQAIGLSRGAQAPQDAVYITNVLPWRPPQNRDPNAEEIAMMRPFVARHVALVNPAVI 200

Query: 191 LFIGNKTKNFFFNNDAQKTYQNL-GKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWH 249
           + +GN +         Q+    L G+W+         P L   HP  L++ P  K+  W 
Sbjct: 201 VLMGNISCEAGLG---QRGITRLRGQWAEAYG----KPALPMFHPAYLLRNPAAKREAWA 253

Query: 250 ALITLKKALK 259
            L+ LK  L+
Sbjct: 254 DLLALKARLR 263


>gi|30249369|ref|NP_841439.1| putative DNA polymerase-related protein [Nitrosomonas europaea ATCC
           19718]
 gi|30180688|emb|CAD85309.1| putative DNA polymerase-related protein, bacteriophage-type
           [Nitrosomonas europaea ATCC 19718]
          Length = 247

 Score =  103 bits (257), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 56/183 (30%), Positives = 88/183 (48%), Gaps = 6/183 (3%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKM 139
           L+ ++     C L  T   T+     E  D + IG  P   ++  G+PF G+ G +LD M
Sbjct: 64  LRQMVSGCTACPLSQTRKQTVFGVGDEQADWLFIGEGPGAREDELGEPFVGQAGKLLDNM 123

Query: 140 LQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTK 198
           LQ++ + R Q ++I+ I    PPGNRN  + E E CRP ++RQI LI P++++ +G    
Sbjct: 124 LQAVSLRRGQDVYIANIVKCRPPGNRNPQDAEAEQCRPYLLRQIALIQPRLIVALGKVAA 183

Query: 199 NFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
                 DA     ++          S IP + T HP  L++    K   W  L   +  +
Sbjct: 184 QNLLATDA-----SIASLRGRLHEFSGIPLIVTYHPAYLLRSLGDKAKAWEDLCFARDTM 238

Query: 259 KNL 261
           +NL
Sbjct: 239 RNL 241


>gi|84500233|ref|ZP_00998499.1| uracil-DNA glycosylase [Oceanicola batsensis HTCC2597]
 gi|84392167|gb|EAQ04435.1| uracil-DNA glycosylase [Oceanicola batsensis HTCC2597]
          Length = 257

 Score =  103 bits (257), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 58/210 (27%), Positives = 98/210 (46%), Gaps = 12/210 (5%)

Query: 52  PITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLM 111
           P   +R      V+ A   AQ A SL  L+  L ++  C L   + + + +       ++
Sbjct: 49  PEQPVRRKEIDAVEVARQAAQAAGSLDALREALGAYEHCALKRGARNLVFSDGHPAARVL 108

Query: 112 IIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRT------QIHISMISPWHPPGNRN 165
           I+G  P   ++  G+PF G+ G +LD+ML +I++ RT       ++I+ + PW P  NR+
Sbjct: 109 ILGEAPDRDEDREGRPFVGRAGRLLDRMLAAIDLDRTGETPDRAVYITNVLPWRPLQNRD 168

Query: 166 LSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSI 225
               E+ +  P + + IEL+ P  ++ +GN           Q   +  G W+        
Sbjct: 169 PEPEEIAMMLPFVQKHIELVDPAFVILMGNIACRAALGK--QGILRLRGTWTEAFG---- 222

Query: 226 IPTLATVHPQELIQYPLIKKNTWHALITLK 255
            PTL   HP  L+Q P  K+  W  L++LK
Sbjct: 223 RPTLPMTHPTYLLQQPRAKREAWADLLSLK 252


>gi|310814870|ref|YP_003962834.1| phage SPO1 DNA polymerase-related protein [Ketogulonicigenium
           vulgare Y25]
 gi|308753605|gb|ADO41534.1| phage SPO1 DNA polymerase-related protein [Ketogulonicigenium
           vulgare Y25]
          Length = 263

 Score =  103 bits (256), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 53/189 (28%), Positives = 91/189 (48%), Gaps = 12/189 (6%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L +L S++  F  C L   + S + +       +MI+G  P   ++ +G+PF G+ G +
Sbjct: 81  NLEQLASVMEGFDLCALKQGARSFVFSDGDPAARVMIVGEAPGREEDRAGRPFVGRAGQL 140

Query: 136 LDKMLQSIEIMRT------QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKI 189
           LD+M  +I + R+       ++I+ + PW PP NR  S+ E+ +  P + R IEL  P+ 
Sbjct: 141 LDRMFGAIGLSRSAPMADQAVYIANVLPWRPPENRTPSDTEIAMMLPFLQRHIELADPEY 200

Query: 190 LLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWH 249
           L+ +GN               +  G W+ +       P L   HP  L++ P  K+  W 
Sbjct: 201 LVLMGNTPCKALLGQ--AGILRLRGNWAEVTG----RPALPMTHPAYLLREPGAKREAWA 254

Query: 250 ALITLKKAL 258
            L++LK  L
Sbjct: 255 DLLSLKARL 263


>gi|296117296|ref|ZP_06835886.1| phage SPO1 DNA polymerase-related protein [Gluconacetobacter
           hansenii ATCC 23769]
 gi|295976062|gb|EFG82850.1| phage SPO1 DNA polymerase-related protein [Gluconacetobacter
           hansenii ATCC 23769]
          Length = 292

 Score =  103 bits (256), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 51/197 (25%), Positives = 92/197 (46%), Gaps = 13/197 (6%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           ++ EL   + +F  C L  T+  T+      G  +M++G  P   ++  G  F G+TG +
Sbjct: 90  TVEELHIAMATFGQCALRDTATHTVTPQGRPGAHVMVVGEAPDADEDRGGMAFCGETGKL 149

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
            D+M  SI + R  + ++ +  W PPG R  S +E++ C P + R I L  P+ L+ +GN
Sbjct: 150 TDRMFGSIGLSRDDLFLAPVIAWRPPGGRPPSAMELKSCLPFLQRLIVLARPRRLILMGN 209

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHS------------IIPTLATVHPQELIQYPLI 243
                    +     +  G+W ++  P +            +IP L   H Q+L   P  
Sbjct: 210 -IPVALLTGERITAARARGRWRDITVPENLSATGNNSAVPHVIPALPMRHAQQLRASPTA 268

Query: 244 KKNTWHALITLKKALKN 260
           +++ W  ++ L+K L+ 
Sbjct: 269 RRDAWKDMLELRKTLQE 285


>gi|83952423|ref|ZP_00961154.1| uracil-DNA glycosylase [Roseovarius nubinhibens ISM]
 gi|83836096|gb|EAP75394.1| uracil-DNA glycosylase [Roseovarius nubinhibens ISM]
          Length = 267

 Score =  102 bits (255), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 59/204 (28%), Positives = 96/204 (47%), Gaps = 12/204 (5%)

Query: 64  VQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNI 123
           V +A   A  A  L  LK+ +  +  C L   +   + +    G  +M+IG  P   ++ 
Sbjct: 69  VAEARKSALAAQDLAGLKAAMAGYEHCELKRGARQLVFSDGHPGARVMLIGEAPGRDEDR 128

Query: 124 SGKPFSGKTGNMLDKMLQSIEIMRTQ------IHISMISPWHPPGNRNLSNIEMEICRPI 177
           +GKPF G+ G MLD+ML +I + R         +I+ + PW PP NR+ S  E+ +  P 
Sbjct: 129 AGKPFVGQAGQMLDRMLAAIGLDRGSDDPGQGAYITNVMPWRPPQNRDPSPEEIAMMVPF 188

Query: 178 IMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQEL 237
           + R + L +P +LL +GN +         +   +  G W+         P L   HP  L
Sbjct: 189 MERHVALANPDLLLLVGNISCQAGLGK--RGITRLRGNWTEAYG----KPALPIFHPAYL 242

Query: 238 IQYPLIKKNTWHALITLKKALKNL 261
           ++ P  K+  W  L++LK  L+ L
Sbjct: 243 LRMPSAKREAWADLLSLKARLQGL 266


>gi|294085230|ref|YP_003551990.1| phage SPO1 DNA polymerase-like protein [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292664805|gb|ADE39906.1| phage SPO1 DNA polymerase-related protein [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 317

 Score =  102 bits (254), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 53/173 (30%), Positives = 91/173 (52%), Gaps = 2/173 (1%)

Query: 87  FHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIM 146
           F  C L  T+ + + A    G  LMIIG  P   +++ G PF G +G +LDKML SI + 
Sbjct: 136 FEGCALKHTASNLVFADGNPGARLMIIGEAPGRDEDMVGLPFVGVSGQLLDKMLASIGLD 195

Query: 147 RTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDA 206
           R+ ++I+ + PW PPGNR  +  E  +  P + R ++L +P  +L +G        +   
Sbjct: 196 RSHVYIANLLPWRPPGNRTPTTEETAMMLPWLRRHVQLANPDYILILGGSAAKAVLDTK- 254

Query: 207 QKTYQNLGKWSNLCTPHSII-PTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
               +  G+W ++    +I  PTLA++HP  L++ P  K+ ++  ++ +   L
Sbjct: 255 DGILKLRGRWQDVDFGDAITRPTLASLHPAYLLRSPAQKRLSFADMLAVNSRL 307


>gi|152992742|ref|YP_001358463.1| uracil-DNA glycosylase [Sulfurovum sp. NBC37-1]
 gi|151424603|dbj|BAF72106.1| uracil-DNA glycosylase [Sulfurovum sp. NBC37-1]
          Length = 222

 Score =  102 bits (254), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 102/188 (54%), Gaps = 13/188 (6%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEGQ---DLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L SL +   +CHLC  S S       EG    D++IIG  P  +++ +GKPF G++G +L
Sbjct: 42  LDSLQKQAINCHLCDLSKSRQKVVFGEGNPHADILIIGEGPGATEDSTGKPFVGRSGELL 101

Query: 137 DKMLQSI-EIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
            KML+++  + R  ++I+ I    PP NR  +  E   C+P +++QIELI PK++L +G 
Sbjct: 102 SKMLENVLGLKRADVYITNIVKCRPPNNRAPTPTEAHTCQPYLLKQIELIKPKLILTLGA 161

Query: 196 KTKNFFFNNDA--QKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALIT 253
              ++   +D    K   ++ K  N     ++IP   T HP  L++ P  KK  +  L+ 
Sbjct: 162 TAYHYLTGDDTGITKVRGSIHKHGNA----TLIP---TYHPSYLLRNPSAKKEVFEDLLK 214

Query: 254 LKKALKNL 261
           +K+ +K+ 
Sbjct: 215 VKELMKSF 222


>gi|167570399|ref|ZP_02363273.1| putative phage-related DNA polymerase [Burkholderia oklahomensis
           C6786]
          Length = 311

 Score =  101 bits (252), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 88/183 (48%), Gaps = 6/183 (3%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           EL++ +     C LC    +T+     E  D M+IG  P ++++  G+PF G+ G +LD 
Sbjct: 126 ELRARVADCRRCRLCEKRTNTVFGVGDERADWMLIGEAPGENEDKQGEPFVGQAGKLLDN 185

Query: 139 MLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT 197
           ML+++ + R + ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G   
Sbjct: 186 MLRALALKRGENVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVALVKPKLIVALGRFA 245

Query: 198 KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKA 257
                  DA     ++         +  +P + T HP  L++    K   W  L     A
Sbjct: 246 AQTLLKTDA-----SIASMRGRVHQYEGVPVIVTYHPAYLLRSLQDKAKAWSDLCLANDA 300

Query: 258 LKN 260
            +N
Sbjct: 301 YRN 303


>gi|260893068|ref|YP_003239165.1| phage SPO1 DNA polymerase-related protein [Ammonifex degensii KC4]
 gi|260865209|gb|ACX52315.1| phage SPO1 DNA polymerase-related protein [Ammonifex degensii KC4]
          Length = 210

 Score =  101 bits (252), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 55/186 (29%), Positives = 92/186 (49%), Gaps = 4/186 (2%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L EL++++++   C L +   + +         LM IG  P   ++  G+PF G  G +
Sbjct: 24  TLEELEAVVKNCRKCPLAAGRTNVVFGEGNPHALLMFIGEGPGAEEDRQGRPFVGPAGQL 83

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           LD++L +  I R +++I+ I    PPGNR  +  E E C P + RQIELI PKI++ +G 
Sbjct: 84  LDRILAACGIKREEVYIANIVKCRPPGNRVPTKEEAEACLPYLRRQIELIRPKIIVLLGA 143

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
               +   + A+ T +  G+W        I+PT    HP  L++    K+  W     ++
Sbjct: 144 TALQYLVGSGARIT-KIRGQWLGPLYGAQIMPTY---HPAALLRDASKKRPAWEDFKKVR 199

Query: 256 KALKNL 261
            A   L
Sbjct: 200 DAYFGL 205


>gi|85704408|ref|ZP_01035510.1| hypothetical protein ROS217_04999 [Roseovarius sp. 217]
 gi|85670816|gb|EAQ25675.1| hypothetical protein ROS217_04999 [Roseovarius sp. 217]
          Length = 264

 Score =  101 bits (252), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 51/187 (27%), Positives = 92/187 (49%), Gaps = 12/187 (6%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKM 139
           L++ L ++  C L   + + +         +MIIG  P   +++ G PF G+ G +LD+M
Sbjct: 81  LRAALGAYPHCDLKRGARNLVFCDGNPAARVMIIGEAPGRDEDLQGLPFVGRAGQLLDRM 140

Query: 140 LQSIEIMRTQ------IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFI 193
           L +I + R        ++I+ + PW PP NR+ S  E+ + RP + R ++LI+P +++ +
Sbjct: 141 LAAIGLTRGADAPQEAVYITNVLPWRPPQNRDPSTEEIAMMRPFVARHVDLIAPDLIVLM 200

Query: 194 GNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALIT 253
           GN + +       +   +  G W+         P L   HP  L++ P  K+  W  L+ 
Sbjct: 201 GNISCDAGLGK--RGITRLRGTWAEAYG----KPALPMFHPAYLLRTPAAKREAWADLLA 254

Query: 254 LKKALKN 260
           LK  L+ 
Sbjct: 255 LKARLRE 261


>gi|167563217|ref|ZP_02356133.1| putative phage-related DNA polymerase [Burkholderia oklahomensis
           EO147]
          Length = 253

 Score =  101 bits (251), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 88/183 (48%), Gaps = 6/183 (3%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           EL++ +     C LC    +T+     E  D M+IG  P ++++  G+PF G+ G +LD 
Sbjct: 68  ELRARVADCRRCRLCEKRTNTVFGVGDERADWMLIGEAPGENEDKQGEPFVGQAGKLLDN 127

Query: 139 MLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT 197
           ML+++ + R + ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G   
Sbjct: 128 MLRALALKRGENVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVALVKPKLIVALGRFA 187

Query: 198 KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKA 257
                  DA     ++         +  +P + T HP  L++    K   W  L     A
Sbjct: 188 AQTLLKTDA-----SIASMRGRVHQYEGVPVIVTYHPAYLLRSLQDKAKAWSDLCLANDA 242

Query: 258 LKN 260
            +N
Sbjct: 243 YRN 245


>gi|89070681|ref|ZP_01157950.1| uracil-DNA glycosylase [Oceanicola granulosus HTCC2516]
 gi|89043702|gb|EAR49906.1| uracil-DNA glycosylase [Oceanicola granulosus HTCC2516]
          Length = 261

 Score =  101 bits (251), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 60/258 (23%), Positives = 112/258 (43%), Gaps = 21/258 (8%)

Query: 18  FYADSGVYWVFDEPNNEATYESQRKEKSIDSA----IQPITNIRHIHSPL-----VQQAD 68
           + A + + W  +   +EA  ++     ++D+A      P+     +  P      V +A 
Sbjct: 8   WAAKAALDWQIELGADEAIGDAPVDRYALDAARAKPTAPVAAPNAVPVPAAPDDPVAEAR 67

Query: 69  SIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPF 128
            +A  A  L  L + +  F  C L + + S +         LMI+G  P   ++ +G+PF
Sbjct: 68  RLAAGARDLGGLAAAMEGFEHCALKAGARSFVFCDGNPDARLMIVGEAPGREEDRAGRPF 127

Query: 129 SGKTGNMLDKMLQSIEI------MRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQI 182
            G+ G +LD+ML +I +          ++I+ + PW PP NR     E+ +  P +   I
Sbjct: 128 VGRAGQLLDRMLAAIGMARAAPDAAHAVYITNVLPWRPPENRRPERAEIAMFLPFLEAHI 187

Query: 183 ELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPL 242
            L  P++L+ +GN   +           +  G W+ +      +P L   HP  L++ P 
Sbjct: 188 ALARPEVLVLMGNTPCDALLGRSGITRMR--GSWTEVLG----VPALPMFHPAFLLRQPQ 241

Query: 243 IKKNTWHALITLKKALKN 260
            K+  W  L+ ++  L+ 
Sbjct: 242 AKREAWADLLDVQARLRG 259


>gi|288940110|ref|YP_003442350.1| phage SPO1 DNA polymerase-like protein [Allochromatium vinosum DSM
           180]
 gi|288895482|gb|ADC61318.1| phage SPO1 DNA polymerase-related protein [Allochromatium vinosum
           DSM 180]
          Length = 331

 Score =  100 bits (250), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 54/179 (30%), Positives = 84/179 (46%), Gaps = 3/179 (1%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKM 139
           L + +R    C L  T   T+        DLMIIG  P   ++  G+PF G+ G +L +M
Sbjct: 156 LDAAVRGCRACRLWETRTKTVFGVGDRRADLMIIGEAPGADEDRQGEPFVGRAGQLLTRM 215

Query: 140 LQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKN 199
           L +I   R Q++I+ +    PPGNR+    E   C+  + RQ+ LI P+++L +G  +  
Sbjct: 216 LAAIGFSREQVYIANVLKCRPPGNRDPKPDEALACQAYLHRQVALIEPRVILSVGRISAQ 275

Query: 200 FFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
                D     +  G+W +    H  IP   T HP  L++ P  K   W  L  + + L
Sbjct: 276 QLLKTDT-PVGRLRGQWFDYGPAH--IPLRVTYHPAYLLRSPEQKAKAWDDLTEVWRRL 331


>gi|159045630|ref|YP_001534424.1| uracil-DNA glycosylase [Dinoroseobacter shibae DFL 12]
 gi|157913390|gb|ABV94823.1| uracil-DNA glycosylase [Dinoroseobacter shibae DFL 12]
          Length = 265

 Score =  100 bits (250), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 54/194 (27%), Positives = 92/194 (47%), Gaps = 12/194 (6%)

Query: 73  KACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKT 132
           ++ SL  L+  L ++  C L   + + + +    G  +MI+G  P   ++  G+PF G+ 
Sbjct: 76  QSGSLEALRDALAAYPHCELRKGARNLVFSDGRPGARVMILGEAPGRDEDREGRPFVGRA 135

Query: 133 GNMLDKMLQSIEIMRT------QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELIS 186
           G +LDKML +I + R        ++I+ I PW PP NR+    E+ +  P + R + L  
Sbjct: 136 GQLLDKMLAAIGLARDAPDPGHAVYITNILPWRPPQNRDPRPDEIAMMMPFVQRHVTLAD 195

Query: 187 PKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKN 246
           P+IL+ +GN +             +  G+W+         P L   HP  L++ P  K+ 
Sbjct: 196 PEILVLMGNISCQAVLGRKGITRLR--GQWTEAMD----RPALPMFHPAFLLRQPAQKRA 249

Query: 247 TWHALITLKKALKN 260
            W  L+ L+  LK 
Sbjct: 250 AWADLLDLQARLKG 263


>gi|146276280|ref|YP_001166439.1| phage SPO1 DNA polymerase-related protein [Rhodobacter sphaeroides
           ATCC 17025]
 gi|145554521|gb|ABP69134.1| phage SPO1 DNA polymerase-related protein [Rhodobacter sphaeroides
           ATCC 17025]
          Length = 259

 Score =  100 bits (250), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 90/188 (47%), Gaps = 12/188 (6%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L  L+  + ++  C L   + +T+         LM+IG  P   ++ +G+PF G+ G +L
Sbjct: 76  LGSLREAMAAYEHCDLKRGARNTVFCDGNASARLMLIGEAPGREEDAAGRPFVGRAGQLL 135

Query: 137 DKMLQSIEIMRTQ------IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKIL 190
           D+M  +I I RT       ++I+ + PW PP NR+ S  E+ +  P + R +EL +P ++
Sbjct: 136 DRMFAAIGIARTSPDPAGALYITNVMPWRPPQNRDPSAEEVAMMTPFLERHVELAAPDLI 195

Query: 191 LFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHA 250
           + +GN   +           +  G+W+         P +   HP  L++ P  K+  W  
Sbjct: 196 VVMGNTACSAVLGRTGITRLR--GRWAEAWG----RPVMPMCHPAYLLRNPEAKREAWAD 249

Query: 251 LITLKKAL 258
           L+ LK  L
Sbjct: 250 LLELKARL 257


>gi|84515828|ref|ZP_01003189.1| hypothetical protein SKA53_14301 [Loktanella vestfoldensis SKA53]
 gi|84510270|gb|EAQ06726.1| hypothetical protein SKA53_14301 [Loktanella vestfoldensis SKA53]
          Length = 257

 Score =  100 bits (249), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 52/179 (29%), Positives = 84/179 (46%), Gaps = 12/179 (6%)

Query: 87  FHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIM 146
           F  C +   + + + A    G  +MI+G  P   ++ +GKPF G+ G MLD+ML +I++ 
Sbjct: 84  FEHCEIKRGARNAVFADGQPGARVMIVGEAPGREEDRAGKPFVGQAGQMLDRMLAAIDLG 143

Query: 147 RTQ------IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNF 200
           R        ++I+ + PW PP NR     E+ +  P + R I L  P+I++ +GN     
Sbjct: 144 RAHENTDRAVYITNVMPWRPPSNRTPDADEIAMMLPFLERHIALADPQIIVLMGNTPCQA 203

Query: 201 FFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALK 259
                     +  G W+ +       P L   HP  L++ P  K+  W  L+TL   LK
Sbjct: 204 LLGQTGITALR--GTWTEVLG----KPCLPMFHPAYLLRNPAAKREAWADLLTLNARLK 256


>gi|260429553|ref|ZP_05783530.1| uracil-DNA glycosylase [Citreicella sp. SE45]
 gi|260420176|gb|EEX13429.1| uracil-DNA glycosylase [Citreicella sp. SE45]
          Length = 263

 Score =  100 bits (249), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 46/187 (24%), Positives = 95/187 (50%), Gaps = 7/187 (3%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L EL++ + ++  C L   + + + +       +MI+G  P   +++ G+PF G+ G +
Sbjct: 82  TLDELRAAIGAYEHCALKRGARNLVFSDGAPDARVMIVGEAPGRDEDLQGRPFVGRAGQL 141

Query: 136 LDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           LD+ML  + + R + ++I+ + PW PP NR+    E+ + +P + R I L+ P +L+ +G
Sbjct: 142 LDRMLAPLGLSRAENVYITNVLPWRPPQNRDPRPDEIAMMKPFLARHIALVDPDLLVIMG 201

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITL 254
           N + +       +   +  G W+         P +   HP  L++ P +K+  W  ++ +
Sbjct: 202 NISCDALLGR--RGITRLRGNWAE----AEGRPAMPMFHPAYLLRQPQMKREAWADMLAI 255

Query: 255 KKALKNL 261
              L+ L
Sbjct: 256 GAKLRAL 262


>gi|313201963|ref|YP_004040621.1| phage spo1 DNA polymerase-like protein [Methylovorus sp. MP688]
 gi|312441279|gb|ADQ85385.1| phage SPO1 DNA polymerase-related protein [Methylovorus sp. MP688]
          Length = 377

 Score =  100 bits (249), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 56/195 (28%), Positives = 95/195 (48%), Gaps = 8/195 (4%)

Query: 68  DSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKP 127
           DSIAQ       L+S + +   C L  T   T+        + +I+G  P   ++  G+P
Sbjct: 175 DSIAQ--LDWQGLQSCVANCQACSLSRTRTQTVFGVGDPAAEWLIVGEAPGAEEDKRGEP 232

Query: 128 FSGKTGNMLDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELIS 186
           F G+ G +LD ML +I++ R Q ++I+ +    PP NR+    E++ C P + RQ+ELI 
Sbjct: 233 FVGQAGQLLDNMLGAIQLKRGQNVYIANVLKCRPPQNRDPQGEEVQQCDPFLKRQVELIK 292

Query: 187 PKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKN 246
           PK++L +G        N+DA      +G        ++ +P + T HP  L++  + K  
Sbjct: 293 PKLILALGKFAAQSLLNSDA-----TIGSMRGRQHEYNGVPVIVTYHPAYLLRNLMDKAK 347

Query: 247 TWHALITLKKALKNL 261
            W  L   +  ++ L
Sbjct: 348 AWEDLCLARATMRKL 362


>gi|253999990|ref|YP_003052053.1| phage SPO1 DNA polymerase-like protein [Methylovorus sp. SIP3-4]
 gi|253986669|gb|ACT51526.1| phage SPO1 DNA polymerase-related protein [Methylovorus sp. SIP3-4]
          Length = 377

 Score =  100 bits (249), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 56/195 (28%), Positives = 95/195 (48%), Gaps = 8/195 (4%)

Query: 68  DSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKP 127
           DSIAQ       L+S + +   C L  T   T+        + +I+G  P   ++  G+P
Sbjct: 175 DSIAQ--LDWQGLQSCVANCQACSLSRTRTQTVFGVGDPAAEWLIVGEAPGAEEDKRGEP 232

Query: 128 FSGKTGNMLDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELIS 186
           F G+ G +LD ML +I++ R Q ++I+ +    PP NR+    E++ C P + RQ+ELI 
Sbjct: 233 FVGQAGQLLDNMLGAIQLKRGQNVYIANVLKCRPPQNRDPQGEEVQQCDPFLKRQVELIK 292

Query: 187 PKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKN 246
           PK++L +G        N+DA      +G        ++ +P + T HP  L++  + K  
Sbjct: 293 PKLILALGKFAAQSLLNSDA-----TIGSMRGRQHEYNGVPVIVTYHPAYLLRNLMDKAK 347

Query: 247 TWHALITLKKALKNL 261
            W  L   +  ++ L
Sbjct: 348 AWEDLCLARATMRKL 362


>gi|126740581|ref|ZP_01756268.1| uracil-DNA glycosylase [Roseobacter sp. SK209-2-6]
 gi|126718382|gb|EBA15097.1| uracil-DNA glycosylase [Roseobacter sp. SK209-2-6]
          Length = 264

 Score =  100 bits (249), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 53/184 (28%), Positives = 88/184 (47%), Gaps = 7/184 (3%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           SL  LK  +  F  C L   + + + +    G ++M+IG  P   +++ GKPF G+ G M
Sbjct: 77  SLPALKEAIAGFEHCGLKRGARNLVFSDGQAGANVMVIGEAPGRDEDLQGKPFVGRAGQM 136

Query: 136 LDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           LD+ML +I + R++ ++I+ + PW PP NR+    E+ +  P + R + L  P  L+ +G
Sbjct: 137 LDRMLTAIGLSRSENVYITNVLPWRPPQNRDPQAEEIAMMMPFLERHVALAQPDFLVLMG 196

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITL 254
           N +             +  G W          P +   HP  L++ P  K+  W  L+ L
Sbjct: 197 NISCQAVLGKRGITRLR--GNWDQAWG----KPVMPMFHPAFLLRQPHQKRQAWADLLEL 250

Query: 255 KKAL 258
           K  L
Sbjct: 251 KARL 254


>gi|302392090|ref|YP_003827910.1| phage SPO1 DNA polymerase-related protein [Acetohalobium arabaticum
           DSM 5501]
 gi|302204167|gb|ADL12845.1| phage SPO1 DNA polymerase-related protein [Acetohalobium arabaticum
           DSM 5501]
          Length = 214

 Score =  100 bits (249), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 96/195 (49%), Gaps = 5/195 (2%)

Query: 63  LVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDN 122
           L  + D   Q+  +L E+K +      C L    + T+  T      LM +G  P   ++
Sbjct: 12  LFTEQDQEQQRFNNLDEIKEVAVECERCELHKECIQTVFGTGNSDTGLMFVGEGPGRQED 71

Query: 123 ISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQI 182
             G+PF GK G + +K+L++ EI R  ++IS I    PPGNRN    EM+ C   + ++I
Sbjct: 72  EQGEPFVGKAGQLFNKILKAAEIKRKDVYISNIVKCRPPGNRNPKFSEMKSCLWFLAQEI 131

Query: 183 ELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPL 242
           +LI P I++ +G+       + D + T +  G W      + ++PT    HP  L++   
Sbjct: 132 KLIQPMIIVPLGSIAVKGLLDPDGKIT-ELRGNWVER-EGYYLLPTF---HPAALLRNEQ 186

Query: 243 IKKNTWHALITLKKA 257
            KK TWH  + +KK 
Sbjct: 187 WKKPTWHDFLKIKKG 201


>gi|307824421|ref|ZP_07654646.1| phage SPO1 DNA polymerase-related protein [Methylobacter
           tundripaludum SV96]
 gi|307734405|gb|EFO05257.1| phage SPO1 DNA polymerase-related protein [Methylobacter
           tundripaludum SV96]
          Length = 228

 Score =  100 bits (248), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 56/209 (26%), Positives = 99/209 (47%), Gaps = 5/209 (2%)

Query: 53  ITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMI 112
           + + +   +P+    ++  +   S   L++ +     C LC T   T+  +  +  D MI
Sbjct: 23  VADNQQTSTPVAIAENARPESTDSWEALQAEVAPCTQCDLCKTRTQTVFGSGNKNADWMI 82

Query: 113 IGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEME 172
           IG  P   ++  G PF G  G +L +ML++I + R ++ I+ I    PP NR+   IE+E
Sbjct: 83  IGEGPGQHEDQQGLPFVGNAGLLLTEMLRAIGLDREEVFITNIVKCRPPANRDPKPIEIE 142

Query: 173 ICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATV 232
            C+P +MRQI L+ PKI++ +G        + D     + + K        +  P +   
Sbjct: 143 TCKPYLMRQIALLKPKIIVVLGRIAAQALLDTD-----EPISKLRGKIHALNDTPVVVVY 197

Query: 233 HPQELIQYPLIKKNTWHALITLKKALKNL 261
           HP  L++  L K+  W  L    + +KN+
Sbjct: 198 HPAYLLRSMLDKRKAWADLKLALQTVKNI 226


>gi|86139051|ref|ZP_01057622.1| uracil-DNA glycosylase [Roseobacter sp. MED193]
 gi|85824282|gb|EAQ44486.1| uracil-DNA glycosylase [Roseobacter sp. MED193]
          Length = 266

 Score = 99.8 bits (247), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 54/183 (29%), Positives = 91/183 (49%), Gaps = 7/183 (3%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L  L++ +  +  C L   + + + A    G  +M+IG  P   ++  GKPF G  G +L
Sbjct: 86  LPSLRAAMAEYRHCDLKMGARNLVFADGQPGARVMVIGEAPGRDEDQQGKPFVGAAGQLL 145

Query: 137 DKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           D+MLQ+I++ R + ++I+ + PW P  NR+ S  E+++  P + R +EL  P+IL+ +GN
Sbjct: 146 DRMLQAIDLGRDKNVYITNVLPWRPQQNRDPSPEEIDMMLPFLERHVELAQPEILVLMGN 205

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
            +             +  G W+         P L   HP  L++ P  K+  W  L+ LK
Sbjct: 206 ISCQAVLGKRGITRLR--GTWAEAWG----KPVLPMFHPAYLLRQPDQKRAAWADLLELK 259

Query: 256 KAL 258
             L
Sbjct: 260 ARL 262


>gi|299067423|emb|CBJ38622.1| uracil-DNA glycosylase,phage-related protein [Ralstonia
           solanacearum CMR15]
          Length = 289

 Score = 99.8 bits (247), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 93/197 (47%), Gaps = 8/197 (4%)

Query: 61  SPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDS 120
            P+V +A  IA  A    +L+S +     C LC     T+        D M+IG  P + 
Sbjct: 92  DPVVPRAQRIA--AFDWAQLESAVSGCTACKLCERRTQTVFGVGDRQADWMLIGEAPGEQ 149

Query: 121 DNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIM 179
           ++  G+PF G+ G +LD ML++I + R T + I+ +    PPGNR+    E+ +C P + 
Sbjct: 150 EDRQGEPFVGQAGKLLDSMLRAIGLSRETGVFIANVLKCRPPGNRDPEPDEVAMCDPYLK 209

Query: 180 RQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ 239
           RQI LI P++++ +G      F      +T   +GK          +P + T HP  L++
Sbjct: 210 RQIALIKPRVIIVLGR-----FAAQSLLQTQTPVGKLRGKVHEVDGVPVVVTYHPAYLLR 264

Query: 240 YPLIKKNTWHALITLKK 256
               K   W  L   +K
Sbjct: 265 TLTDKARAWEDLCLARK 281


>gi|220916695|ref|YP_002491999.1| phage SPO1 DNA polymerase-related protein [Anaeromyxobacter
           dehalogenans 2CP-1]
 gi|219954549|gb|ACL64933.1| phage SPO1 DNA polymerase-related protein [Anaeromyxobacter
           dehalogenans 2CP-1]
          Length = 205

 Score = 99.8 bits (247), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 54/198 (27%), Positives = 88/198 (44%), Gaps = 8/198 (4%)

Query: 64  VQQADSIAQKACSLHELKSLLRSFHDCHLC---STSLSTICATQTEGQDLMIIGYTPSDS 120
           V  A  I +K C    L  +  +  DC  C       + +        +L+ +G  P   
Sbjct: 6   VAGAHRIGEKGCGSAALVQVRDALGDCRRCKLAGGRTTLVFGVGNPQAELVFVGEGPGAD 65

Query: 121 DNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMR 180
           ++  G+PF GK G +L KM+Q++   R Q++I+ +    PPGNRN    E+E C P +  
Sbjct: 66  EDREGEPFVGKAGQLLTKMIQAMGYQREQVYIANVVKCRPPGNRNPEPDEIEACEPFLRA 125

Query: 181 QIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQY 240
           Q+  I P++++ +G          D     +  G+W      +  I  + T HP  L++ 
Sbjct: 126 QLAAIRPRVVVALGKFAAQTLL-RDTTPITRLRGRWRE----YEGIRLMPTFHPAYLLRS 180

Query: 241 PLIKKNTWHALITLKKAL 258
           P  KK  W  L  + K L
Sbjct: 181 PEEKKKAWEDLQLVMKEL 198


>gi|319957234|ref|YP_004168497.1| phage spo1 DNA polymerase-related protein [Nitratifractor
           salsuginis DSM 16511]
 gi|319419638|gb|ADV46748.1| phage SPO1 DNA polymerase-related protein [Nitratifractor
           salsuginis DSM 16511]
          Length = 222

 Score = 99.8 bits (247), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 59/201 (29%), Positives = 103/201 (51%), Gaps = 9/201 (4%)

Query: 64  VQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQ---DLMIIGYTPSDS 120
           V+ +D   + A    +L+ L R    CHLC  + S       EG     LM +G  P  +
Sbjct: 26  VKPSDLDPEPAQLPDDLEELRRLVEQCHLCDLAKSRHKVVFGEGDPHARLMFVGEGPGAT 85

Query: 121 DNISGKPFSGKTGNMLDKMLQSI-EIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIM 179
           ++ +G+PF G+ G +L +M++++  + R +++I+ I    PPGNR  +  E   CRP ++
Sbjct: 86  EDQTGRPFVGRAGELLTRMIENVLHLRREEVYIANIVKCRPPGNRVPTPTEAFTCRPYLL 145

Query: 180 RQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ 239
           +QIE+I P+I++ +G  T   +  ND     +  G        ++++PT    HP  L++
Sbjct: 146 KQIEIIRPRIIMTLG-ATAYRYLTNDETPISRVRGHIIQ-SDHYTLVPTF---HPSYLLR 200

Query: 240 YPLIKKNTWHALITLKKALKN 260
            P  KK  W  L+ +K  L+ 
Sbjct: 201 NPSAKKQAWEDLLKVKALLEK 221


>gi|167646129|ref|YP_001683792.1| phage SPO1 DNA polymerase-like protein [Caulobacter sp. K31]
 gi|167348559|gb|ABZ71294.1| phage SPO1 DNA polymerase-related protein [Caulobacter sp. K31]
          Length = 272

 Score = 99.4 bits (246), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 51/175 (29%), Positives = 83/175 (47%), Gaps = 5/175 (2%)

Query: 87  FHDCHL-CSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEI 145
           F  C L    +   + +       LMIIG  P   +++ G PF G+ G +LD+ML++  +
Sbjct: 93  FDGCPLKTQGARQAVVSRGPADAPLMIIGEAPGADEDLQGAPFVGRAGQLLDRMLKAAGL 152

Query: 146 MRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNND 205
           +      + +  W PPGNR  +  E  +C P + R I L+ PKILL +G  +       D
Sbjct: 153 LDRAFVTNTVF-WRPPGNRTPTPQEQAVCAPFLERAIALVQPKILLLVGGASAKSLLRRD 211

Query: 206 AQKTYQNLGKWSNLCTP--HSIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
            +      G+W    +    + +P L T+HP  L++ P  KK  W  ++ L + L
Sbjct: 212 -EGILSLRGRWFEWTSSDGQNELPALPTLHPAFLLRQPAAKKKAWTDMLMLSERL 265


>gi|94310339|ref|YP_583549.1| phage SPO1 DNA polymerase-related protein [Cupriavidus
           metallidurans CH34]
 gi|93354191|gb|ABF08280.1| DNA polymerase bacteriophage-type,uracil-DNA glycosylase
           superfamily [Cupriavidus metallidurans CH34]
          Length = 317

 Score = 99.4 bits (246), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 86/168 (51%), Gaps = 6/168 (3%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C LCST  +T+     +  + M++G  P +++++ G+PF G+ G +LD ML ++ + R +
Sbjct: 146 CGLCSTRTNTVFGVGDQQAEWMLVGEAPGENEDLQGEPFVGQAGKLLDNMLGALGLARGR 205

Query: 150 -IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQK 208
            ++I+ +    PPGNRN    E+  C P + RQI LI PK+++ +G      F      +
Sbjct: 206 NVYIANVLKCRPPGNRNPEPGEVAQCEPYLKRQIALIKPKVIVVLGR-----FAAQSLLR 260

Query: 209 TYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
           +   +GK       +  IP + T HP  L++    K   W  L   ++
Sbjct: 261 STTPIGKLRGAVHSYEGIPVVVTYHPAYLLRTLTDKARAWEDLCLARE 308


>gi|126728290|ref|ZP_01744106.1| uracil-DNA glycosylase [Sagittula stellata E-37]
 gi|126711255|gb|EBA10305.1| uracil-DNA glycosylase [Sagittula stellata E-37]
          Length = 258

 Score = 99.0 bits (245), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 47/176 (26%), Positives = 86/176 (48%), Gaps = 7/176 (3%)

Query: 87  FHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIM 146
           +  C L   + S + +       +M++G  P   +++ GKPF G+ G +LD+ML ++ + 
Sbjct: 88  YDHCELKRGARSLVFSDGAAAARVMLVGEAPGRDEDLQGKPFVGRAGQLLDRMLAAVGLS 147

Query: 147 RTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNND 205
           R + ++I+ + PW PP NR+    E+ +  P + + I L+ P +L+ +GN +        
Sbjct: 148 RDESVYITNVLPWRPPQNRDPKPDEIAMMLPFLKKHIALVDPDLLVIVGNISAQALLGRR 207

Query: 206 AQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
                +  G W          P L  VHP  L++ P  K+  W+ ++ LK  L+ L
Sbjct: 208 GITRLR--GTWQE----AEGRPALPMVHPAYLLRNPGFKREAWNDMLELKVKLRTL 257


>gi|255262434|ref|ZP_05341776.1| uracil-DNA glycosylase [Thalassiobium sp. R2A62]
 gi|255104769|gb|EET47443.1| uracil-DNA glycosylase [Thalassiobium sp. R2A62]
          Length = 270

 Score = 99.0 bits (245), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 95/201 (47%), Gaps = 13/201 (6%)

Query: 64  VQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNI 123
           V  A   AQ A S+  L   + +F  C L   + ST+         +MIIG  P+  ++ 
Sbjct: 74  VNAARLAAQNATSIETLTETVNAFEHCELKRGARSTLLGVGAASAPVMIIGEPPNRDEDR 133

Query: 124 SGKPFSGKTGNMLDKMLQSIEIMR------TQIHISMISPWHPPGNRNLSNIEMEICRPI 177
            G+ F G  G +LD+ML +I   R      T + ++ + PW PP NR+ +  E+ +  P 
Sbjct: 134 EGRAFVGAAGQLLDRMLAAIGRDRNATDPETGVFVASVMPWRPP-NRDPNATELAMTMPF 192

Query: 178 IMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQEL 237
           + R +EL+ PKI++ +GN +       +     +  G+W          P L   +P+ L
Sbjct: 193 LERLVELVDPKIVILMGNVSCQAALGRNGITRLR--GQWLTGFN----RPVLPMFNPEFL 246

Query: 238 IQYPLIKKNTWHALITLKKAL 258
           ++ P  K+  WH L+ +K  L
Sbjct: 247 LRTPAAKREAWHDLLMVKAKL 267


>gi|117926680|ref|YP_867297.1| phage SPO1 DNA polymerase-related protein [Magnetococcus sp. MC-1]
 gi|117610436|gb|ABK45891.1| phage SPO1 DNA polymerase-related protein [Magnetococcus sp. MC-1]
          Length = 300

 Score = 99.0 bits (245), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 53/192 (27%), Positives = 96/192 (50%), Gaps = 9/192 (4%)

Query: 71  AQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSG 130
           A KA +L  +    ++   C LC T    +         ++ +G  P   ++  G+PF G
Sbjct: 108 AGKAAALEHIAQHCQACQRCDLCRTRTQAVPGIGHPDAPVVFVGEAPGAEEDRIGQPFVG 167

Query: 131 KTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKIL 190
             G +LD+M+ +I + R  ++I+ +    PPGNRN    E+ +C+  + +Q+E+ISPK++
Sbjct: 168 PAGQLLDRMMATIGLQREHVYIANVVKCRPPGNRNPQTHEVALCQGYLHQQLEVISPKVI 227

Query: 191 LFIGN-KTKNFFFNNDA-QKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTW 248
             +G    ++   + D+     ++   W         IP LA+ HP   ++ P  KK+ W
Sbjct: 228 FALGRFAIQSLLGSTDSVAAIRRHEHSWRG-------IPVLASYHPAFYLRTPTRKKDGW 280

Query: 249 HALITLKKALKN 260
             LI L++ L+N
Sbjct: 281 LDLIRLQQLLEN 292


>gi|153004366|ref|YP_001378691.1| phage SPO1 DNA polymerase-like protein [Anaeromyxobacter sp.
           Fw109-5]
 gi|152027939|gb|ABS25707.1| phage SPO1 DNA polymerase-related protein [Anaeromyxobacter sp.
           Fw109-5]
          Length = 255

 Score = 99.0 bits (245), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 55/193 (28%), Positives = 89/193 (46%), Gaps = 8/193 (4%)

Query: 69  SIAQKAC---SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISG 125
           + A K C   +L  L+  L     C L  T    +    +   +LM +G  P   ++  G
Sbjct: 61  TTADKGCGSPALLGLRGELGECTRCKLAGTRTHVVFGVGSPAAELMFVGEGPGADEDQQG 120

Query: 126 KPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELI 185
           +PF GK G +L KM++++   R  ++I+ +    PPGNRN    E+  C P +  QI  I
Sbjct: 121 EPFVGKAGQLLTKMIEAMGFRREDVYIANVVKCRPPGNRNPEPDELAACEPFLRAQIAAI 180

Query: 186 SPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKK 245
           SPK+++ +G          D     +  G+WS+    +  +  + T HP  L++ P  KK
Sbjct: 181 SPKVIVALGKFAAQTLL-RDTTPISKLRGRWSS----YEGVKLMPTFHPAYLLRSPEEKK 235

Query: 246 NTWHALITLKKAL 258
             W  L  + K L
Sbjct: 236 KAWEDLQLVMKEL 248


>gi|77464581|ref|YP_354085.1| hypothetical protein RSP_1001 [Rhodobacter sphaeroides 2.4.1]
 gi|77388999|gb|ABA80184.1| hypothetical protein RSP_1001 [Rhodobacter sphaeroides 2.4.1]
          Length = 260

 Score = 98.6 bits (244), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 49/189 (25%), Positives = 90/189 (47%), Gaps = 12/189 (6%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L  L+  + ++  C L   + +T+ +       LM+IG  P   ++ +G+PF G+ G +
Sbjct: 76  TLEALREAMAAYDHCDLKRGARNTVFSDGHPAARLMLIGEAPGREEDAAGRPFVGRAGQL 135

Query: 136 LDKMLQSIEIMRTQ------IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKI 189
           LD+M  +I + RT       ++I+ + PW PP NR+ S  E+ +  P + R +EL +P +
Sbjct: 136 LDRMFAAIGLSRTSPDAETALYITNVMPWRPPQNRDPSAEEVAMMTPFLARHVELAAPDL 195

Query: 190 LLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWH 249
           ++  GN               +  G+W+         P +   HP  L++ P  K+  W 
Sbjct: 196 IVVTGNTACAALLGRTGITRLR--GRWAEAWG----RPVMPMCHPAYLLRNPEAKREAWA 249

Query: 250 ALITLKKAL 258
            L+ +K  L
Sbjct: 250 DLLEVKARL 258


>gi|330837396|ref|YP_004412037.1| phage SPO1 DNA polymerase-related protein [Spirochaeta coccoides
           DSM 17374]
 gi|329749299|gb|AEC02655.1| phage SPO1 DNA polymerase-related protein [Spirochaeta coccoides
           DSM 17374]
          Length = 289

 Score = 98.6 bits (244), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 54/171 (31%), Positives = 88/171 (51%), Gaps = 13/171 (7%)

Query: 74  ACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQD----LMIIGYTPSDSDNISGKPFS 129
           +CSL EL +L+ S  +C LC T   T+     EGQ+    +M+IG  P   +++SG+PF 
Sbjct: 96  SCSLKELSTLVSSCKNCRLCETRTYTVFG---EGQEEHPVVMVIGEGPGRDEDLSGRPFV 152

Query: 130 GKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPK 188
           GK G  +D+    I + R T  +I+ I    PPGNR+    E++ C P + RQI L+ P+
Sbjct: 153 GKGGQYMDRWFAPIGVSRQTNAYIANIVKCRPPGNRDPLPDEVQACIPYLRRQIALVQPR 212

Query: 189 ILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ 239
           ++L  G    +        +T + +G        +  IP + T HP  +++
Sbjct: 213 VILLAGAVAAHAIL-----ETKEGVGALRGRTFSYMNIPVIVTYHPAGVLR 258


>gi|77919605|ref|YP_357420.1| phage SpO1 DNA polymerase-like protein [Pelobacter carbinolicus DSM
           2380]
 gi|77545688|gb|ABA89250.1| phage SpO1 DNA polymerase-related protein [Pelobacter carbinolicus
           DSM 2380]
          Length = 224

 Score = 98.6 bits (244), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 52/202 (25%), Positives = 91/202 (45%), Gaps = 8/202 (3%)

Query: 62  PLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLST---ICATQTEGQDLMIIGYTPS 118
           PL   AD    K C    L+ +     DC  C+ S      +     E   L+ +G  P 
Sbjct: 25  PLPSAADGDTSKPCRQEALEEVRADLGDCRRCALSKKRKHIVFGGGNEKARLVFVGEAPG 84

Query: 119 DSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPII 178
             ++  G PF G+ G +LD+ML ++ + R +++I  +    PPGNR+    E+E C P +
Sbjct: 85  RDEDEQGIPFVGEAGRLLDRMLFAMGLDRDEVYICNVQKCRPPGNRDPLPEEIEACEPFL 144

Query: 179 MRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELI 238
            RQ+  I P++++ +G          + +   +  G W      +  +P + T HP  L+
Sbjct: 145 RRQLAAIRPRVIVTLGRFAAQTLL-REREAISRLRGHWHA----YEGVPLMPTYHPAYLL 199

Query: 239 QYPLIKKNTWHALITLKKALKN 260
           + P  K+  W  L  +   L++
Sbjct: 200 RNPASKREVWEDLKQVMGRLRD 221


>gi|328948441|ref|YP_004365778.1| phage SPO1 DNA polymerase-related protein [Treponema succinifaciens
           DSM 2489]
 gi|328448765|gb|AEB14481.1| phage SPO1 DNA polymerase-related protein [Treponema succinifaciens
           DSM 2489]
          Length = 289

 Score = 98.6 bits (244), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 58/191 (30%), Positives = 90/191 (47%), Gaps = 4/191 (2%)

Query: 67  ADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGK 126
           A+    +  +L  + + + S  +C LC    +T+     E   +M+IG  P + ++ +G+
Sbjct: 84  AEKAPSQGATLESIATKIASCKNCILCKARTNTVPGEGVENPYVMVIGEGPGEDEDKTGR 143

Query: 127 PFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELI 185
           PF GK G +LDKML +I + R T  +I+ I    PP NR     E   C   +  QI ++
Sbjct: 144 PFVGKAGQLLDKMLAAISLGRTTNCYIANIVKCRPPMNRTPMPDEAHACSGYLQAQIHIL 203

Query: 186 SPKILLFIGNKTKNFFFNNDAQKTYQNL-GKWSNLCTPHSIIPTLATVHPQELIQYPLIK 244
            PK +L +G          D Q+   +L GKW       + IP LAT HP  L++    K
Sbjct: 204 KPKYILAMGRTAVQNLL--DTQEGINSLRGKWLEYSLGETKIPLLATYHPSALLRNESFK 261

Query: 245 KNTWHALITLK 255
           +  W  L   K
Sbjct: 262 RPAWEDLKVFK 272


>gi|84684257|ref|ZP_01012159.1| hypothetical protein 1099457000262_RB2654_17451 [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84668010|gb|EAQ14478.1| hypothetical protein RB2654_17451 [Rhodobacterales bacterium
           HTCC2654]
          Length = 264

 Score = 98.6 bits (244), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 56/202 (27%), Positives = 95/202 (47%), Gaps = 12/202 (5%)

Query: 64  VQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNI 123
           V  A   A  A SL  L   ++++    L   + S + +       +MI+G  P   ++ 
Sbjct: 66  VAVAKEHAAGAGSLEALAEAMQAYDGSPLKKGARSFVFSDGNPAARVMIVGEGPGAEEDR 125

Query: 124 SGKPFSGKTGNMLDKMLQSIEIMRT------QIHISMISPWHPPGNRNLSNIEMEICRPI 177
            GKPF G  G +LD+M  +I + R        ++I+ + P+ PPGNRN +  E+ +  P 
Sbjct: 126 EGKPFVGPAGRLLDQMFAAIGLNRATPDAQNALYITNVVPYRPPGNRNPTPEEIAMFTPF 185

Query: 178 IMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQEL 237
           ++R IEL  P I++ +GN         D Q   +  G W+ +       P L   HP  L
Sbjct: 186 LLRHIELADPDIIIPMGNIALTALL--DRQGITKLRGTWTEVLG----KPALPMFHPSYL 239

Query: 238 IQYPLIKKNTWHALITLKKALK 259
           ++ P+ K+  W  L+ ++  L+
Sbjct: 240 LRNPISKREAWADLLDIQAKLR 261


>gi|332559474|ref|ZP_08413796.1| Phage SPO1 DNA polymerase-related protein [Rhodobacter sphaeroides
           WS8N]
 gi|332277186|gb|EGJ22501.1| Phage SPO1 DNA polymerase-related protein [Rhodobacter sphaeroides
           WS8N]
          Length = 259

 Score = 98.6 bits (244), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 49/189 (25%), Positives = 90/189 (47%), Gaps = 12/189 (6%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L  L+  + ++  C L   + +T+ +       LM+IG  P   ++ +G+PF G+ G +
Sbjct: 75  TLEALREAMAAYDHCDLKRGARNTVFSDGHPAARLMLIGEAPGREEDAAGRPFVGRAGQL 134

Query: 136 LDKMLQSIEIMRTQ------IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKI 189
           LD+M  +I + RT       ++I+ + PW PP NR+ S  E+ +  P + R +EL +P +
Sbjct: 135 LDRMFAAIGLSRTSPDAETALYITNVMPWRPPQNRDPSPEEVAMMTPFLARHVELAAPDL 194

Query: 190 LLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWH 249
           ++  GN               +  G+W+         P +   HP  L++ P  K+  W 
Sbjct: 195 IVVTGNTACAALLGRTGITRLR--GRWAEAWG----RPVMPMCHPAYLLRNPEAKREAWA 248

Query: 250 ALITLKKAL 258
            L+ +K  L
Sbjct: 249 DLLEVKARL 257


>gi|221640492|ref|YP_002526754.1| Phage SPO1 DNA polymerase-related protein [Rhodobacter sphaeroides
           KD131]
 gi|221161273|gb|ACM02253.1| Phage SPO1 DNA polymerase-related protein [Rhodobacter sphaeroides
           KD131]
          Length = 260

 Score = 98.6 bits (244), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 49/189 (25%), Positives = 90/189 (47%), Gaps = 12/189 (6%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L  L+  + ++  C L   + +T+ +       LM+IG  P   ++ +G+PF G+ G +
Sbjct: 76  TLEALREAMAAYDHCDLKRGARNTVFSDGHPAARLMLIGEAPGREEDAAGRPFVGRAGQL 135

Query: 136 LDKMLQSIEIMRTQ------IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKI 189
           LD+M  +I + RT       ++I+ + PW PP NR+ S  E+ +  P + R +EL +P +
Sbjct: 136 LDRMFAAIGLSRTSPDAETALYITNVMPWRPPQNRDPSPEEVAMMTPFLARHVELAAPDL 195

Query: 190 LLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWH 249
           ++  GN               +  G+W+         P +   HP  L++ P  K+  W 
Sbjct: 196 IVVTGNTACAALLGRTGITRLR--GRWAEAWG----RPVMPMCHPAYLLRNPEAKREAWA 249

Query: 250 ALITLKKAL 258
            L+ +K  L
Sbjct: 250 DLLEVKARL 258


>gi|126463421|ref|YP_001044535.1| phage SPO1 DNA polymerase-related protein [Rhodobacter sphaeroides
           ATCC 17029]
 gi|126105085|gb|ABN77763.1| phage SPO1 DNA polymerase-related protein [Rhodobacter sphaeroides
           ATCC 17029]
          Length = 260

 Score = 98.6 bits (244), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 49/189 (25%), Positives = 90/189 (47%), Gaps = 12/189 (6%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L  L+  + ++  C L   + +T+ +       LM+IG  P   ++ +G+PF G+ G +
Sbjct: 76  TLEALREAMAAYDHCDLKRGARNTVFSDGHPAARLMLIGEAPGREEDAAGRPFVGRAGQL 135

Query: 136 LDKMLQSIEIMRTQ------IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKI 189
           LD+M  +I + RT       ++I+ + PW PP NR+ S  E+ +  P + R +EL +P +
Sbjct: 136 LDRMFAAIGLSRTSLDAETALYITNVMPWRPPQNRDPSPEEVAMMTPFLARHVELAAPDL 195

Query: 190 LLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWH 249
           ++  GN               +  G+W+         P +   HP  L++ P  K+  W 
Sbjct: 196 IVVTGNTACAALLGRTGITRLR--GRWAEAWG----RPVMPMCHPAYLLRNPEAKREAWA 249

Query: 250 ALITLKKAL 258
            L+ +K  L
Sbjct: 250 DLLEVKARL 258


>gi|193213467|ref|YP_001999420.1| phage SPO1 DNA polymerase-related protein [Chlorobaculum parvum
           NCIB 8327]
 gi|193086944|gb|ACF12220.1| phage SPO1 DNA polymerase-related protein [Chlorobaculum parvum
           NCIB 8327]
          Length = 207

 Score = 98.6 bits (244), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 55/199 (27%), Positives = 90/199 (45%), Gaps = 9/199 (4%)

Query: 59  IHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPS 118
           +  P+ +Q    A  A  L  L  +++    C L  T  S +         + +IG  P 
Sbjct: 6   LFDPVPEQPKQQAVPALDLGSLGKVVQECRKCRLAETRNSVVFGEGNPKARVFVIGEAPG 65

Query: 119 DSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPII 178
             ++  G+PF G++G +LDK+L +I   R+ ++I  I    PP NRN    E+E C+P +
Sbjct: 66  ADEDAQGRPFVGRSGQLLDKILLAIGFERSDVYIGNIIKCRPPQNRNPLGDEIECCKPWL 125

Query: 179 MRQIELISPKILLFIGNKTKNFFFNN--DAQKTYQNLGKWSNLCTPHSIIPTLATVHPQE 236
           M+Q+E+I P I+L +G    N    N          L +W+             T HP  
Sbjct: 126 MQQLEIIKPNIILLLGRVAANTILENTLSMSAMRGKLIRWNGF-------DCFVTYHPAA 178

Query: 237 LIQYPLIKKNTWHALITLK 255
           L++ P  K+  W  +  L+
Sbjct: 179 LLRNPNWKRLCWEDVQLLR 197


>gi|186476121|ref|YP_001857591.1| phage SPO1 DNA polymerase-like protein [Burkholderia phymatum
           STM815]
 gi|184192580|gb|ACC70545.1| phage SPO1 DNA polymerase-related protein [Burkholderia phymatum
           STM815]
          Length = 341

 Score = 98.2 bits (243), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 86/173 (49%), Gaps = 6/173 (3%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKM 139
           L++ + +   C LC    +T+        D M+IG  P ++++  G+PF G+ G +LD M
Sbjct: 156 LEARVSACERCRLCERRTNTVFGVGDREADWMLIGEAPGENEDKQGEPFVGQAGKLLDNM 215

Query: 140 LQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTK 198
           L+S+ + R T ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G    
Sbjct: 216 LRSLGLARGTNVYIANVIKCRPPGNRNPERDEVARCEPYLQRQVALVKPKLIIALGR--- 272

Query: 199 NFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
             F      KT  ++         +  +P + T HP  L++    K  +W  L
Sbjct: 273 --FAAQSLLKTEASISSLRGRVYEYEGVPVVVTYHPAYLLRSLGDKAKSWQDL 323


>gi|33594425|ref|NP_882069.1| bacteriophage-related DNA polymerase [Bordetella pertussis Tohama
           I]
 gi|33564500|emb|CAE43815.1| bacteriophage-related DNA polymerase [Bordetella pertussis Tohama
           I]
 gi|332383836|gb|AEE68683.1| DNA polymerase [Bordetella pertussis CS]
          Length = 298

 Score = 98.2 bits (243), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 55/184 (29%), Positives = 91/184 (49%), Gaps = 5/184 (2%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L +L+ L++    C LC      +     +    M++G  P + ++  G PF G++G +L
Sbjct: 117 LGQLQQLVQDCTACGLCQGRRHAVFGMGAQPARWMVVGEAPGEQEDRQGLPFVGRSGKLL 176

Query: 137 DKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           D MLQS+ + R + + I+ +    PPGNRN    E+  C P + RQI L++P+ +L +G 
Sbjct: 177 DAMLQSVGMSRERDVFIANVIKCRPPGNRNPKPEEIAACSPYLRRQIALLNPERILVLGR 236

Query: 196 KTKNFFFNNDAQKTYQNL-GKWSNLCTPHS-IIPTLATVHPQELIQYPLIKKNTWHALIT 253
                  N +A  T  NL G+  +L T     IP + + HP  L++ P  K   W  L+ 
Sbjct: 237 FAAQTLLNTEA--TIGNLRGRVHSLQTDEGRSIPVVVSYHPAYLLRSPAEKARAWQDLLL 294

Query: 254 LKKA 257
             + 
Sbjct: 295 AARG 298


>gi|312143585|ref|YP_003995031.1| phage SPO1 DNA polymerase-related protein [Halanaerobium sp.
           'sapolanicus']
 gi|311904236|gb|ADQ14677.1| phage SPO1 DNA polymerase-related protein [Halanaerobium sp.
           'sapolanicus']
          Length = 210

 Score = 98.2 bits (243), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 53/168 (31%), Positives = 86/168 (51%), Gaps = 5/168 (2%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C L     + +         +M+IG  P  +++   +PF G+ G ++DK+LQS+ + R +
Sbjct: 35  CQLREGCSNVVMGEGNLDNKIMLIGEGPGATEDRMARPFVGRAGKLMDKILQSVNLKRDE 94

Query: 150 IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKT 209
           I+I+ +    PP NR     E++ C  I+  +IELI PK+++ +G+   NF  N +   T
Sbjct: 95  IYITNVVKCRPPDNRVPYKKEVKACSAILKAEIELIEPKVVVTLGSTATNFLLNPEDSIT 154

Query: 210 YQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKA 257
               GKW         I  LAT HP  L++   +KK +WH    +KKA
Sbjct: 155 KMR-GKW----LKRGDIYFLATFHPAYLLRNENMKKYSWHDFKLIKKA 197


>gi|296158932|ref|ZP_06841760.1| phage SPO1 DNA polymerase-related protein [Burkholderia sp. Ch1-1]
 gi|295890807|gb|EFG70597.1| phage SPO1 DNA polymerase-related protein [Burkholderia sp. Ch1-1]
          Length = 391

 Score = 98.2 bits (243), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 80/163 (49%), Gaps = 6/163 (3%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-T 148
           C LC    ST+      G D M+IG  P ++++  G+PF G+ G +LD ML+S+ + R T
Sbjct: 215 CRLCEKRRSTVFGVGDRGADWMLIGEAPGENEDRLGEPFVGQAGKLLDNMLRSLTLARDT 274

Query: 149 QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQK 208
            ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G          DA  
Sbjct: 275 NVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVALVKPKLIVALGRFAAQSLLKTDA-- 332

Query: 209 TYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
              ++         +  +P + T HP  L++    K   W  L
Sbjct: 333 ---SISSLRGRVHEYEGVPVIVTYHPAYLLRSLPDKAKAWADL 372


>gi|167837067|ref|ZP_02463950.1| putative phage-related DNA polymerase [Burkholderia thailandensis
           MSMB43]
          Length = 208

 Score = 98.2 bits (243), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 86/182 (47%), Gaps = 6/182 (3%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKM 139
           L++ +     C LC    +T+     E  D M++G  P ++++  G+PF G+ G +LD M
Sbjct: 24  LRARVADCERCRLCEKRTNTVFGVGDESADWMLVGEAPGENEDKQGEPFVGQAGKLLDNM 83

Query: 140 LQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTK 198
           L+++ + R + ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G    
Sbjct: 84  LRALALKRGENVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVALVKPKLIVALGRFAA 143

Query: 199 NFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
                 DA     ++         +  +P + T HP  L++    K   W  L       
Sbjct: 144 QTLLKTDA-----SIASMRGRVHRYEGVPVIVTYHPAYLLRSLQDKAKAWSDLCLANDTY 198

Query: 259 KN 260
           +N
Sbjct: 199 RN 200


>gi|291541525|emb|CBL14635.1| uracil-DNA glycosylase, family 4 [Ruminococcus bromii L2-63]
          Length = 191

 Score = 98.2 bits (243), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 96/182 (52%), Gaps = 6/182 (3%)

Query: 78  HELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLD 137
            ELKS   + H C LC T  + +     E  ++M IG  P +++++ G+PF G+ G +LD
Sbjct: 6   EELKSACENCHRCELCETRTNVVVGVGNENAEVMFIGEGPGENEDLQGEPFVGRAGKLLD 65

Query: 138 KMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
           KML ++++ R + I+I+ +    PP NR+    E E+C   +  Q+ +I PKI++ +G  
Sbjct: 66  KMLAAVDLDRNKNIYIANMVKCRPPKNRDPKPEEQEMCIEWLRTQVRMIKPKIIVCLGRI 125

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
                  +D + T ++ G+W       + +  +A +HP  +++ P  K + +   + L+ 
Sbjct: 126 AAARLIKSDIKITKEH-GQW----IEKNGVLMMAMLHPAAILRDPRRKPDAFDDFLKLRD 180

Query: 257 AL 258
            +
Sbjct: 181 KI 182


>gi|194337589|ref|YP_002019383.1| phage SPO1 DNA polymerase-related protein [Pelodictyon
           phaeoclathratiforme BU-1]
 gi|194310066|gb|ACF44766.1| phage SPO1 DNA polymerase-related protein [Pelodictyon
           phaeoclathratiforme BU-1]
          Length = 203

 Score = 98.2 bits (243), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 86/182 (47%), Gaps = 8/182 (4%)

Query: 70  IAQKACSLHELKSLL---RSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGK 126
           + + A S  EL  L    R    C L  T L+ +         L +IG  P   ++ SG+
Sbjct: 7   VEEPASSSQELALLFETARKCRKCQLAETRLNFVFGEGDPAAKLAVIGEAPGAEEDASGR 66

Query: 127 PFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELIS 186
           PF G++G +LDK+LQ+    R +++I  I    PPGNRN    E+E C P ++ Q+++++
Sbjct: 67  PFVGRSGQLLDKILQAAGFNRPEVYICNILKCRPPGNRNPLPDEIENCIPWLLEQLQIVN 126

Query: 187 PKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKN 246
           PK++L +G    N  F N       +LG                T HP  L++ P  K+ 
Sbjct: 127 PKVILILGKVAANTIFENKL-----SLGSMRGKAIKWKGYDCFITYHPAALLRNPEWKRG 181

Query: 247 TW 248
            W
Sbjct: 182 CW 183


>gi|197121903|ref|YP_002133854.1| phage SPO1 DNA polymerase-related protein [Anaeromyxobacter sp. K]
 gi|196171752|gb|ACG72725.1| phage SPO1 DNA polymerase-related protein [Anaeromyxobacter sp. K]
          Length = 295

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 52/192 (27%), Positives = 86/192 (44%), Gaps = 8/192 (4%)

Query: 70  IAQKACSLHELKSLLRSFHDCHLC---STSLSTICATQTEGQDLMIIGYTPSDSDNISGK 126
           I +K C    L  +  +  DC  C       + +        +L+ +G  P   ++  G+
Sbjct: 102 IGEKGCGSAALVQVRDALGDCRRCKLAGGRTTLVFGVGNPQAELVFVGEGPGADEDREGE 161

Query: 127 PFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELIS 186
           PF GK G +L KM+Q++   R Q++I+ +    PPGNRN    E+E C P +  Q+  I 
Sbjct: 162 PFVGKAGQLLTKMIQAMGYQREQVYIANVVKCRPPGNRNPEPDEIEACEPFLRAQLAAIR 221

Query: 187 PKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKN 246
           P++++ +G          D     +  G+W      +  I  + T HP  L++ P  KK 
Sbjct: 222 PRVVVALGKFAAQTLL-RDTTPITRLRGRWRE----YEGIRLMPTFHPAYLLRSPEEKKK 276

Query: 247 TWHALITLKKAL 258
            W  L  + K L
Sbjct: 277 AWEDLQLVMKEL 288


>gi|270159414|ref|ZP_06188070.1| uracil-DNA glycosylase family 4 protein [Legionella longbeachae
           D-4968]
 gi|289165775|ref|YP_003455913.1| C-terminal part of DNA polymerase, bacteriophage-type [Legionella
           longbeachae NSW150]
 gi|269987753|gb|EEZ94008.1| uracil-DNA glycosylase family 4 protein [Legionella longbeachae
           D-4968]
 gi|288858948|emb|CBJ12874.1| putative C-terminal part of DNA polymerase, bacteriophage-type
           [Legionella longbeachae NSW150]
          Length = 211

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 58/183 (31%), Positives = 93/183 (50%), Gaps = 8/183 (4%)

Query: 79  ELKSLLRSFHDCHLC---STSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L SL +    C  C    T   T+     E   LMI+G  P   ++  G PF GK G +
Sbjct: 29  DLSSLAKEVSSCTRCPLHKTRTQTVFYRGHEKAKLMIVGEAPGFYEDQQGLPFVGKAGGL 88

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           L++ML+SIE++   ++I+ +    PP NR+    E+  C   ++RQIEL+ P ++L +G 
Sbjct: 89  LNQMLRSIEMVEKDVYIANVLKCRPPDNRDPHLDEIAQCSSFLVRQIELVKPHLILALGR 148

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
               F  N        +L +  N    ++ IP + + HP  L++ P  KK T+  L+T+K
Sbjct: 149 FAGQFLLNKPL-----SLKQLRNTIHHYNNIPFIVSYHPAYLLRNPSDKKKTYIDLLTVK 203

Query: 256 KAL 258
           K L
Sbjct: 204 KLL 206


>gi|167619562|ref|ZP_02388193.1| putative phage-related DNA polymerase [Burkholderia thailandensis
           Bt4]
          Length = 263

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 51/187 (27%), Positives = 92/187 (49%), Gaps = 8/187 (4%)

Query: 66  QADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISG 125
           +A S+A+      EL++ +     C LC    +T+     E  D M++G  P ++++  G
Sbjct: 67  RAPSVAE--LGWDELRARVADCERCRLCEKRTNTVFGVGDERADWMLVGEAPGENEDKQG 124

Query: 126 KPFSGKTGNMLDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIEL 184
           +PF G+ G +LD ML+++ + R + ++I+ +    PPGNRN    E+  C P + RQ+ L
Sbjct: 125 EPFVGQAGKLLDNMLRALALKRGENVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVAL 184

Query: 185 ISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIK 244
           + PK+++ +G      F      KT  ++         +  +P + T HP  L++    K
Sbjct: 185 VKPKLIVALGR-----FAAQTLLKTDGSIASMRGRVHEYEGVPVIVTYHPAYLLRSLQDK 239

Query: 245 KNTWHAL 251
              W  L
Sbjct: 240 AKAWSDL 246


>gi|17546088|ref|NP_519490.1| DNA polymerase-related protein, bacteriophage-type [Ralstonia
           solanacearum GMI1000]
 gi|17428384|emb|CAD15071.1| putative uracil-dna glycosylase-related protein [Ralstonia
           solanacearum GMI1000]
          Length = 292

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 56/197 (28%), Positives = 92/197 (46%), Gaps = 8/197 (4%)

Query: 61  SPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDS 120
            P+  +A  IA  A    +L++ +     C LC     T+        D M+IG  P + 
Sbjct: 95  DPVAPRAQRIA--AFDWAQLEAAVSGCTACKLCERRTQTVFGVGDRQADWMLIGEAPGEQ 152

Query: 121 DNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIM 179
           ++  G+PF G+ G +LD ML++I + R T + I+ +    PPGNR+    E+ +C P + 
Sbjct: 153 EDRQGEPFVGQAGKLLDSMLRAIGLSRETGVFIANVLKCRPPGNRDPEPDEVAMCDPYLK 212

Query: 180 RQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ 239
           RQI LI P++++ +G      F      +T   +GK          +P + T HP  L++
Sbjct: 213 RQIALIKPRVIVVLGR-----FAAQSLLQTQTPVGKLRGKVHEVDGVPVVVTYHPAYLLR 267

Query: 240 YPLIKKNTWHALITLKK 256
               K   W  L   +K
Sbjct: 268 TLTDKARAWEDLCLARK 284


>gi|254451188|ref|ZP_05064625.1| uracil-DNA glycosylase, C-terminal domain protein [Octadecabacter
           antarcticus 238]
 gi|198265594|gb|EDY89864.1| uracil-DNA glycosylase, C-terminal domain protein [Octadecabacter
           antarcticus 238]
          Length = 264

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 54/184 (29%), Positives = 93/184 (50%), Gaps = 5/184 (2%)

Query: 81  KSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKML 140
           ++ + +F  C L   + + + +    G  +MII   P   D+ +G+ F+G+TG +LDKML
Sbjct: 82  RAAMATFEGCALKPVARNLVFSGGIAGAPVMIIADAPDRDDDRAGEMFAGRTGALLDKML 141

Query: 141 QSIEIMRTQ---IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT 197
            +I + R+    I+ + + PW+PP NR+    EM +  P + R I L +PKIL+ +GN  
Sbjct: 142 AAIGLGRSGDAPIYAAPVLPWNPPQNRDPDAEEMAMMLPFLQRHITLAAPKILILMGNGP 201

Query: 198 KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKA 257
                           G W+++    + +P +    P  L+  P  K+  W  L++LK  
Sbjct: 202 CQALLGRSGMTRLH--GSWADVQIGSASLPAIPMFAPSYLLTTPSAKREAWGDLLSLKAR 259

Query: 258 LKNL 261
           LK+L
Sbjct: 260 LKDL 263


>gi|83721489|ref|YP_442527.1| phage SPO1 DNA polymerase domain-containing protein [Burkholderia
           thailandensis E264]
 gi|257138735|ref|ZP_05586997.1| phage SPO1 DNA polymerase domain-containing protein [Burkholderia
           thailandensis E264]
 gi|83655314|gb|ABC39377.1| phage SPO1 DNA polymerase domain protein [Burkholderia
           thailandensis E264]
          Length = 433

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 51/187 (27%), Positives = 92/187 (49%), Gaps = 8/187 (4%)

Query: 66  QADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISG 125
           +A S+A+      EL++ +     C LC    +T+     E  D M++G  P ++++  G
Sbjct: 237 RAPSVAE--LGWDELRARVADCERCRLCEKRTNTVFGVGDERADWMLVGEAPGENEDKQG 294

Query: 126 KPFSGKTGNMLDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIEL 184
           +PF G+ G +LD ML+++ + R + ++I+ +    PPGNRN    E+  C P + RQ+ L
Sbjct: 295 EPFVGQAGKLLDNMLRALALKRGENVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVAL 354

Query: 185 ISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIK 244
           + PK+++ +G      F      KT  ++         +  +P + T HP  L++    K
Sbjct: 355 VKPKLIVALGR-----FAAQTLLKTDGSIASMRGRVHEYEGVPVIVTYHPAYLLRSLQDK 409

Query: 245 KNTWHAL 251
              W  L
Sbjct: 410 AKAWSDL 416


>gi|332980856|ref|YP_004462297.1| phage SPO1 DNA polymerase-like protein [Mahella australiensis 50-1
           BON]
 gi|332698534|gb|AEE95475.1| phage SPO1 DNA polymerase-related protein [Mahella australiensis
           50-1 BON]
          Length = 189

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 55/184 (29%), Positives = 92/184 (50%), Gaps = 8/184 (4%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQ---DLMIIGYTPSDSDNISGKPFSGKT 132
           +L +LK L+    +C  C  + S       EG     LM +G  P   +++ G+PF G+ 
Sbjct: 2   ALLKLKPLMEEVANCTKCPLAQSRTHTVFGEGNLNARLMFVGEGPGKDEDLQGRPFVGRA 61

Query: 133 GNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLF 192
           G +LD ML++I I R++++I+ +    PP NR  +  E + C P +  Q+ +I PKI++ 
Sbjct: 62  GQLLDNMLEAIGIKRSEVYIANVVKCRPPQNRVPTPSEAKACLPYLRNQVAIIKPKIIVC 121

Query: 193 IGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALI 252
           +G        + D + T Q  G+W      + I    AT HP  +++ P  KK  W   I
Sbjct: 122 LGATAAKNLIDPDFKITQQR-GQWIERKGYYFI----ATFHPAAILRDPSKKKPAWEDFI 176

Query: 253 TLKK 256
            +K+
Sbjct: 177 LIKE 180


>gi|167581451|ref|ZP_02374325.1| phage SPO1 DNA polymerase domain protein [Burkholderia
           thailandensis TXDOH]
          Length = 237

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 51/187 (27%), Positives = 92/187 (49%), Gaps = 8/187 (4%)

Query: 66  QADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISG 125
           +A S+A+      EL++ +     C LC    +T+     E  D M++G  P ++++  G
Sbjct: 41  RAPSVAE--LGWDELRARVADCERCRLCEKRTNTVFGVGDERADWMLVGEAPGENEDKQG 98

Query: 126 KPFSGKTGNMLDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIEL 184
           +PF G+ G +LD ML+++ + R + ++I+ +    PPGNRN    E+  C P + RQ+ L
Sbjct: 99  EPFVGQAGKLLDNMLRALALKRGENVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVAL 158

Query: 185 ISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIK 244
           + PK+++ +G      F      KT  ++         +  +P + T HP  L++    K
Sbjct: 159 VKPKLIVALGR-----FAAQTLLKTDGSIASMRGRVHEYEGVPVIVTYHPAYLLRSLQDK 213

Query: 245 KNTWHAL 251
              W  L
Sbjct: 214 AKAWSDL 220


>gi|134296052|ref|YP_001119787.1| phage SPO1 DNA polymerase--like protein [Burkholderia vietnamiensis
           G4]
 gi|134139209|gb|ABO54952.1| phage SPO1 DNA polymerase-related protein [Burkholderia
           vietnamiensis G4]
          Length = 342

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 80/171 (46%), Gaps = 6/171 (3%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-T 148
           C LC     T+        D M+IG  P ++++  G+PF G+ G +LD MLQS+ + R T
Sbjct: 164 CRLCEKRTQTVFGVGDREADWMLIGEAPGENEDKQGEPFVGQAGKLLDNMLQSLTLARGT 223

Query: 149 QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQK 208
            ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G          DA  
Sbjct: 224 NVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVALVKPKLIVALGRFAAQTLLKTDA-- 281

Query: 209 TYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALK 259
              ++         +  +P + T HP  L++    K   W  L   +   +
Sbjct: 282 ---SIASLRGRVHAYEGVPVIVTYHPAYLLRSLQDKSKAWADLCLARDTFR 329


>gi|134300898|ref|YP_001114394.1| phage SPO1 DNA polymerase-like protein [Desulfotomaculum reducens
           MI-1]
 gi|134053598|gb|ABO51569.1| phage SPO1 DNA polymerase-related protein [Desulfotomaculum
           reducens MI-1]
          Length = 187

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 85/173 (49%), Gaps = 7/173 (4%)

Query: 80  LKSLLRSFHDCHLCSTSLST---ICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L+ L +   +C  C  S      +         LM+IG  P   ++  G PF G+ G +L
Sbjct: 3   LEQLAKDMQNCTRCGLSEGRNKLVFGVGNPKAKLMLIGEGPGKDEDEQGVPFVGRAGQLL 62

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
           D++L +I++ R  ++I+ I    PP NR  + +E + C P + RQIELI P+I++ +GN 
Sbjct: 63  DRILAAIDLTREDVYIANIVKCRPPNNRVPNRVEAKACLPYLYRQIELIQPQIIVLLGNT 122

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWH 249
                   DA+ T    G+W       S I  +AT HP  +++ P  ++  W 
Sbjct: 123 ALQNLIGPDARITKMR-GQW---LESQSGIKIIATYHPAAVLRDPNRRRPVWE 171


>gi|33602783|ref|NP_890343.1| bacteriophage-related DNA polymerase [Bordetella bronchiseptica
           RB50]
 gi|33577225|emb|CAE35782.1| bacteriophage-related DNA polymerase [Bordetella bronchiseptica
           RB50]
          Length = 242

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 54/184 (29%), Positives = 90/184 (48%), Gaps = 5/184 (2%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L +L+ L++    C LC      +     +    M++G  P + ++  G PF G++G +L
Sbjct: 61  LGQLQQLVQDCTACGLCQGRRHAVFGMGAQPARWMVVGEAPGEQEDRQGLPFVGRSGKLL 120

Query: 137 DKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           D MLQS+ + R + + I+ +    PPGNRN    E+  C P + RQI L++P+ +L +G 
Sbjct: 121 DAMLQSVGMSRERDVFIANVIKCRPPGNRNPKPEEIAACSPYLRRQIALLNPERILVLGR 180

Query: 196 KTKNFFFNNDAQKTYQNL-GKWSNLCTPHS-IIPTLATVHPQELIQYPLIKKNTWHALIT 253
                    +A  T  NL G+  +L T     IP + + HP  L++ P  K   W  L+ 
Sbjct: 181 FAAQTLLGTEA--TIGNLRGRVHSLQTDEGRSIPVVVSYHPAYLLRSPAEKARAWQDLLL 238

Query: 254 LKKA 257
             + 
Sbjct: 239 AARG 242


>gi|167816412|ref|ZP_02448092.1| putative phage-related DNA polymerase [Burkholderia pseudomallei
           91]
          Length = 262

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 53/206 (25%), Positives = 98/206 (47%), Gaps = 16/206 (7%)

Query: 55  NIRHIHSPLVQQADSIAQKACSL--------HELKSLLRSFHDCHLCSTSLSTICATQTE 106
           ++  +H P++   D  A+ A +          EL++ +     C LC    +T+     E
Sbjct: 47  DLEPVHEPVLP--DVAARPAATTPSVAELGWDELRARVADCERCRLCEKRTNTVFGVGDE 104

Query: 107 GQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ-IHISMISPWHPPGNRN 165
             D M++G  P ++++  G+PF G+ G +LD ML+++ + R + ++I+ +    PPGNRN
Sbjct: 105 RADWMLVGEAPGENEDKQGEPFVGQAGKLLDNMLRALALKRGENVYIANVIKCRPPGNRN 164

Query: 166 LSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSI 225
               E+  C P + RQ+ L+ PK+++ +G      F      KT  ++         +  
Sbjct: 165 PEPDEVARCEPYLQRQVALVKPKLIVALGR-----FAAQTLLKTDGSIASMRGRVHQYEG 219

Query: 226 IPTLATVHPQELIQYPLIKKNTWHAL 251
           +P + T HP  L++    K   W  L
Sbjct: 220 VPVIVTYHPAYLLRSLQDKAKAWSDL 245


>gi|88810468|ref|ZP_01125725.1| Phage SPO1 DNA polymerase-related protein [Nitrococcus mobilis
           Nb-231]
 gi|88792098|gb|EAR23208.1| Phage SPO1 DNA polymerase-related protein [Nitrococcus mobilis
           Nb-231]
          Length = 265

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 94/185 (50%), Gaps = 11/185 (5%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKM 139
           L+  ++    C L  T +  +         LM+IG  P   ++  G+PF G+ G +LD+M
Sbjct: 79  LRERVQHCERCLLHQTRMQGVFGIGNPQAQLMLIGEAPGAEEDRRGEPFVGRAGKLLDEM 138

Query: 140 LQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKN 199
           L++I + R +++I+ +    PP NR+ +  E+  C P + RQ+ELI+P ++L +G     
Sbjct: 139 LRAIGLSRERVYITNVLKSRPPNNRDPTPDEVAACEPYLRRQLELIAPSLILALGRIAAQ 198

Query: 200 FFFNNDAQKTYQNLGK----WSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
           +       K+ Q+LG+    W +   P +  P   T HP  L++ P  K   W  L  ++
Sbjct: 199 YLL-----KSTQSLGRLRGAWHHY-GPRA-TPLRVTYHPAYLLRSPADKHKAWQDLKQVR 251

Query: 256 KALKN 260
           + L++
Sbjct: 252 QCLRH 256


>gi|254252036|ref|ZP_04945354.1| hypothetical protein BDAG_01247 [Burkholderia dolosa AUO158]
 gi|124894645|gb|EAY68525.1| hypothetical protein BDAG_01247 [Burkholderia dolosa AUO158]
          Length = 348

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 80/172 (46%), Gaps = 6/172 (3%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C LC    +T+        D M+IG  P ++++  G+PF G+ G +LD MLQS+ + R  
Sbjct: 170 CRLCEKRTNTVFGVGDRDADWMLIGEAPGENEDKQGEPFVGQAGKLLDNMLQSLSLRRGD 229

Query: 150 -IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQK 208
            + I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G          DA  
Sbjct: 230 NVFIANVIKCRPPGNRNPEPDEVARCEPYLQRQVALVKPKLIVALGRFAAQTLLKTDA-- 287

Query: 209 TYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
              ++         +  +P + T HP  L++    K   W  L   +   +N
Sbjct: 288 ---SIASLRGRVHAYEGVPVIVTYHPAYLLRSLPDKAKAWADLCLARDTFRN 336


>gi|218960625|ref|YP_001740400.1| Uracil-DNA glycosylase [Candidatus Cloacamonas acidaminovorans]
 gi|167729282|emb|CAO80193.1| Uracil-DNA glycosylase [Candidatus Cloacamonas acidaminovorans]
          Length = 217

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 59/186 (31%), Positives = 88/186 (47%), Gaps = 8/186 (4%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQD---LMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L  L + +  C  C    S       EG      M+IG  P + ++I+G+PF G  G +
Sbjct: 31  KLTELQKQYSTCTKCPLHNSRRKFVYGEGNPNAIAMLIGEGPGEQEDITGRPFVGAAGQL 90

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           L+KML +I + R+ ++I+ I    PPGNRN  + E + C P ++ QI++I PKILL +G 
Sbjct: 91  LEKMLSAINLQRSDVYITNIVKCRPPGNRNPESEERKACLPYLLEQIQIIQPKILLILGL 150

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
                  NN+       LG           IP   T HP  L++    KK  W  L   +
Sbjct: 151 VAAQTLLNNN-----NTLGWHRGKIHYFMDIPAFVTYHPSALLRNQEWKKPAWIDLQEFQ 205

Query: 256 KALKNL 261
           K  + L
Sbjct: 206 KEYEKL 211


>gi|53719792|ref|YP_108778.1| putative phage-related DNA polymerase [Burkholderia pseudomallei
           K96243]
 gi|52210206|emb|CAH36185.1| putative phage-related DNA polymerase [Burkholderia pseudomallei
           K96243]
          Length = 284

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 53/206 (25%), Positives = 98/206 (47%), Gaps = 16/206 (7%)

Query: 55  NIRHIHSPLVQQADSIAQKACSL--------HELKSLLRSFHDCHLCSTSLSTICATQTE 106
           ++  +H P++   D  A+ A +          EL++ +     C LC    +T+     E
Sbjct: 69  DLEPVHEPVLP--DVAARPAATTPSVAELGWDELRARVADCERCRLCEKRTNTVFGVGDE 126

Query: 107 GQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ-IHISMISPWHPPGNRN 165
             D M++G  P ++++  G+PF G+ G +LD ML+++ + R + ++I+ +    PPGNRN
Sbjct: 127 RADWMLVGEAPGENEDKQGEPFVGQAGKLLDNMLRALALKRGENVYIANVIKCRPPGNRN 186

Query: 166 LSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSI 225
               E+  C P + RQ+ L+ PK+++ +G      F      KT  ++         +  
Sbjct: 187 PEPDEVARCEPYLQRQVALVKPKLIVALGR-----FAAQTLLKTDGSIASMRGRVHQYEG 241

Query: 226 IPTLATVHPQELIQYPLIKKNTWHAL 251
           +P + T HP  L++    K   W  L
Sbjct: 242 VPVIVTYHPAYLLRSLQDKAKAWSDL 267


>gi|167720198|ref|ZP_02403434.1| putative phage-related DNA polymerase [Burkholderia pseudomallei
           DM98]
          Length = 237

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 48/174 (27%), Positives = 86/174 (49%), Gaps = 6/174 (3%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           EL++ +     C LC    +T+     E  D M++G  P ++++  G+PF G+ G +LD 
Sbjct: 52  ELRARVADCERCRLCEKRTNTVFGVGDERADWMLVGEAPGENEDKQGEPFVGQAGKLLDN 111

Query: 139 MLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT 197
           ML+++ + R + ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G   
Sbjct: 112 MLRALALKRGENVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVALVKPKLIVALGR-- 169

Query: 198 KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
              F      KT  ++         +  +P + T HP  L++    K   W  L
Sbjct: 170 ---FAAQTLLKTDGSIASMRGRVHQYEGVPVIVTYHPAYLLRSLQDKAKAWSDL 220


>gi|33597880|ref|NP_885523.1| bacteriophage-related DNA polymerase [Bordetella parapertussis
           12822]
 gi|33574309|emb|CAE38642.1| bacteriophage-related DNA polymerase [Bordetella parapertussis]
          Length = 298

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 54/184 (29%), Positives = 90/184 (48%), Gaps = 5/184 (2%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L +L+ L++    C LC      +     +    M++G  P + ++  G PF G++G +L
Sbjct: 117 LGQLQQLVQDCTACGLCQGRRHAVFGMGAQPARWMVVGEAPGEQEDRQGLPFVGRSGKLL 176

Query: 137 DKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           D MLQS+ + R + + I+ +    PPGNRN    E+  C P + RQI L++P+ +L +G 
Sbjct: 177 DAMLQSVGMSRERDVFIANVIKCRPPGNRNPKPEEIAACSPYLRRQIALLNPERILVLGR 236

Query: 196 KTKNFFFNNDAQKTYQNL-GKWSNLCTPHS-IIPTLATVHPQELIQYPLIKKNTWHALIT 253
                    +A  T  NL G+  +L T     IP + + HP  L++ P  K   W  L+ 
Sbjct: 237 FAAQTLLGTEA--TIGNLRGRVHSLQTDEGRSIPVVVSYHPAYLLRSPAEKARAWQDLLL 294

Query: 254 LKKA 257
             + 
Sbjct: 295 AARG 298


>gi|217421553|ref|ZP_03453057.1| uracil-DNA glycosylase, family 4 [Burkholderia pseudomallei 576]
 gi|217395295|gb|EEC35313.1| uracil-DNA glycosylase, family 4 [Burkholderia pseudomallei 576]
          Length = 457

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 85/174 (48%), Gaps = 6/174 (3%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           EL++ +     C LC    +T+     E  D M++G  P ++++  G+PF G+ G +LD 
Sbjct: 272 ELRARVADCERCRLCEKRTNTVFGVGDEHADWMLVGEAPGENEDKQGEPFVGQAGKLLDN 331

Query: 139 MLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT 197
           ML+++ + R + ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G   
Sbjct: 332 MLRALALKRGENVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVALVKPKLIVALGRFA 391

Query: 198 KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
                     KT  ++         +  +P + T HP  L++    K   W  L
Sbjct: 392 AQTLL-----KTDGSIASMRGRVHQYEGVPVIVTYHPAYLLRSLQDKAKAWSDL 440


>gi|254197195|ref|ZP_04903617.1| uracil-DNA glycosylase, family 4 [Burkholderia pseudomallei S13]
 gi|169653936|gb|EDS86629.1| uracil-DNA glycosylase, family 4 [Burkholderia pseudomallei S13]
          Length = 455

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 85/174 (48%), Gaps = 6/174 (3%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           EL++ +     C LC    +T+     E  D M++G  P ++++  G+PF G+ G +LD 
Sbjct: 270 ELRARVADCERCRLCEKRTNTVFGVGDEHADWMLVGEAPGENEDKQGEPFVGQAGKLLDN 329

Query: 139 MLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT 197
           ML+++ + R + ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G   
Sbjct: 330 MLRALALKRGENVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVALVKPKLIVALGRFA 389

Query: 198 KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
                     KT  ++         +  +P + T HP  L++    K   W  L
Sbjct: 390 AQTLL-----KTDGSIASMRGRVHQYEGVPVIVTYHPAYLLRSLQDKAKAWSDL 438


>gi|110597629|ref|ZP_01385914.1| phage SPO1 DNA polymerase-related protein [Chlorobium ferrooxidans
           DSM 13031]
 gi|110340749|gb|EAT59226.1| phage SPO1 DNA polymerase-related protein [Chlorobium ferrooxidans
           DSM 13031]
          Length = 218

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 50/179 (27%), Positives = 85/179 (47%), Gaps = 5/179 (2%)

Query: 71  AQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSG 130
           A  A  L EL+    +   C L  T  + +    +   ++++IG  P   ++ SG+PF G
Sbjct: 21  ASAAEQLAELQKAAMACRKCRLAETRRNVVVGEGSPLAEIVVIGEAPGAEEDASGRPFVG 80

Query: 131 KTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKIL 190
           ++G +L K+LQ++   R +++I  I    PPGNRN    E+  CRP + +Q++++ PKI+
Sbjct: 81  RSGQLLTKILQAVHFEREKVYICNILKCRPPGNRNPLEDEIGFCRPWLQQQLQILKPKII 140

Query: 191 LFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWH 249
           L +G    N    N       ++G                T HP  L++ P  K+  W 
Sbjct: 141 LILGKVAANTILENKL-----SMGMMRGKLIEWKGFDCFVTYHPAALLRNPNWKRACWE 194


>gi|83748580|ref|ZP_00945600.1| Uracil DNA glycosylase superfamily protein [Ralstonia solanacearum
           UW551]
 gi|83724788|gb|EAP71946.1| Uracil DNA glycosylase superfamily protein [Ralstonia solanacearum
           UW551]
          Length = 277

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 54/197 (27%), Positives = 93/197 (47%), Gaps = 8/197 (4%)

Query: 61  SPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDS 120
           +P + +A  IA  A    +L++ +     C LC     T+        D M+IG  P + 
Sbjct: 80  APELPRAQRIA--AFDWAQLEAAVSGCTACKLCERRTQTVFGVGDRQADWMLIGEAPGEQ 137

Query: 121 DNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIM 179
           ++  G+PF G+ G +LD ML+++ + R T + I+ +    PPGNR+    E+ +C P + 
Sbjct: 138 EDRQGEPFVGQAGKLLDSMLRAVGLSRETGVFIANVLKCRPPGNRDPEPDEVAMCDPYLK 197

Query: 180 RQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ 239
           RQI L+ P++++ +G      F      +T   +GK          +P + T HP  L++
Sbjct: 198 RQIALVKPRVIIVLGR-----FAAQSLLQTQTPVGKLRGRVHEVDGVPVVVTYHPAYLLR 252

Query: 240 YPLIKKNTWHALITLKK 256
               K   W  L   +K
Sbjct: 253 TLTDKARAWEDLCLARK 269


>gi|167739201|ref|ZP_02411975.1| putative phage-related DNA polymerase [Burkholderia pseudomallei
           14]
          Length = 259

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 48/174 (27%), Positives = 86/174 (49%), Gaps = 6/174 (3%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           EL++ +     C LC    +T+     E  D M++G  P ++++  G+PF G+ G +LD 
Sbjct: 74  ELRARVADCERCRLCEKRTNTVFGVGDEHADWMLVGEAPGENEDKQGEPFVGQAGKLLDN 133

Query: 139 MLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT 197
           ML+++ + R + ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G   
Sbjct: 134 MLRALALKRGENVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVALVKPKLIVALGR-- 191

Query: 198 KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
              F      KT  ++         +  +P + T HP  L++    K   W  L
Sbjct: 192 ---FAAQTLLKTDGSIASMRGRVHQYEGVPVIVTYHPAYLLRSLQDKAKAWSDL 242


>gi|167590014|ref|ZP_02382402.1| phage SPO1 DNA polymerase-related protein [Burkholderia ubonensis
           Bu]
          Length = 307

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 46/172 (26%), Positives = 80/172 (46%), Gaps = 6/172 (3%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-T 148
           C LC    +T+        D M++G  P ++++  G+PF G+ G +LD MLQS+ + R  
Sbjct: 114 CRLCEKRTNTVFGVGDREADWMLVGEAPGENEDKQGEPFVGQAGKLLDNMLQSLSLERGA 173

Query: 149 QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQK 208
            ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G          DA  
Sbjct: 174 NVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVALVKPKLIVALGRFAAQTLLKTDA-- 231

Query: 209 TYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
              ++         +  +P + T HP  L++    K   W  L   +   + 
Sbjct: 232 ---SIASLRGRVHAYEGVPVIVTYHPAYLLRSLQDKSKAWADLCLARDTFRG 280


>gi|126438636|ref|YP_001059495.1| uracil-DNA glycosylase [Burkholderia pseudomallei 668]
 gi|126218129|gb|ABN81635.1| uracil-DNA glycosylase, family 4 [Burkholderia pseudomallei 668]
          Length = 455

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 85/174 (48%), Gaps = 6/174 (3%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           EL++ +     C LC    +T+     E  D M++G  P ++++  G+PF G+ G +LD 
Sbjct: 270 ELRARVADCARCRLCEKRTNTVFGVGDEHADWMLVGEAPGENEDKQGEPFVGQAGKLLDN 329

Query: 139 MLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT 197
           ML+++ + R + ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G   
Sbjct: 330 MLRALALKRGENVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVALVKPKLIVALGRFA 389

Query: 198 KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
                     KT  ++         +  +P + T HP  L++    K   W  L
Sbjct: 390 AQTLL-----KTDGSIASMRGRVHQYEGVPVIVTYHPAYLLRSLQDKAKAWSDL 438


>gi|226198966|ref|ZP_03794529.1| uracil-DNA glycosylase, family 4 [Burkholderia pseudomallei
           Pakistan 9]
 gi|225929066|gb|EEH25090.1| uracil-DNA glycosylase, family 4 [Burkholderia pseudomallei
           Pakistan 9]
          Length = 457

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 85/174 (48%), Gaps = 6/174 (3%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           EL++ +     C LC    +T+     E  D M++G  P ++++  G+PF G+ G +LD 
Sbjct: 272 ELRARVADCARCRLCEKRTNTVFGVGDEHADWMLVGEAPGENEDKQGEPFVGQAGKLLDN 331

Query: 139 MLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT 197
           ML+++ + R + ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G   
Sbjct: 332 MLRALALKRGENVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVALVKPKLIVALGRFA 391

Query: 198 KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
                     KT  ++         +  +P + T HP  L++    K   W  L
Sbjct: 392 AQTLL-----KTDGSIASMRGRVHQYEGVPVIVTYHPAYLLRSLQDKAKAWSDL 440


>gi|315186692|gb|EFU20451.1| phage SPO1 DNA polymerase-related protein [Spirochaeta thermophila
           DSM 6578]
          Length = 253

 Score = 95.9 bits (237), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 52/195 (26%), Positives = 92/195 (47%), Gaps = 9/195 (4%)

Query: 67  ADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGK 126
            D  A+   +LHE    +R+ + C L  T    +  T   G  +M++G  P   +++ G+
Sbjct: 57  GDDPARTLGALHEQ---VRACNRCDLARTRRQAVPGTGRVGLPVMVVGEAPGADEDVKGE 113

Query: 127 PFSGKTGNMLDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELI 185
           PF G+ G  LDK L +I + R + + I+ +    PPGNR+    E+  C P +  QI L+
Sbjct: 114 PFVGRAGQYLDKWLAAIGLQRGRDVFITNVVKCRPPGNRDPRPDEISACLPFLEAQIALV 173

Query: 186 SPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKK 245
            P+ +L +G      F  +    T + + +       +  IP + T HP  +++ P +++
Sbjct: 174 RPRAILTVGR-----FAASTLLGTQEGISRLRGRVYRYRDIPLVPTYHPSAVLRDPSLRR 228

Query: 246 NTWHALITLKKALKN 260
             W  L  L   L+ 
Sbjct: 229 PVWEDLKLLSSVLRG 243


>gi|207723323|ref|YP_002253722.1| uracil-dna glycosylase-related protein [Ralstonia solanacearum
           MolK2]
 gi|206588521|emb|CAQ35484.1| uracil-dna glycosylase-related protein [Ralstonia solanacearum
           MolK2]
          Length = 280

 Score = 95.9 bits (237), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 54/197 (27%), Positives = 93/197 (47%), Gaps = 8/197 (4%)

Query: 61  SPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDS 120
           +P + +A  IA  A    +L++ +     C LC     T+        D M+IG  P + 
Sbjct: 83  APELPRAQRIA--AFDWAQLEAAVSGCTACKLCERRTQTVFGVGDRQADWMLIGEAPGEQ 140

Query: 121 DNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIM 179
           ++  G+PF G+ G +LD ML+++ + R T + I+ +    PPGNR+    E+ +C P + 
Sbjct: 141 EDRQGEPFVGQAGKLLDSMLRAVGLSRETGVFIANVLKCRPPGNRDPEPDEVTMCDPYLK 200

Query: 180 RQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ 239
           RQI L+ P++++ +G      F      +T   +GK          +P + T HP  L++
Sbjct: 201 RQIALVKPRVIIVLGR-----FAAQSLLQTQTPVGKLRGRVHEVDGVPVVVTYHPAYLLR 255

Query: 240 YPLIKKNTWHALITLKK 256
               K   W  L   +K
Sbjct: 256 TLTDKARAWEDLCLARK 272


>gi|167903291|ref|ZP_02490496.1| phage SPO1 DNA polymerase domain protein [Burkholderia pseudomallei
           NCTC 13177]
          Length = 311

 Score = 95.9 bits (237), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 53/206 (25%), Positives = 98/206 (47%), Gaps = 16/206 (7%)

Query: 55  NIRHIHSPLVQQADSIAQKACSL--------HELKSLLRSFHDCHLCSTSLSTICATQTE 106
           ++  +H P++   D  A+ A +          EL++ +     C LC    +T+     E
Sbjct: 96  DLEPVHEPVLP--DVAARPAATTPSVAELGWDELRARVADCARCRLCEKRTNTVFGVGDE 153

Query: 107 GQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ-IHISMISPWHPPGNRN 165
             D M++G  P ++++  G+PF G+ G +LD ML+++ + R + ++I+ +    PPGNRN
Sbjct: 154 RADWMLVGEAPGENEDKQGEPFVGQAGKLLDNMLRALALKRGENVYIANVIKCRPPGNRN 213

Query: 166 LSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSI 225
               E+  C P + RQ+ L+ PK+++ +G      F      KT  ++         +  
Sbjct: 214 PEPDEVARCEPYLQRQVALVKPKLIVALGR-----FAAQTLLKTDGSIASMRGRVHQYEG 268

Query: 226 IPTLATVHPQELIQYPLIKKNTWHAL 251
           +P + T HP  L++    K   W  L
Sbjct: 269 VPVIVTYHPAYLLRSLQDKAKAWSDL 294


>gi|167824793|ref|ZP_02456264.1| phage SPO1 DNA polymerase domain protein [Burkholderia pseudomallei
           9]
          Length = 256

 Score = 95.9 bits (237), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 48/174 (27%), Positives = 86/174 (49%), Gaps = 6/174 (3%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           EL++ +     C LC    +T+     E  D M++G  P ++++  G+PF G+ G +LD 
Sbjct: 71  ELRARVADCARCRLCEKRTNTVFGVGDEHADWMLVGEAPGENEDKQGEPFVGQAGKLLDN 130

Query: 139 MLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT 197
           ML+++ + R + ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G   
Sbjct: 131 MLRALALKRGENVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVALVKPKLIVALGR-- 188

Query: 198 KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
              F      KT  ++         +  +P + T HP  L++    K   W  L
Sbjct: 189 ---FAAQTLLKTDGSIASMRGRVHQYEGVPVIVTYHPAYLLRSLQDKAKAWSDL 239


>gi|134277251|ref|ZP_01763966.1| uracil-DNA glycosylase, family 4 [Burkholderia pseudomallei 305]
 gi|134250901|gb|EBA50980.1| uracil-DNA glycosylase, family 4 [Burkholderia pseudomallei 305]
          Length = 453

 Score = 95.9 bits (237), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 85/174 (48%), Gaps = 6/174 (3%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           EL++ +     C LC    +T+     E  D M++G  P ++++  G+PF G+ G +LD 
Sbjct: 268 ELRARVADCARCRLCEKRTNTVFGVGDEHADWMLVGEAPGENEDKQGEPFVGQAGKLLDN 327

Query: 139 MLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT 197
           ML+++ + R + ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G   
Sbjct: 328 MLRALALKRGENVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVALVKPKLIVALGRFA 387

Query: 198 KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
                     KT  ++         +  +P + T HP  L++    K   W  L
Sbjct: 388 AQTLL-----KTDGSIASMRGRVHQYEGVPVIVTYHPAYLLRSLQDKAKAWSDL 436


>gi|126454213|ref|YP_001066778.1| uracil-DNA glycosylase [Burkholderia pseudomallei 1106a]
 gi|242316127|ref|ZP_04815143.1| uracil-DNA glycosylase, family 4 [Burkholderia pseudomallei 1106b]
 gi|126227855|gb|ABN91395.1| uracil-DNA glycosylase, family 4 [Burkholderia pseudomallei 1106a]
 gi|242139366|gb|EES25768.1| uracil-DNA glycosylase, family 4 [Burkholderia pseudomallei 1106b]
          Length = 455

 Score = 95.9 bits (237), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 85/174 (48%), Gaps = 6/174 (3%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           EL++ +     C LC    +T+     E  D M++G  P ++++  G+PF G+ G +LD 
Sbjct: 270 ELRARVADCARCRLCEKRTNTVFGVGDEHADWMLVGEAPGENEDKQGEPFVGQAGKLLDN 329

Query: 139 MLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT 197
           ML+++ + R + ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G   
Sbjct: 330 MLRALALKRGENVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVALVKPKLIVALGRFA 389

Query: 198 KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
                     KT  ++         +  +P + T HP  L++    K   W  L
Sbjct: 390 AQTLL-----KTDGSIASMRGRVHQYEGVPVIVTYHPAYLLRSLQDKAKAWSDL 438


>gi|237812834|ref|YP_002897285.1| uracil-DNA glycosylase, family 4 [Burkholderia pseudomallei
           MSHR346]
 gi|237502848|gb|ACQ95166.1| uracil-DNA glycosylase, family 4 [Burkholderia pseudomallei
           MSHR346]
          Length = 468

 Score = 95.9 bits (237), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 85/174 (48%), Gaps = 6/174 (3%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           EL++ +     C LC    +T+     E  D M++G  P ++++  G+PF G+ G +LD 
Sbjct: 283 ELRARVADCARCRLCEKRTNTVFGVGDEHADWMLVGEAPGENEDKQGEPFVGQAGKLLDN 342

Query: 139 MLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT 197
           ML+++ + R + ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G   
Sbjct: 343 MLRALALKRGENVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVALVKPKLIVALGRFA 402

Query: 198 KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
                     KT  ++         +  +P + T HP  L++    K   W  L
Sbjct: 403 AQTLL-----KTDGSIASMRGRVHQYEGVPVIVTYHPAYLLRSLQDKAKAWSDL 451


>gi|194289838|ref|YP_002005745.1| uracil-DNA glycosylase,phage-related protein [Cupriavidus
           taiwanensis LMG 19424]
 gi|193223673|emb|CAQ69680.1| putative uracil-DNA glycosylase,phage-related protein [Cupriavidus
           taiwanensis LMG 19424]
          Length = 289

 Score = 95.9 bits (237), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 86/178 (48%), Gaps = 6/178 (3%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKM 139
           L + +     C LC T  +T+        + M++G  P +++++ G+PF G+ G +LD M
Sbjct: 108 LDAAVAGCTACGLCRTRTNTVFGVGARQAEWMLVGEAPGENEDLQGEPFVGQAGKLLDNM 167

Query: 140 LQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTK 198
           L ++ + R + + I+ +    PPGNRN    E+  C P + RQI L+ P++++ +G    
Sbjct: 168 LGALGLARGRNVFIANVLKCRPPGNRNPEPEEVAQCEPFLRRQIALVRPRVIVVLGR--- 224

Query: 199 NFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
             F      +T   +GK       +  IP + T HP  L++    K   W  L   ++
Sbjct: 225 --FAAQSLLRTTTPIGKLRGTVHVYEGIPVVVTYHPAYLLRTLTDKARAWEDLCLARE 280


>gi|254179296|ref|ZP_04885895.1| uracil-DNA glycosylase, family 4 [Burkholderia pseudomallei 1655]
 gi|184209836|gb|EDU06879.1| uracil-DNA glycosylase, family 4 [Burkholderia pseudomallei 1655]
          Length = 463

 Score = 95.9 bits (237), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 85/174 (48%), Gaps = 6/174 (3%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           EL++ +     C LC    +T+     E  D M++G  P ++++  G+PF G+ G +LD 
Sbjct: 278 ELRARVADCARCRLCEKRTNTVFGVGDEHADWMLVGEAPGENEDKQGEPFVGQAGKLLDN 337

Query: 139 MLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT 197
           ML+++ + R + ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G   
Sbjct: 338 MLRALALKRGENVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVALVKPKLIVALGRFA 397

Query: 198 KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
                     KT  ++         +  +P + T HP  L++    K   W  L
Sbjct: 398 AQTLL-----KTDGSIASMRGRVHQYEGVPVIVTYHPAYLLRSLQDKAKAWSDL 446


>gi|67639488|ref|ZP_00438341.1| uracil-DNA glycosylase, family 4 [Burkholderia mallei GB8 horse 4]
 gi|238520036|gb|EEP83500.1| uracil-DNA glycosylase, family 4 [Burkholderia mallei GB8 horse 4]
          Length = 252

 Score = 95.9 bits (237), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 48/174 (27%), Positives = 86/174 (49%), Gaps = 6/174 (3%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           EL++ +     C LC    +T+     E  D M++G  P ++++  G+PF G+ G +LD 
Sbjct: 67  ELRARVADCARCRLCEKRTNTVFGVGDEHADWMLVGEAPGENEDKQGEPFVGQAGKLLDN 126

Query: 139 MLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT 197
           ML+++ + R + ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G   
Sbjct: 127 MLRALALKRGENVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVALVKPKLIVALGR-- 184

Query: 198 KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
              F      KT  ++         +  +P + T HP  L++    K   W  L
Sbjct: 185 ---FAAQTLLKTDGSIASMRGRVHQYEGVPVIVTYHPAYLLRSLQDKAKAWSDL 235


>gi|317052571|ref|YP_004113687.1| phage SPO1 DNA polymerase-like protein [Desulfurispirillum indicum
           S5]
 gi|316947655|gb|ADU67131.1| phage SPO1 DNA polymerase-related protein [Desulfurispirillum
           indicum S5]
          Length = 279

 Score = 95.9 bits (237), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 50/181 (27%), Positives = 88/181 (48%), Gaps = 3/181 (1%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQ-DLMIIGYTPSDSDNISGKPFSGKTGN 134
           S   L+  L+    C L      TI   +   Q D+M+IG  P   ++  G+PF GK+G 
Sbjct: 75  SWQRLEEDLKDCQACALARQGRKTIVMGEGNRQADIMLIGEGPGFDEDRLGRPFVGKSGQ 134

Query: 135 MLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
            LD+++ ++   R +++I+ +    PPGNRN    E+ IC+  + RQI L++P+ +L +G
Sbjct: 135 KLDQIMLAVGFQREELYIANVVKCRPPGNRNPEPGEISICQQFLQRQIRLVNPRFILALG 194

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITL 254
               NF +        + LG        +  I  + T HP  L++   +++  W  +  L
Sbjct: 195 KFAANFLYGESGAP--RTLGSMREKILHYGDIQVVVTYHPSALLRNENLRRPVWDDVRVL 252

Query: 255 K 255
           +
Sbjct: 253 R 253


>gi|254189318|ref|ZP_04895829.1| uracil-DNA glycosylase, family 4 [Burkholderia pseudomallei Pasteur
           52237]
 gi|157936997|gb|EDO92667.1| uracil-DNA glycosylase, family 4 [Burkholderia pseudomallei Pasteur
           52237]
          Length = 476

 Score = 95.9 bits (237), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 85/174 (48%), Gaps = 6/174 (3%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           EL++ +     C LC    +T+     E  D M++G  P ++++  G+PF G+ G +LD 
Sbjct: 291 ELRARVADCARCRLCEKRTNTVFGVGDEHADWMLVGEAPGENEDKQGEPFVGQAGKLLDN 350

Query: 139 MLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT 197
           ML+++ + R + ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G   
Sbjct: 351 MLRALALKRGENVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVALVKPKLIVALGRFA 410

Query: 198 KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
                     KT  ++         +  +P + T HP  L++    K   W  L
Sbjct: 411 AQTLL-----KTDGSIASMRGRVHQYEGVPVIVTYHPAYLLRSLQDKAKAWSDL 459


>gi|254297183|ref|ZP_04964636.1| uracil-DNA glycosylase, family 4 [Burkholderia pseudomallei 406e]
 gi|157807234|gb|EDO84404.1| uracil-DNA glycosylase, family 4 [Burkholderia pseudomallei 406e]
          Length = 464

 Score = 95.9 bits (237), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 85/174 (48%), Gaps = 6/174 (3%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           EL++ +     C LC    +T+     E  D M++G  P ++++  G+PF G+ G +LD 
Sbjct: 279 ELRARVADCARCRLCEKRTNTVFGVGDEHADWMLVGEAPGENEDKQGEPFVGQAGKLLDN 338

Query: 139 MLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT 197
           ML+++ + R + ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G   
Sbjct: 339 MLRALALKRGENVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVALVKPKLIVALGRFA 398

Query: 198 KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
                     KT  ++         +  +P + T HP  L++    K   W  L
Sbjct: 399 AQTLL-----KTDGSIASMRGRVHQYEGVPVIVTYHPAYLLRSLQDKAKAWSDL 447


>gi|76811418|ref|YP_334000.1| phage SPO1 DNA polymerase domain-containing protein [Burkholderia
           pseudomallei 1710b]
 gi|254261802|ref|ZP_04952856.1| uracil-DNA glycosylase, family 4 [Burkholderia pseudomallei 1710a]
 gi|76580871|gb|ABA50346.1| phage SPO1 DNA polymerase domain protein [Burkholderia pseudomallei
           1710b]
 gi|254220491|gb|EET09875.1| uracil-DNA glycosylase, family 4 [Burkholderia pseudomallei 1710a]
          Length = 468

 Score = 95.9 bits (237), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 85/174 (48%), Gaps = 6/174 (3%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           EL++ +     C LC    +T+     E  D M++G  P ++++  G+PF G+ G +LD 
Sbjct: 283 ELRARVADCARCRLCEKRTNTVFGVGDEHADWMLVGEAPGENEDKQGEPFVGQAGKLLDN 342

Query: 139 MLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT 197
           ML+++ + R + ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G   
Sbjct: 343 MLRALALKRGENVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVALVKPKLIVALGRFA 402

Query: 198 KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
                     KT  ++         +  +P + T HP  L++    K   W  L
Sbjct: 403 AQTLL-----KTDGSIASMRGRVHQYEGVPVIVTYHPAYLLRSLQDKAKAWSDL 451


>gi|53723916|ref|YP_103220.1| phage SPO1 DNA polymerase domain-containing protein [Burkholderia
           mallei ATCC 23344]
 gi|52427339|gb|AAU47932.1| phage SPO1 DNA polymerase domain protein [Burkholderia mallei ATCC
           23344]
          Length = 220

 Score = 95.9 bits (237), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 48/174 (27%), Positives = 86/174 (49%), Gaps = 6/174 (3%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           EL++ +     C LC    +T+     E  D M++G  P ++++  G+PF G+ G +LD 
Sbjct: 35  ELRARVADCARCRLCEKRTNTVFGVGDEHADWMLVGEAPGENEDKQGEPFVGQAGKLLDN 94

Query: 139 MLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT 197
           ML+++ + R + ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G   
Sbjct: 95  MLRALALKRGENVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVALVKPKLIVALGR-- 152

Query: 198 KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
              F      KT  ++         +  +P + T HP  L++    K   W  L
Sbjct: 153 ---FAAQTLLKTDGSIASMRGRVHQYEGVPVIVTYHPAYLLRSLQDKAKAWSDL 203


>gi|107028777|ref|YP_625872.1| phage SPO1 DNA polymerase-related protein [Burkholderia cenocepacia
           AU 1054]
 gi|116690064|ref|YP_835687.1| phage SPO1 DNA polymerase-related protein [Burkholderia cenocepacia
           HI2424]
 gi|105897941|gb|ABF80899.1| phage SPO1 DNA polymerase-related protein [Burkholderia cenocepacia
           AU 1054]
 gi|116648153|gb|ABK08794.1| phage SPO1 DNA polymerase-related protein [Burkholderia cenocepacia
           HI2424]
          Length = 346

 Score = 95.5 bits (236), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 80/172 (46%), Gaps = 6/172 (3%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C LC    +T+        D M+IG  P ++++  G+PF G+ G +LD MLQS+ + R  
Sbjct: 168 CRLCEKRTNTVFGVGDREADWMLIGEAPGENEDKQGEPFVGQAGKLLDNMLQSLALKRGD 227

Query: 150 -IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQK 208
            ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G          DA  
Sbjct: 228 NVYIANVIKCRPPGNRNPEPDEVASCEPYLQRQVALVKPKLIVALGRFAAQTLLKTDA-- 285

Query: 209 TYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
              ++         +  +P + T HP  L++    K   W  L   +   K 
Sbjct: 286 ---SIASLRGRVHAYEGVPVIVTYHPAYLLRSLQDKSKAWADLCLARDTFKR 334


>gi|166999677|ref|ZP_02265512.1| uracil-DNA glycosylase, family 4 [Burkholderia mallei PRL-20]
 gi|243064327|gb|EES46513.1| uracil-DNA glycosylase, family 4 [Burkholderia mallei PRL-20]
          Length = 461

 Score = 95.5 bits (236), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 85/174 (48%), Gaps = 6/174 (3%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           EL++ +     C LC    +T+     E  D M++G  P ++++  G+PF G+ G +LD 
Sbjct: 276 ELRARVADCARCRLCEKRTNTVFGVGDEHADWMLVGEAPGENEDKQGEPFVGQAGKLLDN 335

Query: 139 MLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT 197
           ML+++ + R + ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G   
Sbjct: 336 MLRALALKRGENVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVALVKPKLIVALGRFA 395

Query: 198 KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
                     KT  ++         +  +P + T HP  L++    K   W  L
Sbjct: 396 AQTLL-----KTDGSIASMRGRVHQYEGVPVIVTYHPAYLLRSLQDKAKAWSDL 444


>gi|254178558|ref|ZP_04885213.1| uracil-DNA glycosylase, family 4 [Burkholderia mallei ATCC 10399]
 gi|160699597|gb|EDP89567.1| uracil-DNA glycosylase, family 4 [Burkholderia mallei ATCC 10399]
          Length = 452

 Score = 95.5 bits (236), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 85/174 (48%), Gaps = 6/174 (3%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           EL++ +     C LC    +T+     E  D M++G  P ++++  G+PF G+ G +LD 
Sbjct: 267 ELRARVADCARCRLCEKRTNTVFGVGDEHADWMLVGEAPGENEDKQGEPFVGQAGKLLDN 326

Query: 139 MLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT 197
           ML+++ + R + ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G   
Sbjct: 327 MLRALALKRGENVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVALVKPKLIVALGRFA 386

Query: 198 KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
                     KT  ++         +  +P + T HP  L++    K   W  L
Sbjct: 387 AQTLL-----KTDGSIASMRGRVHQYEGVPVIVTYHPAYLLRSLQDKAKAWSDL 435


>gi|254358080|ref|ZP_04974353.1| uracil-DNA glycosylase, family 4 [Burkholderia mallei 2002721280]
 gi|148027207|gb|EDK85228.1| uracil-DNA glycosylase, family 4 [Burkholderia mallei 2002721280]
          Length = 458

 Score = 95.5 bits (236), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 85/174 (48%), Gaps = 6/174 (3%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           EL++ +     C LC    +T+     E  D M++G  P ++++  G+PF G+ G +LD 
Sbjct: 273 ELRARVADCARCRLCEKRTNTVFGVGDEHADWMLVGEAPGENEDKQGEPFVGQAGKLLDN 332

Query: 139 MLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT 197
           ML+++ + R + ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G   
Sbjct: 333 MLRALALKRGENVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVALVKPKLIVALGRFA 392

Query: 198 KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
                     KT  ++         +  +P + T HP  L++    K   W  L
Sbjct: 393 AQTLL-----KTDGSIASMRGRVHQYEGVPVIVTYHPAYLLRSLQDKAKAWSDL 441


>gi|121599419|ref|YP_993398.1| phage SPO1 DNA polymerase domain-containing protein [Burkholderia
           mallei SAVP1]
 gi|124385331|ref|YP_001029166.1| phage SPO1 DNA polymerase domain-containing protein [Burkholderia
           mallei NCTC 10229]
 gi|126451029|ref|YP_001080906.1| uracil-DNA glycosylase [Burkholderia mallei NCTC 10247]
 gi|121228229|gb|ABM50747.1| phage SPO1 DNA polymerase domain protein [Burkholderia mallei
           SAVP1]
 gi|124293351|gb|ABN02620.1| phage SPO1 DNA polymerase domain protein [Burkholderia mallei NCTC
           10229]
 gi|126243899|gb|ABO06992.1| uracil-DNA glycosylase, family 4 [Burkholderia mallei NCTC 10247]
          Length = 455

 Score = 95.5 bits (236), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 85/174 (48%), Gaps = 6/174 (3%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           EL++ +     C LC    +T+     E  D M++G  P ++++  G+PF G+ G +LD 
Sbjct: 270 ELRARVADCARCRLCEKRTNTVFGVGDEHADWMLVGEAPGENEDKQGEPFVGQAGKLLDN 329

Query: 139 MLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT 197
           ML+++ + R + ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G   
Sbjct: 330 MLRALALKRGENVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVALVKPKLIVALGRFA 389

Query: 198 KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
                     KT  ++         +  +P + T HP  L++    K   W  L
Sbjct: 390 AQTLL-----KTDGSIASMRGRVHQYEGVPVIVTYHPAYLLRSLQDKAKAWSDL 438


>gi|167894904|ref|ZP_02482306.1| phage SPO1 DNA polymerase domain protein [Burkholderia pseudomallei
           7894]
          Length = 254

 Score = 95.5 bits (236), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 48/174 (27%), Positives = 86/174 (49%), Gaps = 6/174 (3%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           EL++ +     C LC    +T+     E  D M++G  P ++++  G+PF G+ G +LD 
Sbjct: 69  ELRARVADCARCRLCEKRTNTVFGVGDEHADWMLVGEAPGENEDKQGEPFVGQAGKLLDN 128

Query: 139 MLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT 197
           ML+++ + R + ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G   
Sbjct: 129 MLRALALKRGENVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVALVKPKLIVALGR-- 186

Query: 198 KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
              F      KT  ++         +  +P + T HP  L++    K   W  L
Sbjct: 187 ---FAAQTLLKTDGSIASMRGRVHQYEGVPVIVTYHPAYLLRSLQDKAKAWSDL 237


>gi|187477567|ref|YP_785591.1| uracil-DNA glycosylase [Bordetella avium 197N]
 gi|115422153|emb|CAJ48677.1| uracil-DNA glycosylase [Bordetella avium 197N]
          Length = 206

 Score = 95.5 bits (236), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 57/197 (28%), Positives = 91/197 (46%), Gaps = 4/197 (2%)

Query: 58  HIHSPLVQQADSIAQKA-CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYT 116
            + +PL   AD+  + A   L  L+  + +   C LC      +     +    M++G  
Sbjct: 4   ELAAPLGAGADTARRVADFDLARLQQEVLACTACGLCQGRKHAVFGDGAQAARWMVVGEA 63

Query: 117 PSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICR 175
           P + ++  G PF G++G +LD ML S+ + R Q + I+ +    PPGNRN    E+  C 
Sbjct: 64  PGEQEDRRGLPFVGRSGQLLDAMLASVGMSREQDVFIANVIKCRPPGNRNPKPEEIAACS 123

Query: 176 PIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSI-IPTLATVHP 234
           P +MRQI L+ P+ +L +G          DA  +    G+   L T     IP + + HP
Sbjct: 124 PYLMRQIALLRPERILVLGRFAAQTLLGTDAAISSLR-GRQHVLKTEAGREIPVVVSYHP 182

Query: 235 QELIQYPLIKKNTWHAL 251
             L++ P  K   W  L
Sbjct: 183 AYLLRSPAEKARAWQDL 199


>gi|254247860|ref|ZP_04941181.1| Uracil-DNA glycosylase [Burkholderia cenocepacia PC184]
 gi|124872636|gb|EAY64352.1| Uracil-DNA glycosylase [Burkholderia cenocepacia PC184]
          Length = 343

 Score = 95.5 bits (236), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 80/172 (46%), Gaps = 6/172 (3%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C LC    +T+        D M+IG  P ++++  G+PF G+ G +LD MLQS+ + R  
Sbjct: 165 CRLCEKRTNTVFGVGDREADWMLIGEAPGENEDKQGEPFVGQAGKLLDNMLQSLALKRGD 224

Query: 150 -IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQK 208
            ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G          DA  
Sbjct: 225 NVYIANVIKCRPPGNRNPEPDEVASCEPYLQRQVALVKPKLIVALGRFAAQTLLKTDA-- 282

Query: 209 TYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
              ++         +  +P + T HP  L++    K   W  L   +   K 
Sbjct: 283 ---SIASLRGRVHAYEGVPVIVTYHPAYLLRSLQDKSKAWADLCLARDTFKR 331


>gi|167911532|ref|ZP_02498623.1| phage SPO1 DNA polymerase domain protein [Burkholderia pseudomallei
           112]
          Length = 261

 Score = 95.5 bits (236), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 48/174 (27%), Positives = 86/174 (49%), Gaps = 6/174 (3%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           EL++ +     C LC    +T+     E  D M++G  P ++++  G+PF G+ G +LD 
Sbjct: 76  ELRARVADCARCRLCEKRTNTVFGVGDEHADWMLVGEAPGENEDKQGEPFVGQAGKLLDN 135

Query: 139 MLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT 197
           ML+++ + R + ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G   
Sbjct: 136 MLRALALKRGENVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVALVKPKLIVALGR-- 193

Query: 198 KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
              F      KT  ++         +  +P + T HP  L++    K   W  L
Sbjct: 194 ---FAAQTLLKTDGSIASMRGRVHQYEGVPVIVTYHPAYLLRSLQDKAKAWSDL 244


>gi|207743281|ref|YP_002259673.1| uracil-dna glycosylase-related protein [Ralstonia solanacearum
           IPO1609]
 gi|206594678|emb|CAQ61605.1| uracil-dna glycosylase-related protein [Ralstonia solanacearum
           IPO1609]
          Length = 277

 Score = 95.5 bits (236), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 54/197 (27%), Positives = 93/197 (47%), Gaps = 8/197 (4%)

Query: 61  SPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDS 120
           +P + +A  IA  A    +L++ +     C LC     T+        D M+IG  P + 
Sbjct: 80  APELPRAQRIA--AFDWAQLEAAVSGCTACKLCERRTQTVFGVGDRQADWMLIGEAPGEQ 137

Query: 121 DNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIM 179
           ++  G+PF G+ G +LD ML+++ + R T + I+ +    PPGNR+    E+ +C P + 
Sbjct: 138 EDRQGEPFVGQAGKLLDSMLRAVGLSRETGVFIANVLKCRPPGNRDPEPDEVAMCDPYLK 197

Query: 180 RQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ 239
           RQI L+ P++++ +G      F      +T   +GK          +P + T HP  L++
Sbjct: 198 RQIALVKPRVIIVLGR-----FPAQSLLQTQTPVGKLRGRVHEVDGVPVVVTYHPAYLLR 252

Query: 240 YPLIKKNTWHALITLKK 256
               K   W  L   +K
Sbjct: 253 TLTDKARAWEDLCLARK 269


>gi|167919542|ref|ZP_02506633.1| phage SPO1 DNA polymerase domain protein [Burkholderia pseudomallei
           BCC215]
          Length = 265

 Score = 95.5 bits (236), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 48/174 (27%), Positives = 86/174 (49%), Gaps = 6/174 (3%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           EL++ +     C LC    +T+     E  D M++G  P ++++  G+PF G+ G +LD 
Sbjct: 80  ELRARVADCARCRLCEKRTNTVFGVGDEHADWMLVGEAPGENEDKQGEPFVGQAGKLLDN 139

Query: 139 MLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT 197
           ML+++ + R + ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G   
Sbjct: 140 MLRALALKRGENVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVALVKPKLIVALGR-- 197

Query: 198 KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
              F      KT  ++         +  +P + T HP  L++    K   W  L
Sbjct: 198 ---FAAQTLLKTDGSIASMRGRVHQYEGVPVIVTYHPAYLLRSLQDKAKAWSDL 248


>gi|91784145|ref|YP_559351.1| Phage SPO1 DNA polymerase-related protein [Burkholderia xenovorans
           LB400]
 gi|91688099|gb|ABE31299.1| Phage SPO1 DNA polymerase-related protein [Burkholderia xenovorans
           LB400]
          Length = 401

 Score = 95.5 bits (236), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 47/163 (28%), Positives = 79/163 (48%), Gaps = 6/163 (3%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-T 148
           C LC    +T+      G D M+IG  P ++++  G+PF G+ G +LD ML+S+ + R  
Sbjct: 222 CRLCEKRTNTVFGVGDRGADWMLIGEAPGENEDRLGEPFVGQAGKLLDNMLRSLTLARDA 281

Query: 149 QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQK 208
            ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G          DA  
Sbjct: 282 NVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVALVKPKLIVALGRFAAQSLLKTDA-- 339

Query: 209 TYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
              ++         +  +P + T HP  L++    K   W  L
Sbjct: 340 ---SISSLRGRVHEYEGVPVIVTYHPAYLLRSLPDKAKAWADL 379


>gi|187924459|ref|YP_001896101.1| phage SPO1 DNA polymerase-related protein [Burkholderia
           phytofirmans PsJN]
 gi|187715653|gb|ACD16877.1| phage SPO1 DNA polymerase-related protein [Burkholderia
           phytofirmans PsJN]
          Length = 414

 Score = 95.5 bits (236), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 81/163 (49%), Gaps = 6/163 (3%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-T 148
           C LC    +T+      G D M+IG  P ++++  G+PF G+ G +LD ML+S+ + R T
Sbjct: 238 CRLCEKRTNTVFGVGDRGADWMLIGEAPGENEDRLGEPFVGQAGKLLDNMLRSLTLARDT 297

Query: 149 QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQK 208
            ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G      F      K
Sbjct: 298 NVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVALVKPKLIVALGR-----FAAQSLLK 352

Query: 209 TYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
           T  ++         +  +P + T HP  L++    K   W  L
Sbjct: 353 TEASISSLRGRVHEYEGVPVIVTYHPAYLLRSLPDKAKAWADL 395


>gi|296444847|ref|ZP_06886809.1| Uracil-DNA glycosylase superfamily [Methylosinus trichosporium
           OB3b]
 gi|296257515|gb|EFH04580.1| Uracil-DNA glycosylase superfamily [Methylosinus trichosporium
           OB3b]
          Length = 175

 Score = 95.5 bits (236), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 52/176 (29%), Positives = 83/176 (47%), Gaps = 3/176 (1%)

Query: 84  LRSFHDC-HLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQS 142
           L +F  C  L + +   + A    G  LM++ + P + D  SG+ F G    +LDKML++
Sbjct: 1   LAAFDGCAQLKAAAAHFLYAAGAPGAPLMVLDFAPGEEDERSGEAFVGAEARLLDKMLKA 60

Query: 143 IEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFF 202
           I   R   +++  +PW PPG R L+  E+   +P + R +EL +PKILL +G+       
Sbjct: 61  IGQKRESAYLAYATPWRPPGARELNAGEVTALQPFLRRHVELAAPKILLILGDYAARAAL 120

Query: 203 NNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
              A    +  G+W +     S    L       L++ P +K+  W  L  L  AL
Sbjct: 121 G--ATDVAKLRGQWFDYDAGASRPRALLASSLDNLLKTPALKRRAWRDLRALAAAL 174


>gi|108760490|ref|YP_632566.1| uracil-DNA glycosylase [Myxococcus xanthus DK 1622]
 gi|108464370|gb|ABF89555.1| uracil-DNA glycosylase, family 4 [Myxococcus xanthus DK 1622]
          Length = 186

 Score = 95.5 bits (236), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 86/182 (47%), Gaps = 5/182 (2%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L E++  L     C+LCST  + +  +     +L+ +G  P +++++ G PF G  G++L
Sbjct: 2   LDEIRRELGDCQRCNLCSTRKNLVFGSGNPRAELVFVGEGPGENEDLQGVPFVGAAGDLL 61

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
            KM+ ++   R  ++I  +    PPGNRN    E+  C P +  Q+  I PK+++ +G  
Sbjct: 62  TKMIGAMGYRRDDVYICNVVKCRPPGNRNPEPEEVAACEPFLRAQLAAIQPKVVVALGKF 121

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
                   D+    +  G W      +  I  + T HP  L++ P  K+  W  L  + K
Sbjct: 122 AAQTLL-RDSTPITRLRGNWRT----YEGIQLMPTFHPAYLLRSPAEKRKAWEDLQAVMK 176

Query: 257 AL 258
            L
Sbjct: 177 VL 178


>gi|172060990|ref|YP_001808642.1| phage SPO1 DNA polymerase-related protein [Burkholderia ambifaria
           MC40-6]
 gi|171993507|gb|ACB64426.1| phage SPO1 DNA polymerase-related protein [Burkholderia ambifaria
           MC40-6]
          Length = 345

 Score = 95.5 bits (236), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 47/163 (28%), Positives = 79/163 (48%), Gaps = 6/163 (3%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C LC    +T+        D M+IG  P ++++  G+PF G+ G +LD MLQS+ + R +
Sbjct: 167 CRLCEKRTNTVFGVGDREADWMLIGEAPGENEDKQGEPFVGQAGKLLDNMLQSLALKRGE 226

Query: 150 -IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQK 208
            ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G          DA  
Sbjct: 227 NVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVALVKPKLIVALGRFAAQTLLKTDA-- 284

Query: 209 TYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
              ++         +  +P + T HP  L++    K   W  L
Sbjct: 285 ---SIASLRGRVHTYEGVPVIVTYHPAYLLRSLQDKSKAWADL 324


>gi|170733398|ref|YP_001765345.1| phage SPO1 DNA polymerase-related protein [Burkholderia cenocepacia
           MC0-3]
 gi|169816640|gb|ACA91223.1| phage SPO1 DNA polymerase-related protein [Burkholderia cenocepacia
           MC0-3]
          Length = 342

 Score = 95.1 bits (235), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 80/172 (46%), Gaps = 6/172 (3%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C LC    +T+        D M+IG  P ++++  G+PF G+ G +LD MLQS+ + R  
Sbjct: 164 CRLCEKRTNTVFGVGDREADWMLIGEAPGENEDKQGEPFVGQAGKLLDNMLQSLALKRGD 223

Query: 150 -IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQK 208
            ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G          DA  
Sbjct: 224 NVYIANVIKCRPPGNRNPEPDEVASCEPYLQRQVALVKPKLIVALGRFAAQTLLKTDA-- 281

Query: 209 TYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
              ++         +  +P + T HP  L++    K   W  L   +   K 
Sbjct: 282 ---SIASLRGRVHAYEGVPVIVTYHPAYLLRSLQDKSKAWADLCLARDTFKR 330


>gi|53803655|ref|YP_114693.1| phage SPO1 DNA polymerase-like protein [Methylococcus capsulatus
           str. Bath]
 gi|53757416|gb|AAU91707.1| phage SPO1 DNA polymerase-related protein [Methylococcus capsulatus
           str. Bath]
          Length = 243

 Score = 95.1 bits (235), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 82/164 (50%), Gaps = 7/164 (4%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C L  T   T+          M+IG  P + +++ G+PF G+ G +L++ML++I + R +
Sbjct: 71  CELHLTRTQTVFGVGNRRATWMVIGEAPGEQEDLQGEPFVGRAGQLLNEMLRAIGLKREE 130

Query: 150 IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN-KTKNFFFNNDAQK 208
           ++I+ I    PP NR+    E   C   + RQI LI P+I+L  G    +N        K
Sbjct: 131 VYIANILKCRPPRNRDPKPEEAAACESYLKRQIALIRPRIILAAGRIAAQNLL------K 184

Query: 209 TYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALI 252
           + + +GK       +  IP + T HP  L++ PL K+  W  L+
Sbjct: 185 STETIGKLRGRVHRYENIPLVITYHPAYLLRAPLEKRKAWQDLL 228


>gi|226227093|ref|YP_002761199.1| putative DNA glycosylase [Gemmatimonas aurantiaca T-27]
 gi|226090284|dbj|BAH38729.1| putative DNA glycosylase [Gemmatimonas aurantiaca T-27]
          Length = 293

 Score = 95.1 bits (235), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 54/196 (27%), Positives = 93/196 (47%), Gaps = 8/196 (4%)

Query: 66  QADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQ---DLMIIGYTPSDSDN 122
           Q  S+A     L  L+ L +    C  C+   S       EG    D + +G  P  +++
Sbjct: 85  QPTSVAPDIAQLPTLEQLAQHVAGCQRCALHASAKNPVPGEGNPEADFLCVGEAPGANED 144

Query: 123 ISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQI 182
             G+PF G  G +L K+L +I++ R  ++I  +    PPGNR+    E++ C+P ++RQI
Sbjct: 145 AQGRPFVGDAGQLLTKILGAIQLSRESVYICNVLKHRPPGNRDPLPDEVQACQPYLLRQI 204

Query: 183 ELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPL 242
           EL+ PK++L +G      F      +T  ++G           +P + T HP  L++   
Sbjct: 205 ELVRPKVILALGR-----FAAQTLLQTTTSIGVLRGRIHRFHGVPLIVTYHPAALLRNES 259

Query: 243 IKKNTWHALITLKKAL 258
            K+ TW  +   ++ L
Sbjct: 260 WKRPTWEDVKLARRVL 275


>gi|317401956|gb|EFV82558.1| uracil-DNA glycosylase, family 4 [Achromobacter xylosoxidans C54]
          Length = 192

 Score = 95.1 bits (235), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 54/184 (29%), Positives = 90/184 (48%), Gaps = 5/184 (2%)

Query: 71  AQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSG 130
           A K  +L EL+  + +   C LCS     +     +    +++G  P + ++  G+PF G
Sbjct: 4   AVKNANLDELREQVVACTACGLCSGRRHAVFGHGGQPTRWLVVGEAPGEQEDRQGQPFVG 63

Query: 131 KTGNMLDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKI 189
           ++G +LD ML ++ + R + + I+ +    PPGNRN    E+  C P +MRQI L+ P+ 
Sbjct: 64  RSGQLLDSMLSAVGMSRERDVFIANVIKCRPPGNRNPKPEEIAACSPYLMRQIALLKPER 123

Query: 190 LLFIGNKTKNFFFNNDAQKTYQNL-GKWSNLCTPHSI-IPTLATVHPQELIQYPLIKKNT 247
           +L +G          DA  T  +L G+   + T     IP + + HP  L++ P  K   
Sbjct: 124 ILVLGRFAAQTLLGTDA--TIGSLRGRVHQMKTEEGREIPVIVSYHPAYLLRSPAEKARA 181

Query: 248 WHAL 251
           W  L
Sbjct: 182 WQDL 185


>gi|86158792|ref|YP_465577.1| phage SPO1 DNA polymerase-like protein [Anaeromyxobacter
           dehalogenans 2CP-C]
 gi|85775303|gb|ABC82140.1| phage SPO1 DNA polymerase-related protein [Anaeromyxobacter
           dehalogenans 2CP-C]
          Length = 245

 Score = 95.1 bits (235), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 85/193 (44%), Gaps = 8/193 (4%)

Query: 69  SIAQKACSLHELKSLLRSFHDCHLC---STSLSTICATQTEGQDLMIIGYTPSDSDNISG 125
           +  +K C    L  +  +  DC  C       + +        +L+ +G  P   ++  G
Sbjct: 51  AAGEKGCGSEALVQVRDALGDCRRCKLAGGRTTLVFGVGNPHAELVFVGEGPGADEDREG 110

Query: 126 KPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELI 185
           +PF GK G +L KM+Q++   R Q++I+ +    PPGNRN    E+E C P +  Q+  I
Sbjct: 111 EPFVGKAGQLLTKMIQAMGYQREQVYIANVVKCRPPGNRNPEPDEIEACEPFLRAQLAAI 170

Query: 186 SPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKK 245
            P++++ +G          D     +  G W      +  I  + T HP  L++ P  KK
Sbjct: 171 RPRVVVALGKFAAQTLL-RDTTPITRLRGGWRE----YEGIRLMPTFHPAYLLRSPEEKK 225

Query: 246 NTWHALITLKKAL 258
             W  L  + K L
Sbjct: 226 KAWEDLQLVMKEL 238


>gi|167846322|ref|ZP_02471830.1| putative phage-related DNA polymerase [Burkholderia pseudomallei
           B7210]
          Length = 263

 Score = 95.1 bits (235), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 53/206 (25%), Positives = 98/206 (47%), Gaps = 16/206 (7%)

Query: 55  NIRHIHSPLVQQADSIAQKACSL--------HELKSLLRSFHDCHLCSTSLSTICATQTE 106
           ++  +H P++   D  A+ A +          EL++ +     C LC    +T+     E
Sbjct: 48  DLEPVHEPVLP--DVAARPAATTPSVAELGWDELRARVADCERCRLCEKRTNTVFGVGDE 105

Query: 107 GQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ-IHISMISPWHPPGNRN 165
             D M++G  P ++++  G+PF G+ G +LD ML+++ + R + ++I+ +    PPGNRN
Sbjct: 106 HADWMLVGEAPGENEDKQGEPFVGQAGKLLDNMLRALALKRGENVYIANVIKCWPPGNRN 165

Query: 166 LSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSI 225
               E+  C P + RQ+ L+ PK+++ +G      F      KT  ++         +  
Sbjct: 166 PEPDEVARCEPYLQRQVALVKPKLIVALGR-----FAAQTLLKTDGSIASMRGRVHQYEG 220

Query: 226 IPTLATVHPQELIQYPLIKKNTWHAL 251
           +P + T HP  L++    K   W  L
Sbjct: 221 VPVIVTYHPAYLLRSLQDKAKAWSDL 246


>gi|160872254|ref|ZP_02062386.1| phage SPO1 DNA polymerase domain protein [Rickettsiella grylli]
 gi|159121053|gb|EDP46391.1| phage SPO1 DNA polymerase domain protein [Rickettsiella grylli]
          Length = 240

 Score = 95.1 bits (235), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 55/183 (30%), Positives = 87/183 (47%), Gaps = 7/183 (3%)

Query: 78  HELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLD 137
            ELK  +     C L  T  + +        DL+++G  P   ++  G+PF G+ G +L 
Sbjct: 54  QELKLAVNHCKACDLYKTRSNPVFGVGNPHADLLVVGEAPGAHEDKQGEPFVGRGGQLLT 113

Query: 138 KMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT 197
            ML SI   R   +I+ I    PP NR+ S  E+  C P ++RQI LI PK++L +G   
Sbjct: 114 NMLSSIGFKREDYYIANILKSRPPNNRDPSLEEVSACTPYLLRQINLIKPKLILAVGRIA 173

Query: 198 KNFFFNNDA--QKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
            ++  + ++   +   NL  +         IP L T HP  L++ P  K+  W  +  +K
Sbjct: 174 AHYLLSTESTMARLRGNLFYFG-----ERKIPLLVTYHPAYLLRSPREKRKAWQDMRCVK 228

Query: 256 KAL 258
           K L
Sbjct: 229 KQL 231


>gi|119383192|ref|YP_914248.1| phage SPO1 DNA polymerase-related protein [Paracoccus denitrificans
           PD1222]
 gi|119372959|gb|ABL68552.1| phage SPO1 DNA polymerase-related protein [Paracoccus denitrificans
           PD1222]
          Length = 271

 Score = 95.1 bits (235), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 48/157 (30%), Positives = 79/157 (50%), Gaps = 12/157 (7%)

Query: 110 LMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQI------HISMISPWHPPGN 163
           +MIIG  P + ++  G+PF G+ G +LD+M  +I + R  +      +I+ +  W PPGN
Sbjct: 121 IMIIGEAPGEEEDRQGRPFVGRAGQLLDQMFGAIGLSREAVDAERALYITNVLTWRPPGN 180

Query: 164 RNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPH 223
           R     E+ +  P + R +EL  P++L+ +GN       N   Q   +  GKW+      
Sbjct: 181 RRPEPAEIAMMLPFLTRHVELAQPQLLVLMGNTPCIAALNQ--QGILKLRGKWTTAFG-- 236

Query: 224 SIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
             +P L   HP  L++ PL K+  W  L++L   L+ 
Sbjct: 237 --LPALPMAHPAYLLRTPLAKREAWADLLSLSARLEG 271


>gi|194333183|ref|YP_002015043.1| phage SPO1 DNA polymerase-like protein [Prosthecochloris aestuarii
           DSM 271]
 gi|194311001|gb|ACF45396.1| phage SPO1 DNA polymerase-related protein [Prosthecochloris
           aestuarii DSM 271]
          Length = 209

 Score = 95.1 bits (235), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 54/186 (29%), Positives = 85/186 (45%), Gaps = 5/186 (2%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           SL EL +  ++   C L  T  + +         +++IG  P   ++  G+PF G++G +
Sbjct: 23  SLDELGAQSKNCTQCQLAETRQNVVFGEGNPQAKIVVIGEGPGAEEDAQGRPFVGRSGKL 82

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           LDK+LQSI   R  ++I  I    PP NRN    E+E C P +  Q+ELI P I+L +G 
Sbjct: 83  LDKILQSIGFDRNDVYICNIVKCRPPANRNPLAEEIEQCLPWLNAQLELIQPGIILLLGK 142

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
              N    N       ++G              + T HP  L++ P  K   W  +  L+
Sbjct: 143 VAANTILQNKC-----SMGSMRGSIIRWGTYDVVVTYHPAALLRNPNWKYQCWEDVKMLR 197

Query: 256 KALKNL 261
           K   ++
Sbjct: 198 KHFDSM 203


>gi|71907612|ref|YP_285199.1| Phage SPO1 DNA polymerase-related protein [Dechloromonas aromatica
           RCB]
 gi|71847233|gb|AAZ46729.1| Phage SPO1 DNA polymerase-related protein [Dechloromonas aromatica
           RCB]
          Length = 260

 Score = 95.1 bits (235), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 72/265 (27%), Positives = 118/265 (44%), Gaps = 26/265 (9%)

Query: 7   LSQEQILTIALFYADSGV--YWVFDE--PNNEATYESQRKEKSIDSAIQPITNIRHIHSP 62
           LS+EQ+L      A+ G+   WV  +  P   A   S + E     A+ P        +P
Sbjct: 3   LSREQML------AEMGISPIWVLRDVAPPASAIESSPQMEAE---AVTPPQVAEVPSAP 53

Query: 63  LVQQADSIAQKACSLHELK--SLLRSFHDCH---LCSTSLSTICATQTEGQDLMIIGYTP 117
           +  Q       A ++  L   +L R   +C    LC      +        + + IG  P
Sbjct: 54  IPAQTPPPRSTAAAVDTLDWPALARQVAECRACSLCEQRKQAVLGVGDTNPEWLFIGEGP 113

Query: 118 SDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRP 176
              +++ G+PF G+ G +LD ML S++I R  +++I+      PPGNR     EM  C P
Sbjct: 114 GAEEDVKGEPFVGQAGKLLDNMLASLDIARGNRVYIANAVKCRPPGNRTPDAAEMAACWP 173

Query: 177 IIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNL-GKWSNLCTPHSIIPTLATVHPQ 235
            + RQI L+ PK+++ +G    +   ++D  K+  +L GK   L      IP + T HP 
Sbjct: 174 YLERQIALLKPKVIVLLGKAAVHAVLHDD--KSLASLRGKRFELAG----IPVVVTYHPA 227

Query: 236 ELIQYPLIKKNTWHALITLKKALKN 260
            L++    K   W  L+  ++ L+ 
Sbjct: 228 YLLRNLPDKAKAWEDLLFARRTLRE 252


>gi|171319311|ref|ZP_02908424.1| phage SPO1 DNA polymerase-related protein [Burkholderia ambifaria
           MEX-5]
 gi|171095493|gb|EDT40460.1| phage SPO1 DNA polymerase-related protein [Burkholderia ambifaria
           MEX-5]
          Length = 229

 Score = 95.1 bits (235), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 47/163 (28%), Positives = 79/163 (48%), Gaps = 6/163 (3%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C LC    +T+        D M+IG  P ++++  G+PF G+ G +LD MLQS+ + R +
Sbjct: 51  CRLCEKRTNTVFGVGDREADWMLIGEAPGENEDKQGEPFVGQAGKLLDNMLQSLALKRGE 110

Query: 150 -IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQK 208
            ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G          DA  
Sbjct: 111 NVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVALVKPKLIVALGRFAAQTLLKTDA-- 168

Query: 209 TYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
              ++         +  +P + T HP  L++    K   W  L
Sbjct: 169 ---SIASLRGRVHTYEGVPVIVTYHPAYLLRSLQDKSKAWADL 208


>gi|115352126|ref|YP_773965.1| phage SPO1 DNA polymerase--like protein [Burkholderia ambifaria
           AMMD]
 gi|115282114|gb|ABI87631.1| phage SPO1 DNA polymerase-related protein [Burkholderia ambifaria
           AMMD]
          Length = 367

 Score = 95.1 bits (235), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 47/163 (28%), Positives = 79/163 (48%), Gaps = 6/163 (3%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C LC    +T+        D M+IG  P ++++  G+PF G+ G +LD MLQS+ + R +
Sbjct: 189 CRLCEKRTNTVFGVGDREADWMLIGEAPGENEDKQGEPFVGQAGKLLDNMLQSLALKRGE 248

Query: 150 -IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQK 208
            ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G          DA  
Sbjct: 249 NVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVALVKPKLIVALGRFAAQTLLKTDA-- 306

Query: 209 TYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
              ++         +  +P + T HP  L++    K   W  L
Sbjct: 307 ---SIASLRGRVHTYEGVPVIVTYHPAYLLRSLQDKSKAWADL 346


>gi|74317741|ref|YP_315481.1| putative phage DNA polymerase [Thiobacillus denitrificans ATCC
           25259]
 gi|74057236|gb|AAZ97676.1| putative phage DNA polymerase [Thiobacillus denitrificans ATCC
           25259]
          Length = 213

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 52/188 (27%), Positives = 83/188 (44%), Gaps = 6/188 (3%)

Query: 75  CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
           C   +L   +     C L +T    +        D +++G  P   ++  G+PF GK G 
Sbjct: 31  CGWEQLSDAVAHCTRCRLAATRTQGVLGVGDREADWLVVGEAPGADEDRLGEPFVGKAGK 90

Query: 135 MLDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFI 193
           +LD ML SI I R   ++I+ +    PPGNR+    E+  C P ++ QI+L+ PK++L +
Sbjct: 91  LLDAMLASIGIARGDNVYITNVLKSRPPGNRDPEADEVAACMPYLLAQIDLVKPKLILAL 150

Query: 194 GNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALIT 253
           G          DA      LG           IP + T HP  L++    K   W  L  
Sbjct: 151 GRFAAQSLLATDAA-----LGSLRGRVHSFQNIPLVVTYHPAYLLRNLPDKARAWEDLCL 205

Query: 254 LKKALKNL 261
            ++ ++ L
Sbjct: 206 ARRTIQRL 213


>gi|221198347|ref|ZP_03571393.1| uracil-DNA glycosylase, family 4 [Burkholderia multivorans CGD2M]
 gi|221208286|ref|ZP_03581290.1| uracil-DNA glycosylase, family 4 [Burkholderia multivorans CGD2]
 gi|221171934|gb|EEE04377.1| uracil-DNA glycosylase, family 4 [Burkholderia multivorans CGD2]
 gi|221182279|gb|EEE14680.1| uracil-DNA glycosylase, family 4 [Burkholderia multivorans CGD2M]
          Length = 358

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 79/163 (48%), Gaps = 6/163 (3%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C LC    +T+        D M+IG  P ++++  G+PF G+ G +LD ML+S+ + R +
Sbjct: 180 CRLCEKRTNTVFGVGDREADWMLIGEAPGENEDKQGEPFVGQAGKLLDNMLRSLSLQRGE 239

Query: 150 -IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQK 208
            ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G          DA  
Sbjct: 240 NVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVALVKPKLIVALGRFAAQTLLKTDA-- 297

Query: 209 TYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
              ++         +  +P + T HP  L++    K   W  L
Sbjct: 298 ---SIASLRGRVHAYEGVPVIVTYHPAYLLRSLPDKAKAWADL 337


>gi|206560476|ref|YP_002231240.1| uracil DNA glycosylase superfamily protein [Burkholderia
           cenocepacia J2315]
 gi|198036517|emb|CAR52414.1| uracil DNA glycosylase superfamily protein [Burkholderia
           cenocepacia J2315]
          Length = 343

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 80/172 (46%), Gaps = 6/172 (3%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C LC    +T+        D M+IG  P ++++  G+PF G+ G +LD MLQS+ + R  
Sbjct: 165 CRLCEKRTNTVFGVGDREADWMLIGEAPGENEDKQGEPFVGQAGKLLDNMLQSLSLKRGD 224

Query: 150 -IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQK 208
            ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G          DA  
Sbjct: 225 NVYIANVIKCRPPGNRNPEPDEVASCEPYLQRQVALVKPKLIVALGRFAAQTLLKTDA-- 282

Query: 209 TYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
              ++         +  +P + T HP  L++    K   W  L   +   + 
Sbjct: 283 ---SIASLRGRVHAYEGVPVIVTYHPAYLLRSLQDKSKAWADLCLARNTFRR 331


>gi|221215432|ref|ZP_03588396.1| uracil-DNA glycosylase, family 4 [Burkholderia multivorans CGD1]
 gi|221164616|gb|EED97098.1| uracil-DNA glycosylase, family 4 [Burkholderia multivorans CGD1]
          Length = 358

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 79/163 (48%), Gaps = 6/163 (3%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C LC    +T+        D M+IG  P ++++  G+PF G+ G +LD ML+S+ + R +
Sbjct: 180 CRLCEKRTNTVFGVGDREADWMLIGEAPGENEDKQGEPFVGQAGKLLDNMLRSLSLQRGE 239

Query: 150 -IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQK 208
            ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G          DA  
Sbjct: 240 NVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVALVKPKLIVALGRFAAQTLLKTDA-- 297

Query: 209 TYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
              ++         +  +P + T HP  L++    K   W  L
Sbjct: 298 ---SIASLRGRVHAYEGVPVIVTYHPAYLLRSLPDKAKAWADL 337


>gi|291614685|ref|YP_003524842.1| phage SPO1 DNA polymerase-related protein [Sideroxydans
           lithotrophicus ES-1]
 gi|291584797|gb|ADE12455.1| phage SPO1 DNA polymerase-related protein [Sideroxydans
           lithotrophicus ES-1]
          Length = 245

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 53/190 (27%), Positives = 85/190 (44%), Gaps = 6/190 (3%)

Query: 63  LVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDN 122
           L QQ +       +  +LK ++R    C L S    T+     E  + + +G  P   ++
Sbjct: 52  LRQQTEPPPASTLNWTDLKRVVRDCSACKLRSGCTQTVFGVGDEKAEWLFVGEGPGADED 111

Query: 123 ISGKPFSGKTGNMLDKMLQSIEIMRT-QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQ 181
             G+PF G+ G +LD ML ++ + R  +++I+ I    PP NR     E+  C P + +Q
Sbjct: 112 AQGEPFVGQAGKLLDNMLAALRLKRGDKVYIANIVKCRPPNNRTPEPDEIATCMPYLQQQ 171

Query: 182 IELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
           IELI PK+++ +G          DA      LG        +   P + T HP  L++ P
Sbjct: 172 IELIKPKLIVALGKTAATSLLGRDA-----TLGSLRGTVHDYHGTPLIVTYHPAYLLRSP 226

Query: 242 LIKKNTWHAL 251
             K   W  L
Sbjct: 227 AEKAKAWQDL 236


>gi|300704264|ref|YP_003745867.1| uracil-DNA glycosylase,phage-like protein [Ralstonia solanacearum
           CFBP2957]
 gi|299071928|emb|CBJ43257.1| uracil-DNA glycosylase,phage-related protein [Ralstonia
           solanacearum CFBP2957]
          Length = 279

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 53/197 (26%), Positives = 93/197 (47%), Gaps = 8/197 (4%)

Query: 61  SPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDS 120
           +P + +A  IA  A    +L++ +     C LC     T+        + M+IG  P + 
Sbjct: 82  APELPRAQRIA--AFDWAQLEAAVSGCTACKLCERRTQTVFGVGDRQAEWMLIGEAPGEQ 139

Query: 121 DNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIM 179
           ++  G+PF G+ G +LD ML+++ + R T + I+ +    PPGNR+    E+ +C P + 
Sbjct: 140 EDRQGEPFVGQAGKLLDSMLRAVGLSRETGVFIANVLKCRPPGNRDPEPDEVAMCDPYLK 199

Query: 180 RQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ 239
           RQI L+ P++++ +G      F      +T   +GK          +P + T HP  L++
Sbjct: 200 RQIALVKPRVIIVLGR-----FAAQSLLQTQTPVGKLRGKVHEVDGVPVVVTYHPAYLLR 254

Query: 240 YPLIKKNTWHALITLKK 256
               K   W  L   +K
Sbjct: 255 TLTDKARAWEDLCLARK 271


>gi|197104821|ref|YP_002130198.1| uracil-DNA glycosylase [Phenylobacterium zucineum HLK1]
 gi|196478241|gb|ACG77769.1| uracil-DNA glycosylase [Phenylobacterium zucineum HLK1]
          Length = 274

 Score = 94.4 bits (233), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 68/252 (26%), Positives = 111/252 (44%), Gaps = 13/252 (5%)

Query: 18  FYADSGV-YWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSP------LVQQADSI 70
           F+A++GV   + DEP +          K     + P      + SP       + QA ++
Sbjct: 18  FWAEAGVDGMLLDEPFDRIEAGKILPPKPAPPLVAPAVRPGPVASPQPDVSAAIAQAQAL 77

Query: 71  AQKACSLHELKSLLRSFHDCHLC--STSLSTICATQTEGQDLMIIGYTPSDSDNISGKPF 128
           A +A  +  L + + +F  C L     +   +C        LM+IG  P   ++  G PF
Sbjct: 78  AAQAQDMDALAAAIAAFEGCPLRFEGAASKAVCWRGEPSAPLMVIGEGPGAEEDSQGLPF 137

Query: 129 SGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPK 188
            G+ G +LD+ML +  +    +  + +  W PPGNR  S  E  IC P + R I L  P+
Sbjct: 138 VGRAGKLLDRMLGAAGLTGRALITNTVF-WRPPGNRTPSPHEQLICAPFLERAIALTQPR 196

Query: 189 ILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSI--IPTLATVHPQELIQYPLIKKN 246
           +LL +G  +       D +      G+W    +      +P + T+HP  L++ P  KK 
Sbjct: 197 MLLLVGGASAKSLLKKD-EGILSLRGRWFEWRSSDGALELPAMPTLHPAFLLRQPGAKKR 255

Query: 247 TWHALITLKKAL 258
            W  L+TL + L
Sbjct: 256 AWSDLLTLAERL 267


>gi|121997486|ref|YP_001002273.1| phage SPO1 DNA polymerase-like protein [Halorhodospira halophila
           SL1]
 gi|121588891|gb|ABM61471.1| phage SPO1 DNA polymerase-related protein [Halorhodospira halophila
           SL1]
          Length = 294

 Score = 94.4 bits (233), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 53/180 (29%), Positives = 82/180 (45%), Gaps = 9/180 (5%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKM 139
           L++ +   H C LC     T+        DL+IIG  P   ++  G+PF G+ G +LD M
Sbjct: 115 LEARVAGCHACKLCEGRTQTVFGVGDRQADLVIIGEGPGAEEDRQGEPFVGRAGQLLDAM 174

Query: 140 LQSIEIMRTQ--IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT 197
           L +I+  R +  ++I  I    PPGNR+    E+  C P + RQ+EL+ PK ++ +G   
Sbjct: 175 LAAIDRGRDRGGVYIGNIVKCRPPGNRDPRPDEVAACTPYLRRQLELLEPKAIVALGRVA 234

Query: 198 KNFFFNNDAQKTYQNLGKWSNLCTPHSI--IPTLATVHPQELIQYPLIKKNTWHALITLK 255
                     +T   L K       +    IP   T HP  L++ P  K   W  L  ++
Sbjct: 235 AQQLL-----ETKSPLAKLRGRVHHYGAQSIPVWVTYHPAYLLRSPGEKAKVWQDLKRIR 289


>gi|161524407|ref|YP_001579419.1| phage SPO1 DNA polymerase-like protein [Burkholderia multivorans
           ATCC 17616]
 gi|189350838|ref|YP_001946466.1| bacteriophage-type DNA polymerase [Burkholderia multivorans ATCC
           17616]
 gi|160341836|gb|ABX14922.1| phage SPO1 DNA polymerase-related protein [Burkholderia multivorans
           ATCC 17616]
 gi|189334860|dbj|BAG43930.1| bacteriophage-type DNA polymerase [Burkholderia multivorans ATCC
           17616]
          Length = 358

 Score = 94.4 bits (233), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 79/163 (48%), Gaps = 6/163 (3%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C LC    +T+        D M+IG  P ++++  G+PF G+ G +LD ML+S+ + R +
Sbjct: 180 CRLCEKRTNTVFGVGDREADWMLIGEAPGENEDKQGEPFVGQAGKLLDNMLRSLSLQRGE 239

Query: 150 -IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQK 208
            ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G          DA  
Sbjct: 240 NVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVALVKPKLIVALGRFAAQTLLKTDA-- 297

Query: 209 TYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
              ++         +  +P + T HP  L++    K   W  L
Sbjct: 298 ---SIASLRGRVHAYEGVPVIVTYHPAYLLRSLPDKAKAWADL 337


>gi|300691643|ref|YP_003752638.1| uracil-DNA glycosylase,phage-related protein [Ralstonia
           solanacearum PSI07]
 gi|299078703|emb|CBJ51362.1| uracil-DNA glycosylase,phage-related protein [Ralstonia
           solanacearum PSI07]
          Length = 273

 Score = 94.4 bits (233), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 85/179 (47%), Gaps = 6/179 (3%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           +L++ +     C LC     T+        D M+IG  P + ++  G+PF G+ G +LD 
Sbjct: 92  QLEAAVSGCTACKLCERRTQTVFGVGDRQADWMLIGEAPGEQEDRQGEPFVGQAGKLLDS 151

Query: 139 MLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT 197
           ML++I + R + + I+ +    PPGNR+    E+ +C P + RQI L+ P++++ +G   
Sbjct: 152 MLRAIGLSRERGVFIANVLKCRPPGNRDPEPDEVAMCDPYLKRQIALVKPRVIIVLGR-- 209

Query: 198 KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
              F      +T   +GK          +P + T HP  L++    K   W  L   +K
Sbjct: 210 ---FAAQSLLQTQTPVGKLRGKVHEVDGVPVVVTYHPAYLLRTLTDKARAWEDLCLARK 265


>gi|254495599|ref|ZP_05108521.1| bacteriophage related DNA polymerase [Legionella drancourtii
           LLAP12]
 gi|254355169|gb|EET13782.1| bacteriophage related DNA polymerase [Legionella drancourtii
           LLAP12]
          Length = 198

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 89/189 (47%), Gaps = 9/189 (4%)

Query: 74  ACSLHELKSLLRSFHDCHLC---STSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSG 130
           AC   +L +L +    C  C    T   T+    +    LMIIG  P   ++  G PF G
Sbjct: 11  ACE-EQLSALAKEVAACTRCPLHQTRKQTVFFRGSPQAKLMIIGEAPGFYEDQQGLPFVG 69

Query: 131 KTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKIL 190
           K G +L++MLQS+E+     +I+ +    PP NR+    E+  C   + RQIEL+ P ++
Sbjct: 70  KAGGLLNQMLQSVELFEQDFYIANVLKCRPPNNRDPQAAEIRQCSAYLSRQIELLQPSLI 129

Query: 191 LFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHA 250
           L +G     F  N         L +  N    +   P + + HP  L++ P  KK T+  
Sbjct: 130 LALGRFAGQFLLNKPL-----ALKQLRNNVHYYKNTPFIVSYHPAYLLRKPADKKKTYLD 184

Query: 251 LITLKKALK 259
           L+ +KK L+
Sbjct: 185 LLAVKKFLQ 193


>gi|295676848|ref|YP_003605372.1| phage SPO1 DNA polymerase-related protein [Burkholderia sp.
           CCGE1002]
 gi|295436691|gb|ADG15861.1| phage SPO1 DNA polymerase-related protein [Burkholderia sp.
           CCGE1002]
          Length = 332

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 47/163 (28%), Positives = 78/163 (47%), Gaps = 6/163 (3%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-T 148
           C LC    +T+        D M+IG  P ++++  G+PF G+ G +LD ML S+ + R T
Sbjct: 156 CRLCEKRTNTVFGVGDREADWMLIGEAPGENEDRQGEPFVGQAGKLLDNMLHSLALARGT 215

Query: 149 QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQK 208
            ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G          DA  
Sbjct: 216 NVYIANVIKCRPPGNRNPQPDEVARCEPYLQRQVSLVKPKLIVALGRFAAQSLLKTDA-- 273

Query: 209 TYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
              ++         +  +P + T HP  L++    K   W  L
Sbjct: 274 ---SISSLRGRVHTYEGVPVIVTYHPAYLLRSLPDKAKAWTDL 313


>gi|170702440|ref|ZP_02893325.1| phage SPO1 DNA polymerase-related protein [Burkholderia ambifaria
           IOP40-10]
 gi|170132643|gb|EDT01086.1| phage SPO1 DNA polymerase-related protein [Burkholderia ambifaria
           IOP40-10]
          Length = 349

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 47/163 (28%), Positives = 79/163 (48%), Gaps = 6/163 (3%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C LC    +T+        D M+IG  P ++++  G+PF G+ G +LD MLQS+ + R +
Sbjct: 171 CRLCEKRTNTVFGVGDREADWMLIGEAPGENEDKQGEPFVGQAGKLLDNMLQSLALKRGE 230

Query: 150 -IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQK 208
            ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G          DA  
Sbjct: 231 NVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVALVKPKLIVALGRFAAQTLLKTDA-- 288

Query: 209 TYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
              ++         +  +P + T HP  L++    K   W  L
Sbjct: 289 ---SIASLRGRVHTYEGVPVIVTYHPAYLLRSLQDKSKAWADL 328


>gi|114567385|ref|YP_754539.1| Uracil-DNA glycosylase-like protein [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
 gi|114338320|gb|ABI69168.1| Uracil-DNA glycosylase-like protein [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
          Length = 233

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 52/170 (30%), Positives = 85/170 (50%), Gaps = 5/170 (2%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKM 139
           L+ L R+ ++C L S     + +       +M IG  P   ++  G+PF GK G +LDK+
Sbjct: 52  LEELARNCNNCRLRSGCRQVVFSDGDVKSRIMFIGEGPGKDEDEQGRPFVGKAGQLLDKI 111

Query: 140 LQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKN 199
           L + EI R+Q++IS +    PPGNR  +  E+  CR  +  QI ++ P I++ +G     
Sbjct: 112 LVAAEIPRSQVYISNVVKCRPPGNRLPNPDEVRECRNYLEAQIRIMQPAIIVCLGAMASQ 171

Query: 200 FFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWH 249
              +  A  + +  GKW N       +  +AT HP  L++ P  K+  W 
Sbjct: 172 VVIDPKASVS-KIRGKWFN----RQGVKIMATYHPAALLRNPSYKRPAWQ 216


>gi|281358066|ref|ZP_06244550.1| phage SPO1 DNA polymerase-related protein [Victivallis vadensis
           ATCC BAA-548]
 gi|281315439|gb|EFA99468.1| phage SPO1 DNA polymerase-related protein [Victivallis vadensis
           ATCC BAA-548]
          Length = 292

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 53/185 (28%), Positives = 85/185 (45%), Gaps = 5/185 (2%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L EL+ L  +  +C L     + +         LM IG  P   +++ G+PF G  G +L
Sbjct: 106 LDELRQLALACRNCPLAQGRHTVVFGEGNPEARLMFIGEGPGYQEDMQGRPFVGPAGQLL 165

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
            KM+Q+++  R +++I+ I    PP NRN    E   C   + RQIEL+ P+ ++ +G  
Sbjct: 166 TKMIQAMQFTREEVYIANIVKCRPPNNRNPEPDEAFACIGYLKRQIELVQPEAIVLLGAV 225

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
              F          +  GKW      ++ IP + T HP  L++ P  KK  W  L  + K
Sbjct: 226 AVRFLLERPG-GIMRLRGKWLG----YNGIPVMPTFHPSYLLRDPSGKKLAWADLQMVMK 280

Query: 257 ALKNL 261
               +
Sbjct: 281 MFGKV 285


>gi|209518016|ref|ZP_03266847.1| phage SPO1 DNA polymerase-related protein [Burkholderia sp. H160]
 gi|209501520|gb|EEA01545.1| phage SPO1 DNA polymerase-related protein [Burkholderia sp. H160]
          Length = 292

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 48/168 (28%), Positives = 82/168 (48%), Gaps = 6/168 (3%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-T 148
           C LC    +T+        D M+IG  P ++++  G+PF G+ G +LD ML+S+ + R T
Sbjct: 116 CRLCEKRTNTVFGVGDREADWMLIGEAPGENEDRQGEPFVGQAGKLLDNMLRSLALARGT 175

Query: 149 QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQK 208
            ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G      F      K
Sbjct: 176 NVYIANVIKCRPPGNRNPQPDEVARCEPYLQRQVSLVKPKLIVALGR-----FAAQSLLK 230

Query: 209 TYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
           T  ++         +  +P + T HP  L++    K   W  L   ++
Sbjct: 231 TEASISSLRGRVHTYEGVPVIVTYHPAYLLRSLPDKAKAWADLCLARE 278


>gi|78066821|ref|YP_369590.1| Phage SPO1 DNA polymerase-related protein [Burkholderia sp. 383]
 gi|77967566|gb|ABB08946.1| Phage SPO1 DNA polymerase-related protein [Burkholderia sp. 383]
          Length = 336

 Score = 93.6 bits (231), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 47/163 (28%), Positives = 78/163 (47%), Gaps = 6/163 (3%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C LC    +T+        D M+IG  P ++++  G+PF G+ G +LD MLQS+ + R  
Sbjct: 158 CRLCEKRTNTVFGVGDREADWMLIGEAPGENEDKQGEPFVGQAGKLLDNMLQSLSLKRGD 217

Query: 150 -IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQK 208
            ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G          DA  
Sbjct: 218 NVYIANVIKCRPPGNRNPEPDEVASCEPYLQRQVALVKPKLIVALGRFAAQTLLKTDA-- 275

Query: 209 TYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
              ++         +  +P + T HP  L++    K   W  L
Sbjct: 276 ---SIASLRGRVHAYEGVPVIVTYHPAYLLRSLQDKSKAWADL 315


>gi|307719508|ref|YP_003875040.1| hypothetical protein STHERM_c18320 [Spirochaeta thermophila DSM
           6192]
 gi|306533233|gb|ADN02767.1| hypothetical protein STHERM_c18320 [Spirochaeta thermophila DSM
           6192]
          Length = 253

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 51/195 (26%), Positives = 91/195 (46%), Gaps = 9/195 (4%)

Query: 67  ADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGK 126
            D  A+   +LHE    +R+ + C L  T    +      G  +M++G  P   +++ G+
Sbjct: 57  GDDPARTLGALHEQ---VRACNRCDLARTRRHAVPGIGRVGLPVMVVGEAPGADEDVKGE 113

Query: 127 PFSGKTGNMLDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELI 185
           PF G+ G  LDK L +I + R + + I+ +    PPGNR+    E+  C P +  QI L+
Sbjct: 114 PFVGRAGQYLDKWLAAIGLQRGRDVFITNVVKCRPPGNRDPRPDEISACLPFLEAQIALV 173

Query: 186 SPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKK 245
            P+ +L +G      F  +    T + + +       +  IP + T HP  +++ P +++
Sbjct: 174 RPRAILTVGR-----FAASTLLGTQEGISRLRGRVYRYRDIPLVPTYHPSAVLRDPSLRR 228

Query: 246 NTWHALITLKKALKN 260
             W  L  L   L+ 
Sbjct: 229 PVWEDLKLLSSVLRG 243


>gi|163856012|ref|YP_001630310.1| bacteriophage-related DNA polymerase [Bordetella petrii DSM 12804]
 gi|163259740|emb|CAP42041.1| bacteriophage-related DNA polymerase [Bordetella petrii]
          Length = 298

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 89/203 (43%), Gaps = 9/203 (4%)

Query: 52  PITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLM 111
           P+   R    P  Q  +     A     L+  +     C LC+     +          M
Sbjct: 95  PVPAAREQAQPAAQPVEP----ARDFDALREQVIQCAACGLCNGRRHAVFGMGGRPARWM 150

Query: 112 IIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIE 170
           ++G  P + ++  G PF G++G +LD ML S+ + R + + I+ +    PPGNRN    E
Sbjct: 151 VVGEAPGEQEDRQGLPFVGRSGQLLDAMLASVGLSREKDVFIANVIKCRPPGNRNPKPEE 210

Query: 171 MEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNL-GKWSNLCTPHSI-IPT 228
           +  C P +MRQIEL+ P+ +L +G          DA  T  +L G+   L       IP 
Sbjct: 211 IAACSPYLMRQIELLKPERILVLGRFAAQTLLGTDA--TIGSLRGRRHELAAEDGRKIPV 268

Query: 229 LATVHPQELIQYPLIKKNTWHAL 251
           + + HP  L++ P  K   W  L
Sbjct: 269 VVSYHPAYLLRSPAEKARAWQDL 291


>gi|300113321|ref|YP_003759896.1| phage SPO1 DNA polymerase-like protein [Nitrosococcus watsonii
           C-113]
 gi|299539258|gb|ADJ27575.1| phage SPO1 DNA polymerase-related protein [Nitrosococcus watsonii
           C-113]
          Length = 231

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 58/207 (28%), Positives = 96/207 (46%), Gaps = 16/207 (7%)

Query: 61  SPLVQQADS---IAQKACSLHELKSLLRSFHDCHLCSTSLS---TICATQTEGQDLMIIG 114
           +PLV+  +    +A  A  + E + L      C  CS   S   T+     +    +I+G
Sbjct: 28  TPLVETGEEPIPVAPSAGVMSEWEELAVQVAGCKACSLHRSRTQTVFGVGDQAAKWLIVG 87

Query: 115 YTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEIC 174
             P   ++  G+PF G+ G +L+ ML+++ + R Q++I+ I    PP NR+    E+  C
Sbjct: 88  EAPGAEEDRQGEPFVGRAGQLLNAMLEAVGLQRGQVYIANILKCRPPNNRDPLPEEVAHC 147

Query: 175 RPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLC--TPHSIIPTLATV 232
              + RQI L+ P+I+L +G             K+   LG+        P + IP + T 
Sbjct: 148 ESYLRRQIALLRPRIILAVGRVAGQNLL-----KSSLPLGRLRGSVHQYPETAIPLVVTY 202

Query: 233 HPQELIQYPLIKKNTWHALITLKKALK 259
           HP  L++ P  K+  W     L+ ALK
Sbjct: 203 HPAYLLRAPREKRRAWQ---DLRLALK 226


>gi|115378583|ref|ZP_01465737.1| phage SPO1 DNA polymerase domain protein [Stigmatella aurantiaca
           DW4/3-1]
 gi|310822001|ref|YP_003954359.1| phage spo1 DNA polymerase domain-containing protein [Stigmatella
           aurantiaca DW4/3-1]
 gi|115364411|gb|EAU63492.1| phage SPO1 DNA polymerase domain protein [Stigmatella aurantiaca
           DW4/3-1]
 gi|309395073|gb|ADO72532.1| Phage SPO1 DNA polymerase domain protein [Stigmatella aurantiaca
           DW4/3-1]
          Length = 323

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 47/176 (26%), Positives = 82/176 (46%), Gaps = 5/176 (2%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L +++  L     C LC+   + +        DL+ +G  P ++++I G PF G  G +
Sbjct: 138 TLDQIRRELGDCRRCKLCTGRKNIVFGVGNPRADLVFVGEGPGENEDIQGVPFVGAAGEL 197

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           L KM+Q++   R +I+I  +    PPGNRN    E+  C P +  Q+  I PK+++ +G 
Sbjct: 198 LTKMIQAMGFSRDEIYICNVVKCRPPGNRNPEADEIAACEPFLRSQLLAIQPKVIVALGK 257

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
                    D     +  G+W      +  +  + T HP  L++ P  K+  W  L
Sbjct: 258 FAAQTLL-RDTTPITRLRGQWRE----YQGVKLMPTFHPAYLLRSPAEKRKAWEDL 308


>gi|187928331|ref|YP_001898818.1| phage SPO1 DNA polymerase-like protein [Ralstonia pickettii 12J]
 gi|187725221|gb|ACD26386.1| phage SPO1 DNA polymerase-related protein [Ralstonia pickettii 12J]
          Length = 264

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 85/179 (47%), Gaps = 6/179 (3%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           +L++ + +   C LC    +T+        + M+IG  P + ++  G+PF G+ G +LD 
Sbjct: 83  QLEAAVSNCTSCKLCERRTNTVFGVGDREAEWMLIGEAPGEQEDKQGEPFVGQAGKLLDS 142

Query: 139 MLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT 197
           ML+SI + R + + I+ +    PPGNR+    E  +C P + RQI L+ P+I++ +G   
Sbjct: 143 MLRSIGLSREKGVFIANVLKCRPPGNRDPEPDEAAMCDPYLKRQIALVKPRIIVVLGRVA 202

Query: 198 KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
                     +T   +GK          +P + T HP  L++    K   W  L   +K
Sbjct: 203 AQNLL-----QTQTPVGKLRGTVHDVEGVPVVVTYHPAYLLRTLTDKARAWEDLCLARK 256


>gi|167769246|ref|ZP_02441299.1| hypothetical protein ANACOL_00569 [Anaerotruncus colihominis DSM
           17241]
 gi|167668886|gb|EDS13016.1| hypothetical protein ANACOL_00569 [Anaerotruncus colihominis DSM
           17241]
          Length = 188

 Score = 92.8 bits (229), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 52/187 (27%), Positives = 93/187 (49%), Gaps = 6/187 (3%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           S   L+S   +   C LC T  S +    ++   +M IG  P +++++ G+PF G+ G +
Sbjct: 4   SFQALQSAALACQGCKLCQTRHSVVFGAGSQHAKIMFIGEGPGENEDLQGEPFVGRAGQL 63

Query: 136 LDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           LDK+L  + + R   ++I+ +    PP NR+    E+E C P +  QIE I PKI++ +G
Sbjct: 64  LDKILTHVGLSRQNDVYITNMVKCRPPKNRDPERDEVEACMPYLRAQIEFIRPKIIVCLG 123

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITL 254
                   + + + T Q+ G++ +       +  + T HP  L++ P+ K       I L
Sbjct: 124 RVAACALIDPNFKVTRQH-GEFFD----KDGLMMMGTFHPAALLRNPVNKPGALDDFINL 178

Query: 255 KKALKNL 261
           +  L +L
Sbjct: 179 RARLDSL 185


>gi|220935320|ref|YP_002514219.1| phage SPO1 DNA polymerase-related protein [Thioalkalivibrio sp.
           HL-EbGR7]
 gi|219996630|gb|ACL73232.1| phage SPO1 DNA polymerase-related protein [Thioalkalivibrio sp.
           HL-EbGR7]
          Length = 241

 Score = 92.8 bits (229), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 86/182 (47%), Gaps = 7/182 (3%)

Query: 79  ELKSLLRSFHDC-HLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLD 137
           EL + + +   C  L +T   T+        D + IG  P   ++  G+PF G+ G +LD
Sbjct: 63  ELAARVAACSRCGELAATRTQTVFGVGDRQADWLFIGEAPGAEEDRQGEPFVGRAGQLLD 122

Query: 138 KMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
            ML ++ + R + ++I+ I    PPGNR+    E   CR  + RQI+LI P+I++ +G  
Sbjct: 123 SMLFALGLKRGRGVYIANILKCRPPGNRDPKPEEARACRAYLDRQIDLIQPRIIVALGRI 182

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
                   D     + LG+       +  IP + T HP  L++ P  K+  W  L   ++
Sbjct: 183 AAQNLLGTD-----EPLGRLRGKPLNYRDIPLVITYHPAYLLRQPADKRKAWEDLCLARR 237

Query: 257 AL 258
            +
Sbjct: 238 VM 239


>gi|325972111|ref|YP_004248302.1| phage SPO1 DNA polymerase-related protein [Spirochaeta sp. Buddy]
 gi|324027349|gb|ADY14108.1| phage SPO1 DNA polymerase-related protein [Spirochaeta sp. Buddy]
          Length = 249

 Score = 92.8 bits (229), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 86/177 (48%), Gaps = 6/177 (3%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           ++ +L++L+     C LC T    +    +    LM+IG  P   ++ SGKPF GK G  
Sbjct: 63  NVRQLEALVALCTKCRLCETRKQVVFGEGSIPARLMVIGEGPGFEEDASGKPFVGKAGKY 122

Query: 136 LDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           LD  L +I + R+  ++I+ I    PP NR+    E++ C P + RQI+L+ P+I+L +G
Sbjct: 123 LDSWLGAIHMDRSNAVYIANIVKCRPPENRDPEVDEVQACLPYLKRQIQLVKPQIILLVG 182

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
           +                 +GK       +  +P + T HP  +++   +K+  W  L
Sbjct: 183 SVAARSLLG-----VSDGVGKLRGRFLRYEDVPVVVTYHPAAVLRNMELKRPVWDDL 234


>gi|188585122|ref|YP_001916667.1| phage SPO1 DNA polymerase-related protein [Natranaerobius
           thermophilus JW/NM-WN-LF]
 gi|179349809|gb|ACB84079.1| phage SPO1 DNA polymerase-related protein [Natranaerobius
           thermophilus JW/NM-WN-LF]
          Length = 195

 Score = 92.8 bits (229), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 57/180 (31%), Positives = 83/180 (46%), Gaps = 5/180 (2%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
            L  LK       +CHL  T    +     E  D+M+IG  P   ++   +PF G  G +
Sbjct: 9   DLESLKKEALICKNCHLRETCNGVVFGEGDEQADIMLIGEGPGAKEDELQRPFVGPAGEL 68

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           L KML +I   R  ++I+ I    PP NR  +  EM+ C PI+ +QI LI  KI++ +G 
Sbjct: 69  LTKMLAAINFSRDDVYITNIVKCRPPNNRTPNQEEMDTCLPILRQQIRLIQSKIIVILGG 128

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
                  + + + T +  G W         I  L T HP  L++ P  KK +W  L  LK
Sbjct: 129 AALKGLIDKNMKIT-KARGSW----LERKGIHILPTYHPAYLLRNPAKKKESWEDLQNLK 183


>gi|311104684|ref|YP_003977537.1| uracil DNA glycosylase superfamily protein [Achromobacter
           xylosoxidans A8]
 gi|310759373|gb|ADP14822.1| uracil DNA glycosylase superfamily protein [Achromobacter
           xylosoxidans A8]
          Length = 333

 Score = 92.8 bits (229), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 52/180 (28%), Positives = 88/180 (48%), Gaps = 5/180 (2%)

Query: 75  CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
            +L E+   + +   C LC    + +     +    +++G  P + ++  G+PF G++G 
Sbjct: 148 ATLEEMHEQVVACAACGLCKGRRNAVFGHGGQPTRWLVVGEAPGEQEDRQGQPFVGRSGQ 207

Query: 135 MLDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFI 193
           +LD ML S+ + R + + I+ +    PPGNRN    E+  C P +MRQI L+ P+ +L +
Sbjct: 208 LLDAMLSSVSMSRERDVFITNVIKCRPPGNRNPKPEEIAACSPYLMRQIALLKPERILVL 267

Query: 194 GNKTKNFFFNNDAQKTYQNL-GKWSNLCTPHSI-IPTLATVHPQELIQYPLIKKNTWHAL 251
           G          DA  T  +L G+   L T   + IP + + HP  L++ P  K   W  L
Sbjct: 268 GRFAAQTLLGTDA--TIGSLRGRIHQLKTDEGVEIPVVVSYHPAYLLRSPSEKARAWQDL 325


>gi|241662909|ref|YP_002981269.1| phage SPO1 DNA polymerase-like protein [Ralstonia pickettii 12D]
 gi|309782169|ref|ZP_07676899.1| arginine biosynthesis protein ArgJ [Ralstonia sp. 5_7_47FAA]
 gi|240864936|gb|ACS62597.1| phage SPO1 DNA polymerase-related protein [Ralstonia pickettii 12D]
 gi|308919235|gb|EFP64902.1| arginine biosynthesis protein ArgJ [Ralstonia sp. 5_7_47FAA]
          Length = 264

 Score = 92.4 bits (228), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 50/180 (27%), Positives = 87/180 (48%), Gaps = 8/180 (4%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           +L++ + +   C LC    +T+        + M+IG  P + ++  G+PF G+ G +LD 
Sbjct: 83  QLEAAVSNCTSCKLCERRTNTVFGVGDREAEWMLIGEAPGEQEDKQGEPFVGQAGKLLDS 142

Query: 139 MLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN-K 196
           ML+SI + R + + I+ +    PPGNR+    E  +C P + RQI L+ P+I++ +G   
Sbjct: 143 MLRSIGLSREKGVFIANVLKCRPPGNRDPEPDEAAMCDPYLKRQIALVKPRIIVVLGRIA 202

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
            +N        +T   +GK          +P + T HP  L++    K   W  L   +K
Sbjct: 203 AQNLL------QTQTPVGKLRGKVHEVEGVPVVVTYHPAYLLRTLTDKARAWEDLCLARK 256


>gi|42527991|ref|NP_973089.1| DNA polymerase domain-containing protein [Treponema denticola ATCC
           35405]
 gi|41819036|gb|AAS13008.1| DNA polymerase domain protein [Treponema denticola ATCC 35405]
          Length = 264

 Score = 92.4 bits (228), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 60/198 (30%), Positives = 93/198 (46%), Gaps = 21/198 (10%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQ----------DLMIIGYTPSDSDNISG 125
           SL ++ + + S   C LC    +T+     EG           ++M+IG  P   ++  G
Sbjct: 71  SLEKVYAQIASCKACRLCERRHNTVAG---EGPCEFSNFDNKIEVMVIGEGPGADEDAQG 127

Query: 126 KPFSGKTGNMLDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIEL 184
           +PF GK G +LDKML +IE+ RT   +I+ +    PP NR+    E   CR  +  QI L
Sbjct: 128 RPFVGKAGQLLDKMLAAIELYRTHNCYITNVVKCRPPNNRDPLPDETAACRNYLNAQIAL 187

Query: 185 ISPKILLFIGN-KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLI 243
           I PK +L +G    +N        +T + +GK       +  IP +AT HP  L++   +
Sbjct: 188 IRPKAILVVGRVALQNLL------ETQEGIGKMHGKFFEYQNIPLMATYHPSALLRDVNL 241

Query: 244 KKNTWHALITLKKALKNL 261
           K+  W  L   +  L  L
Sbjct: 242 KRPAWEDLKLFRSRLNEL 259


>gi|257094232|ref|YP_003167873.1| phage SPO1 DNA polymerase-like protein [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257046756|gb|ACV35944.1| phage SPO1 DNA polymerase-related protein [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
          Length = 287

 Score = 92.4 bits (228), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 79/185 (42%), Gaps = 5/185 (2%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           EL   + +   C LC      +      G D + IG  P   ++  G+PF G  G +LD 
Sbjct: 94  ELAESVAACRACGLCEQRRQAVLGVGDHGADWLFIGEGPGAEEDARGEPFVGPAGKLLDA 153

Query: 139 MLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT 197
           ML +I++ R   ++I+      PP NR    +EM  C P + RQIELI P++++ +G   
Sbjct: 154 MLAAIDLRRGADVYIANAVKCRPPSNRTPEAVEMVACAPYLRRQIELIQPRLIVLLGRAA 213

Query: 198 KNFFFNNDAQKTYQNLGK---WSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITL 254
            +     D        G+   +         IP + T HP  L++    K   W  L   
Sbjct: 214 AHALL-GDVGSLASLRGRPLEYREGAGGRVAIPVVVTYHPAYLLRTLPDKAKAWEDLCRA 272

Query: 255 KKALK 259
           +  ++
Sbjct: 273 RTVMR 277


>gi|293603947|ref|ZP_06686361.1| family 4 uracil-DNA glycosylase [Achromobacter piechaudii ATCC
           43553]
 gi|292817640|gb|EFF76707.1| family 4 uracil-DNA glycosylase [Achromobacter piechaudii ATCC
           43553]
          Length = 329

 Score = 92.4 bits (228), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 57/196 (29%), Positives = 95/196 (48%), Gaps = 7/196 (3%)

Query: 59  IHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPS 118
           + +P +  A+++  K  +L EL+  + +   C LC      +          +++G  P 
Sbjct: 131 VEAPRIPVAEAV--KNANLDELREQVVACTACGLCQGRRHAVFGHGATPTRWLVVGEAPG 188

Query: 119 DSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPI 177
           + ++  G PF G++G +LD ML ++ + R T + I+ +    PPGNRN    E+  C P 
Sbjct: 189 EQEDRQGHPFVGRSGQLLDAMLAAVGMSRDTDVFITNVIKCRPPGNRNPKPEEIASCSPY 248

Query: 178 IMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNL-GKWSNLCTPH-SIIPTLATVHPQ 235
           +MRQI L+ P+ +L +G          DA  T  +L G+   L T   S IP + + HP 
Sbjct: 249 LMRQIALLKPERILVLGRFAAQTLLGTDA--TIGSLRGRVHTLKTEDGSEIPLIVSYHPA 306

Query: 236 ELIQYPLIKKNTWHAL 251
            L++ P  K   W  L
Sbjct: 307 YLLRSPSEKARAWQDL 322


>gi|312602487|ref|YP_004022332.1| uracil DNA glycosylase superfamily protein [Burkholderia
           rhizoxinica HKI 454]
 gi|312169801|emb|CBW76813.1| Uracil DNA glycosylase superfamily protein [Burkholderia
           rhizoxinica HKI 454]
          Length = 384

 Score = 92.4 bits (228), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 83/173 (47%), Gaps = 6/173 (3%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKM 139
           LK+ +     C LC    +T+     E  D M++G  P ++++  G+PF G+ G +LD M
Sbjct: 203 LKARVAGCTLCRLCERRTNTVFGVGDETADWMLVGEAPGENEDKQGEPFVGQAGKLLDNM 262

Query: 140 LQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTK 198
           L+++++ R   ++I+ +    PPGNRN    E+  C P + RQ+ L+ P +++ +G    
Sbjct: 263 LRALQMRRGDNVYIANVLKCRPPGNRNPQPDEVMRCEPYLKRQVALVKPNVIVALGRFAA 322

Query: 199 NFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
                 DA     ++         +  +P + T HP  L++    K   W  L
Sbjct: 323 QSLLKTDA-----SIASLRGRVHEYEGVPVIVTYHPAYLLRSLHDKHKAWSDL 370


>gi|77165973|ref|YP_344498.1| Phage SPO1 DNA polymerase-related protein [Nitrosococcus oceani
           ATCC 19707]
 gi|254436357|ref|ZP_05049863.1| uracil-DNA glycosylase, family 4 [Nitrosococcus oceani AFC27]
 gi|76884287|gb|ABA58968.1| Phage SPO1 DNA polymerase-related protein [Nitrosococcus oceani
           ATCC 19707]
 gi|207088047|gb|EDZ65320.1| uracil-DNA glycosylase, family 4 [Nitrosococcus oceani AFC27]
          Length = 231

 Score = 92.4 bits (228), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 55/208 (26%), Positives = 93/208 (44%), Gaps = 13/208 (6%)

Query: 62  PLVQQADSI------AQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGY 115
           PLV+  + +      A+ A    EL   + S   C L      T+     +    +I+G 
Sbjct: 29  PLVETGEELIPLAPSAEVASEWEELAVQVASCTACLLHCGRTQTVFGVGDQAAKWLIVGE 88

Query: 116 TPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICR 175
            P   ++  G+PF G+ G +L+ ML+++ + R Q++I+ I    PP NR+    E+  C 
Sbjct: 89  APGVEEDRQGEPFVGRAGQLLNAMLEAVGLQRGQVYIANILKCRPPNNRDPLPEEVAHCE 148

Query: 176 PIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLC--TPHSIIPTLATVH 233
           P + RQ+ L+ P+I+L +G             K+   LG+        P + IP + T H
Sbjct: 149 PYLRRQVALLRPRIILAVGRVAGQNLL-----KSSLPLGRLRGSVHQYPETTIPLVVTYH 203

Query: 234 PQELIQYPLIKKNTWHALITLKKALKNL 261
           P  L++ P  K+  W  L    K  +  
Sbjct: 204 PAYLLRAPREKRRAWQDLQLAHKVYREF 231


>gi|21673047|ref|NP_661112.1| DNA polymerase [Chlorobium tepidum TLS]
 gi|21646115|gb|AAM71454.1| DNA polymerase, bacteriophage-type [Chlorobium tepidum TLS]
          Length = 208

 Score = 92.0 bits (227), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 82/180 (45%), Gaps = 5/180 (2%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
            L EL  +      C L  T  + +         L +IG  P   ++  G+PF G++G +
Sbjct: 24  GLGELCRITVECRKCRLAQTRKNVVFGEGNPQAGLFVIGEAPGADEDAQGRPFVGRSGQL 83

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           LDK+L +I   R  ++I  I    PP NRN    E++ C+P +M+Q+ +I PK+LL +G 
Sbjct: 84  LDKILLAIGFERQDVYIGNIIKCRPPENRNPLADEIDCCKPWLMQQLGIIKPKVLLLLGK 143

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
              N    N      Q++G              + T HP  L++ P  K+  W  +  L+
Sbjct: 144 VAANTILEN-----TQSMGLMRGRIIKWKGFDCVVTYHPAALLRNPNWKRLCWEDVQMLR 198


>gi|238026879|ref|YP_002911110.1| phage SPO1 DNA polymerase-like protein [Burkholderia glumae BGR1]
 gi|237876073|gb|ACR28406.1| Phage SPO1 DNA polymerase-related protein [Burkholderia glumae
           BGR1]
          Length = 362

 Score = 92.0 bits (227), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 50/201 (24%), Positives = 90/201 (44%), Gaps = 6/201 (2%)

Query: 52  PITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLM 111
           P+++  H   P                EL++ +     C LC     T+        D M
Sbjct: 150 PMSDAGHSFEPAEPAVARSPVAGLGWDELEARVAECRRCRLCEKRTRTVFGVGDREADWM 209

Query: 112 IIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIE 170
           +IG  P ++++  G+PF G+ G +LD ML ++ + R + ++I+ +    PPGNRN    E
Sbjct: 210 LIGEAPGENEDKQGEPFVGQAGKLLDSMLHALSLKRGENVYIANVIKCRPPGNRNPEPDE 269

Query: 171 MEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLA 230
           +  C P + RQ+EL+ PK+++ +G      F      K+  ++         +  +P + 
Sbjct: 270 VARCEPYLQRQVELVKPKLIVAMGR-----FAAQTLLKSTGSIASMRGRIHHYEGVPVVV 324

Query: 231 TVHPQELIQYPLIKKNTWHAL 251
           + HP  L++    K   W  L
Sbjct: 325 SYHPAYLLRSLPDKAKAWADL 345


>gi|323526514|ref|YP_004228667.1| phage SPO1 DNA polymerase-like protein [Burkholderia sp. CCGE1001]
 gi|323383516|gb|ADX55607.1| phage SPO1 DNA polymerase-related protein [Burkholderia sp.
           CCGE1001]
          Length = 344

 Score = 92.0 bits (227), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 77/163 (47%), Gaps = 6/163 (3%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-T 148
           C LC      +        D M+IG  P ++++  G+PF G+ G +LD ML+S+ + R  
Sbjct: 160 CRLCEKRTQAVFGVGDRNADWMLIGEAPGENEDRVGEPFVGQAGKLLDNMLRSLTLARGA 219

Query: 149 QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQK 208
            ++I+ +    PPGNRN    E+  C P + RQ+EL+ PK+++ +G          DA  
Sbjct: 220 NVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVELVKPKLIVALGRFAAQSLLKTDA-- 277

Query: 209 TYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
              ++         +  +P + T HP  L++    K   W  L
Sbjct: 278 ---SISSLRGRVHQYEGVPVIVTYHPAYLLRSLPDKAKAWADL 317


>gi|170696493|ref|ZP_02887618.1| phage SPO1 DNA polymerase-related protein [Burkholderia graminis
           C4D1M]
 gi|170138596|gb|EDT06799.1| phage SPO1 DNA polymerase-related protein [Burkholderia graminis
           C4D1M]
          Length = 390

 Score = 92.0 bits (227), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 78/163 (47%), Gaps = 6/163 (3%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-T 148
           C LC     T+        D M+IG  P ++++  G+PF G+ G +LD ML+S+ + R +
Sbjct: 213 CRLCEKRTKTVFGVGDRNADWMLIGEAPGENEDRVGEPFVGQAGKLLDNMLRSLTLARDS 272

Query: 149 QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQK 208
            ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G          DA  
Sbjct: 273 NVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVALVKPKLIVALGRFAAQSLLKTDA-- 330

Query: 209 TYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
              ++         +  +P + T HP  L++    K   W  L
Sbjct: 331 ---SISSLRGRVHEYEGVPVIVTYHPAYLLRSLPDKAKAWADL 370


>gi|145220372|ref|YP_001131081.1| phage SPO1 DNA polymerase-related protein [Prosthecochloris
           vibrioformis DSM 265]
 gi|145206536|gb|ABP37579.1| phage SPO1 DNA polymerase-related protein [Chlorobium
           phaeovibrioides DSM 265]
          Length = 191

 Score = 92.0 bits (227), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 53/186 (28%), Positives = 82/186 (44%), Gaps = 5/186 (2%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           SL  L         C L  T  S +         LM+IG  P   ++ SG+PF G++G +
Sbjct: 5   SLEALAKEADKCRKCRLADTRHSVVFGEGNPEAGLMVIGEAPGADEDASGRPFIGRSGQL 64

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           L K+LQ++E  R ++ I+ I    PP NRN    E+  C P + +Q+E+I PK++L +G 
Sbjct: 65  LTKILQAVEFSRDEVFIANIVKCRPPENRNPLQDEIACCTPWLEKQLEIIRPKVILLLGK 124

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
              N    N        LG                T HP  L++ P  K+     +  ++
Sbjct: 125 VAANTILVNQTA-----LGTMRGKVLEWKGTDCFVTYHPAALLRNPNWKRGCREDVQLMR 179

Query: 256 KALKNL 261
           +   NL
Sbjct: 180 RHYDNL 185


>gi|323701469|ref|ZP_08113142.1| phage SPO1 DNA polymerase-related protein [Desulfotomaculum
           nigrificans DSM 574]
 gi|323533478|gb|EGB23344.1| phage SPO1 DNA polymerase-related protein [Desulfotomaculum
           nigrificans DSM 574]
          Length = 184

 Score = 91.7 bits (226), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 49/174 (28%), Positives = 85/174 (48%), Gaps = 4/174 (2%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           SL +L   ++    C L +   + +         LM+IG  P   ++  G+PF G+ G +
Sbjct: 2   SLEQLALDIQGCTRCGLAAGRTNIVFGDGNPSGKLMLIGEGPGKDEDEQGRPFVGRAGQL 61

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           LD++L +I + R  ++I+ I    PP NR  +  E   C P + RQIELI P+I++ +G+
Sbjct: 62  LDRILAAINLTRQDVYIANIVKCRPPNNRVPTRAEAVACLPYLYRQIELIKPRIIVLLGS 121

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWH 249
                    +A+ T    G+W    +   I+PT    HP  +++ P  ++  W 
Sbjct: 122 TALQNLIGPEARITKMR-GQWLESKSGIKIMPTF---HPAAVLRDPNKRRPVWE 171


>gi|291287466|ref|YP_003504282.1| phage SPO1 DNA polymerase-related protein [Denitrovibrio
           acetiphilus DSM 12809]
 gi|290884626|gb|ADD68326.1| phage SPO1 DNA polymerase-related protein [Denitrovibrio
           acetiphilus DSM 12809]
          Length = 210

 Score = 91.7 bits (226), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 55/201 (27%), Positives = 90/201 (44%), Gaps = 9/201 (4%)

Query: 52  PITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLM 111
           PI  I  +   L Q+ +   +       L   + +   C L  T L+ +        DLM
Sbjct: 8   PIKEIYGVEDVLAQECEQKPEN--PFEALYKEVSTCKKCRLHETRLNIVFGVGDPAADLM 65

Query: 112 IIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEM 171
            +G  P   ++  G PF G+ G +L KM++++   R  ++I+ I    PP NRN    E 
Sbjct: 66  FVGEGPGAEEDKQGIPFVGRAGQLLTKMIEAMGFTRDTVYIANIVKCRPPENRNPFEDES 125

Query: 172 EICRPIIMRQIELISPKILLFIGN-KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLA 230
             C P + RQIE + PK+++ +G+   +NF       KT   + K        + +  + 
Sbjct: 126 NTCIPYLYRQIEYVKPKVIVCLGSVAAQNFL------KTKLGITKIRGEFVELNGVKVMP 179

Query: 231 TVHPQELIQYPLIKKNTWHAL 251
           T HP  L++ P +KK  W  L
Sbjct: 180 TYHPAYLLRNPKMKKPCWEDL 200


>gi|317133620|ref|YP_004092934.1| phage SPO1 DNA polymerase-related protein [Ethanoligenens
           harbinense YUAN-3]
 gi|315471599|gb|ADU28203.1| phage SPO1 DNA polymerase-related protein [Ethanoligenens
           harbinense YUAN-3]
          Length = 192

 Score = 91.7 bits (226), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 94/186 (50%), Gaps = 5/186 (2%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           S  EL++  ++   C L       +  T +   +++ IG  P   +++ G+PF G+ G +
Sbjct: 4   SWDELEAACKACTACGLAEKRTQVVFGTGSREAEVLFIGEGPGQQEDLKGEPFVGRAGQL 63

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           LDKML ++ + R++I+I+ I    PP NR+    E + C P +  Q +L++PKI++ +G 
Sbjct: 64  LDKMLVAVGLDRSKIYIANIVKCRPPQNRDPLPEEQDACLPWLRAQTKLLAPKIIICVGR 123

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
                    D + T ++ G+W         +  +AT+HP  L++ P  K   +   + L+
Sbjct: 124 IAGMKLMKPDLKITREH-GQWFQ----RGHVLMMATLHPAALLRNPNQKPEAFKDFLALR 178

Query: 256 KALKNL 261
             +K +
Sbjct: 179 DKIKEI 184


>gi|78044945|ref|YP_359051.1| uracil-DNA glycosylase [Carboxydothermus hydrogenoformans Z-2901]
 gi|77997060|gb|ABB15959.1| uracil-DNA glycosylase, family 4 [Carboxydothermus hydrogenoformans
           Z-2901]
          Length = 198

 Score = 91.7 bits (226), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 52/176 (29%), Positives = 81/176 (46%), Gaps = 8/176 (4%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQD---LMIIGYTPSDSDNISGKPFSGKTG 133
           + ELK+L      C  C+           EG +   LM++G  P   ++  G+PF G  G
Sbjct: 1   MEELKALKEEALACQRCNLRAHAQRVVFGEGNEKALLMLVGEGPGAEEDRQGRPFVGAAG 60

Query: 134 NMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFI 193
            +L+K+L++  I R +++I  +    PP NR  +  E+  CR  + RQIELI PKI++ +
Sbjct: 61  ELLNKILEAAGISREEVYIGNVVKCRPPNNRVPTREEVAACRTFLDRQIELIKPKIIVCL 120

Query: 194 GNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWH 249
           G          D + T     K   L      I  + T HP  L++ P  K+  W 
Sbjct: 121 GATAAQTLIGPDVRIT-----KIRGLWHEKGEIKIMPTFHPAALLRDPTKKRPAWE 171


>gi|325474785|gb|EGC77971.1| DNA polymerase domain-containing protein [Treponema denticola
           F0402]
          Length = 264

 Score = 91.7 bits (226), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 59/197 (29%), Positives = 90/197 (45%), Gaps = 19/197 (9%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQ----------DLMIIGYTPSDSDNISG 125
           SL ++ + + S   C LC    +T+     EG           ++M+IG  P   ++  G
Sbjct: 71  SLEKVYAQIASCKACRLCERRHNTVAG---EGPCEFSNFDNKIEVMVIGEGPGADEDAQG 127

Query: 126 KPFSGKTGNMLDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIEL 184
           +PF GK G +LDKML +IE+ RT   +I+ +    PP NR+    E   CR  +  QI L
Sbjct: 128 RPFVGKAGQLLDKMLAAIELYRTHNCYITNVVKCRPPNNRDPLPDETAACRNYLNAQIAL 187

Query: 185 ISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIK 244
           I PK +L +G              T + +GK       +  IP +AT HP  L++   +K
Sbjct: 188 IKPKAILVVGRVALQNLLG-----TQEGIGKMHGKFFEYQNIPLMATYHPSALLRDVNLK 242

Query: 245 KNTWHALITLKKALKNL 261
           +  W  L   +  L  L
Sbjct: 243 RPAWEDLKLFRSRLNEL 259


>gi|124265496|ref|YP_001019500.1| putative DNA polymerase-like protein [Methylibium petroleiphilum
           PM1]
 gi|124258271|gb|ABM93265.1| putative DNA polymerase-related protein, bacteriophage-type
           [Methylibium petroleiphilum PM1]
          Length = 260

 Score = 91.7 bits (226), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 48/191 (25%), Positives = 88/191 (46%), Gaps = 15/191 (7%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKM 139
           L++ +     C LC    +T+          M++G  P + ++  G+PF GK G +LD M
Sbjct: 72  LRAAVAGCTACGLCRGRTNTVFGVGHTQAHWMVVGEAPGEQEDRLGEPFVGKAGQLLDHM 131

Query: 140 LQSIEIMRT----------QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKI 189
           LQ++ + R           Q++I+ +    PP NRN    E+  C P + RQ+ L+ P++
Sbjct: 132 LQALGLTRRAEGEGLQPAQQVYIANVLKCRPPMNRNPQPEEVAQCEPYLARQVALLQPRL 191

Query: 190 LLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWH 249
           +L +G      F      +T + +G+       +  +P + T HP  L++ P  K   W 
Sbjct: 192 ILAMGR-----FAVQSLLQTGEPIGRLRGRIHQYQGVPAIVTYHPAYLLRNPADKAKAWD 246

Query: 250 ALITLKKALKN 260
            L   ++ ++ 
Sbjct: 247 DLCLAREVMRG 257


>gi|307729307|ref|YP_003906531.1| phage SPO1 DNA polymerase-related protein [Burkholderia sp.
           CCGE1003]
 gi|307583842|gb|ADN57240.1| phage SPO1 DNA polymerase-related protein [Burkholderia sp.
           CCGE1003]
          Length = 342

 Score = 91.7 bits (226), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 77/163 (47%), Gaps = 6/163 (3%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-T 148
           C LC     T+        D M+IG  P ++++  G+PF G+ G +LD ML+S+ + R  
Sbjct: 166 CRLCEKRTKTVFGVGDREADWMLIGEAPGENEDRVGEPFVGQAGKLLDNMLRSLTLARGA 225

Query: 149 QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQK 208
            ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G          DA  
Sbjct: 226 NVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVALVKPKLIVALGRFAAQSLLKTDA-- 283

Query: 209 TYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
              ++         +  +P + T HP  L++    K   W  L
Sbjct: 284 ---SISSLRGRVHEYEGVPVVVTYHPAYLLRSLPDKAKAWADL 323


>gi|332531590|ref|ZP_08407487.1| putative DNA polymerase-like protein [Hylemonella gracilis ATCC
           19624]
 gi|332038953|gb|EGI75382.1| putative DNA polymerase-like protein [Hylemonella gracilis ATCC
           19624]
          Length = 283

 Score = 91.3 bits (225), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 90/185 (48%), Gaps = 7/185 (3%)

Query: 74  ACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTG 133
           A    +L++ +     C LC +  +T+          +I+G  P +++++ G+PF G+ G
Sbjct: 87  AMGWDDLEAAVAGCQACGLCKSRKNTVFGVGQRQARWLIVGEAPGENEDLQGEPFVGQAG 146

Query: 134 NMLDKMLQSIEIMRT------QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISP 187
            +LD ML+++   RT       ++I+ +    PPGNRN +  E+  C P + RQ+ L+ P
Sbjct: 147 KLLDNMLKTLGRSRTSDDEAQSVYIANVLKCRPPGNRNPAPEEVLQCEPYLRRQVALLQP 206

Query: 188 KILLFIGN-KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKN 246
           +I+L +G    ++   ++        LG+       +  +P + + HP  L++ P  K  
Sbjct: 207 RIILALGRFAVQSLLQHSVPDVATLPLGRLRGQVYRYEGVPVVVSYHPAYLLRTPQDKAK 266

Query: 247 TWHAL 251
            W  L
Sbjct: 267 AWDDL 271


>gi|312793048|ref|YP_004025971.1| phage SPO1 DNA polymerase-like protein [Caldicellulosiruptor
           kristjanssonii 177R1B]
 gi|312876719|ref|ZP_07736698.1| phage SPO1 DNA polymerase-related protein [Caldicellulosiruptor
           lactoaceticus 6A]
 gi|311796450|gb|EFR12800.1| phage SPO1 DNA polymerase-related protein [Caldicellulosiruptor
           lactoaceticus 6A]
 gi|312180188|gb|ADQ40358.1| phage SPO1 DNA polymerase-related protein [Caldicellulosiruptor
           kristjanssonii 177R1B]
          Length = 185

 Score = 91.3 bits (225), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 91/185 (49%), Gaps = 6/185 (3%)

Query: 78  HELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLD 137
            EL+S   S   C +     + +     +   L+ +G  P + ++  GKPF G+ G  LD
Sbjct: 5   EELESACLSCEKCPISKNRTNVVVGDGNKNAKLVFVGEAPGEEEDKQGKPFVGRAGKFLD 64

Query: 138 KMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
             L S+E+ R +  +I  I    PP NR  + +E + C P +  QI+LI+PKI++ +G  
Sbjct: 65  LALTSLELSREKDFYICNILKCRPPNNRVPTEVEAQNCLPFLRAQIKLIAPKIIVCLGAT 124

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
              +    D + T Q+ GKW            +AT HP  L++ P  +++ +  L ++K+
Sbjct: 125 AMKYILGKDLKIT-QDRGKWFE----KGGFWIMATYHPAALLRDPGKREDFYRDLKSVKE 179

Query: 257 ALKNL 261
            L+ +
Sbjct: 180 KLEKI 184


>gi|113868094|ref|YP_726583.1| bacteriophage-type DNA polymerase [Ralstonia eutropha H16]
 gi|113526870|emb|CAJ93215.1| Putative DNA polymerase bacteriophage-type,uracil-DNA glycosylase
           superfamily [Ralstonia eutropha H16]
          Length = 289

 Score = 91.3 bits (225), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 81/168 (48%), Gaps = 6/168 (3%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C LC    +T+        + M++G  P +++++ G+PF G+ G +LD ML ++ + R +
Sbjct: 118 CGLCQHRTNTVFGVGDRQAEWMLVGEAPGENEDLQGEPFVGQAGKLLDNMLGALGLARGR 177

Query: 150 -IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQK 208
            + I+ +    PPGNRN    E+  C P + RQI L+ P +++ +G      F      +
Sbjct: 178 NVFIANVLKCRPPGNRNPEPEEVAQCEPFLRRQIALVKPSVIVVLGR-----FAAQSLLR 232

Query: 209 TYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
           +   +GK       +  IP + T HP  L++    K   W  L   ++
Sbjct: 233 STTPIGKLRGTVHSYEGIPVVVTYHPAYLLRTLTDKARAWEDLCLARE 280


>gi|330817462|ref|YP_004361167.1| Phage SPO1 DNA polymerase-related protein [Burkholderia gladioli
           BSR3]
 gi|327369855|gb|AEA61211.1| Phage SPO1 DNA polymerase-related protein [Burkholderia gladioli
           BSR3]
          Length = 354

 Score = 90.9 bits (224), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 82/174 (47%), Gaps = 6/174 (3%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           EL++ +     C LC     T+        D M++G  P ++++  G+PF G+ G +LD 
Sbjct: 172 ELEARVADCQRCRLCEKRTQTVFGVGDREADWMLVGEAPGENEDKQGEPFVGQAGKLLDS 231

Query: 139 MLQSIEIMRT-QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT 197
           ML ++ + R+  ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G   
Sbjct: 232 MLHALSLERSNNVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVALVKPKLIVALGRFA 291

Query: 198 KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
                 +D      ++         +  +P + + HP  L++    K   W  L
Sbjct: 292 AQTLLKSDG-----SIASMRGRVHQYEGVPVIVSYHPAYLLRSLPDKSKAWADL 340


>gi|297616747|ref|YP_003701906.1| phage SPO1 DNA polymerase-related protein [Syntrophothermus
           lipocalidus DSM 12680]
 gi|297144584|gb|ADI01341.1| phage SPO1 DNA polymerase-related protein [Syntrophothermus
           lipocalidus DSM 12680]
          Length = 228

 Score = 90.9 bits (224), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 54/201 (26%), Positives = 98/201 (48%), Gaps = 8/201 (3%)

Query: 62  PLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSD 121
           P V++ +S  + + SL EL +   +   C L S     +     +  DLM++G  P   +
Sbjct: 29  PGVKREESFLEIS-SLEELAARAGACSRCRLRSGCRQVVFGEGDQKADLMLVGEGPGQVE 87

Query: 122 NISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQ 181
           +  G+PF G  G +LD++L++  I R +++I+ I    PPGNR  +  E+  CR  +  Q
Sbjct: 88  DEQGRPFVGPAGQLLDRILEACAIRRDEVYITNIVKCRPPGNRLPNPDEVAACRGWLEAQ 147

Query: 182 IELISPKILLFIGNKTKNFFFNNDAQKTYQNL-GKWSNLCTPHSIIPTLATVHPQELIQY 240
           I L+SP+I++ +G          +A+ T   + G+W         +  +A  HP  L++ 
Sbjct: 148 IRLMSPRIIVCLGLLATRTVI--EAKATMAGIHGQWFK----RGDVWMMAVYHPAALLRD 201

Query: 241 PLIKKNTWHALITLKKALKNL 261
           P +K+  W     ++   + L
Sbjct: 202 PRLKRPAWEDFKLIRDKYQQL 222


>gi|222529822|ref|YP_002573704.1| phage SPO1 DNA polymerase-related protein [Caldicellulosiruptor
           bescii DSM 6725]
 gi|222456669|gb|ACM60931.1| phage SPO1 DNA polymerase-related protein [Caldicellulosiruptor
           bescii DSM 6725]
          Length = 185

 Score = 90.9 bits (224), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 91/185 (49%), Gaps = 6/185 (3%)

Query: 78  HELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLD 137
            EL++   S   C +     + +     +   L+ +G  P + ++  GKPF G+ G  LD
Sbjct: 5   EELENACLSCEKCPISKNRTNVVVGDGNKNAKLVFVGEAPGEEEDKQGKPFVGRAGKFLD 64

Query: 138 KMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
             L S+E+ R +  +I  I    PP NR  + +E + C P +  QI+LISPKI++ +G  
Sbjct: 65  LALASLELSREKDFYICNILKCRPPNNRVPTELEAQNCLPFLRAQIKLISPKIIVCLGAT 124

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
              +    D + T Q+ GKW            +AT HP  L++ P  +++ +  L ++K+
Sbjct: 125 AMKYILGKDLKIT-QDRGKWFE----KGSFLIMATYHPAALLRDPGKREDFYRDLKSVKE 179

Query: 257 ALKNL 261
            L+ +
Sbjct: 180 RLEKI 184


>gi|193215644|ref|YP_001996843.1| phage SPO1 DNA polymerase-like protein [Chloroherpeton thalassium
           ATCC 35110]
 gi|193089121|gb|ACF14396.1| phage SPO1 DNA polymerase-related protein [Chloroherpeton
           thalassium ATCC 35110]
          Length = 208

 Score = 90.9 bits (224), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 83/187 (44%), Gaps = 9/187 (4%)

Query: 72  QKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGK 131
           QK  +L  L    +    C L       +     E   L++IG  P   ++  G+PF G+
Sbjct: 22  QKYKTLSALYDATKDCKKCQLGELRTKYVFGEGNERAKLVLIGEAPGADEDAQGRPFVGR 81

Query: 132 TGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILL 191
           +G +L K++++I   R +I+I  I    PP NR     E+  C P + RQ+E+I PKI+L
Sbjct: 82  SGQLLTKIMEAIHFSREEIYICNILKCRPPNNREPQADEVAACLPHLYRQLEIIKPKIIL 141

Query: 192 FIGNKTKNFFFNNDAQKTYQN--LGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWH 249
            +G    N    N    +     + KW N            T HP  L++ P  K+  W 
Sbjct: 142 ALGRVAANVLLENKQSMSAMRGKVIKWRN-------SDVFVTYHPAALLRNPNWKRLCWE 194

Query: 250 ALITLKK 256
            +  LK+
Sbjct: 195 DVQALKR 201


>gi|251772271|gb|EES52841.1| Uracil-DNA glycosylase, family 4 [Leptospirillum ferrodiazotrophum]
          Length = 251

 Score = 90.9 bits (224), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 52/175 (29%), Positives = 84/175 (48%), Gaps = 5/175 (2%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEGQD---LMIIGYTPSDSDNISGKPFSGKTGNML 136
           L+SL +   +C LC  S +   A   EG     LM +G  P   ++ SG+PF G+ G +L
Sbjct: 67  LESLAKVVSECRLCVLSSTRTFAVFGEGNPDARLMFVGEGPGADEDASGRPFVGRAGELL 126

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
            +M+ ++   R  ++I+ +    PPGNR     E   C P + RQI LISPK ++ +G  
Sbjct: 127 TRMIGAMGYRREDVYIANVVKCRPPGNRVPEESERASCLPYLKRQIGLISPKAMVLLGQT 186

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
                 + + +   +  G+ ++L      I  + T HP  L++ P  K   W  L
Sbjct: 187 AAVSLLSRN-EGISRLRGRETSLPE-FPGIRVMPTYHPAYLLRNPAAKAQVWEDL 239


>gi|312127133|ref|YP_003992007.1| phage SPO1 DNA polymerase-like protein [Caldicellulosiruptor
           hydrothermalis 108]
 gi|311777152|gb|ADQ06638.1| phage SPO1 DNA polymerase-related protein [Caldicellulosiruptor
           hydrothermalis 108]
          Length = 188

 Score = 90.9 bits (224), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 91/185 (49%), Gaps = 6/185 (3%)

Query: 78  HELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLD 137
            EL++   S   C +     + +     +   L+ +G  P + ++  GKPF G+ G  LD
Sbjct: 5   EELENACLSCEKCPISKNRTNVVVGDGNKNAKLVFVGEAPGEEEDKQGKPFVGRAGKFLD 64

Query: 138 KMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
             L S+E+ R +  +I  I    PP NR  + +E + C P +  QI+LISPKI++ +G  
Sbjct: 65  LALTSLELSREKDFYICNILKCRPPNNRVPTEVEAQNCLPFLRAQIKLISPKIIVCLGAT 124

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
              +    D + T Q+ GKW            +AT HP  L++ P  +++ +  L ++K+
Sbjct: 125 AMKYILGKDLKIT-QDRGKWFE----KGNFLIMATYHPAALLRDPGKREDFYRDLKSVKE 179

Query: 257 ALKNL 261
            L+ +
Sbjct: 180 RLEKI 184


>gi|224372523|ref|YP_002606895.1| uracil-DNA glycosylase [Nautilia profundicola AmH]
 gi|223588852|gb|ACM92588.1| uracil-DNA glycosylase [Nautilia profundicola AmH]
          Length = 210

 Score = 90.5 bits (223), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 57/186 (30%), Positives = 92/186 (49%), Gaps = 13/186 (6%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQ---DLMIIGYTPSDSDNISGKPFSGKTGNM 135
           EL  L +   +C LC  S +       EG    DLM IG  P   ++ +G+PF G+ G +
Sbjct: 32  ELDELEKICLNCTLCDLSKTRTHVVFGEGNPNADLMFIGEGPGAEEDKTGRPFVGRAGKL 91

Query: 136 LDKM-LQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           L K+ L  +E+ R  ++I+ I    PP NR  +  E E C+P +++QI++I+PKIL+ +G
Sbjct: 92  LTKIILNVLELTREDVYIANIVKCRPPNNRVPTIEEAETCKPYLLKQIDIINPKILVCLG 151

Query: 195 NKTKNFFFNNDA--QKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALI 252
                +  N D    K    + ++        +IPT    HP  L++ P  KK  +   +
Sbjct: 152 KTAFMYLMNTDMPISKVRGQIFEFKE----KKVIPTF---HPSFLLRNPSAKKEAYKDFL 204

Query: 253 TLKKAL 258
            +K  L
Sbjct: 205 LIKSML 210


>gi|304315599|ref|YP_003850744.1| phage SPO1 DNA polymerase-related protein [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302777101|gb|ADL67660.1| phage SPO1 DNA polymerase-related protein [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 185

 Score = 90.5 bits (223), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 54/189 (28%), Positives = 90/189 (47%), Gaps = 8/189 (4%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQ---DLMIIGYTPSDSDNISGKPFSGKT 132
           SL  LK L+    +C  C            EG     +M IG  P   ++I G+PF GK 
Sbjct: 2   SLLPLKQLMEECMNCTKCPLHNVRNNVVFGEGNLRSKIMFIGEGPGRDEDIQGRPFVGKA 61

Query: 133 GNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLF 192
           G +L+KM+++I++ R  ++I+ I    PP NR     E++ C P +  Q+ +I+PKI++ 
Sbjct: 62  GQLLNKMIEAIDLKREDVYIANIVKCRPPNNRVPLQNEVDACLPYLRNQVAIIAPKIIVC 121

Query: 193 IGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALI 252
           +G        + + + T    GKW         +  +AT HP  L++ P  K   W    
Sbjct: 122 LGATAAKAIIDKNFKITVMR-GKW----IERKGVKIIATYHPAALLRDPEKKYPAWEDFK 176

Query: 253 TLKKALKNL 261
           ++K  L+ +
Sbjct: 177 SIKNELEKV 185


>gi|222056605|ref|YP_002538967.1| phage SPO1 DNA polymerase-related protein [Geobacter sp. FRC-32]
 gi|221565894|gb|ACM21866.1| phage SPO1 DNA polymerase-related protein [Geobacter sp. FRC-32]
          Length = 256

 Score = 90.5 bits (223), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 95/191 (49%), Gaps = 5/191 (2%)

Query: 68  DSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKP 127
           D ++ +  +L +++  L +   C L  T  + +         L+ +G  P   +++ G+P
Sbjct: 65  DPVSAEKETLDKVRLDLGNCTRCGLSGTRTNLVFGIGNPAARLVFVGEAPGRDEDLQGEP 124

Query: 128 FSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISP 187
           F G+ G +L K++ +++  R+ ++I  I    PPGNRN    E+E C+P ++RQ+  ++P
Sbjct: 125 FVGEAGQLLTKIIGAMQFKRSDVYICNILKCRPPGNRNPQQEEIEQCQPFLLRQLHAVNP 184

Query: 188 KILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNT 247
           + ++ +G      F      +T + + K       +  IP + T HP  L++ P +K+  
Sbjct: 185 EAIVCLGT-----FAAQTLLQTKEPISKLRGRFHDYHGIPLMPTFHPAFLLRNPAMKREV 239

Query: 248 WHALITLKKAL 258
           W  +  + + L
Sbjct: 240 WEDMQKVMRLL 250


>gi|325294639|ref|YP_004281153.1| phage SPO1 DNA polymerase-related protein [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325065087|gb|ADY73094.1| phage SPO1 DNA polymerase-related protein [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 222

 Score = 90.5 bits (223), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 74/132 (56%), Gaps = 2/132 (1%)

Query: 63  LVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDN 122
           +V++ +S  QK   L +LK  + +   C LC T  + +        +LM IG  P + ++
Sbjct: 28  MVKKEESSLQK--ELEKLKEEVLNCCKCRLCKTRTNVVFGEGDTTTNLMFIGEAPGEQED 85

Query: 123 ISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQI 182
           + G+PF G+ G +L + L    I R +I I+ +    PPGNRN +  E++ C P + +QI
Sbjct: 86  LQGRPFVGRAGQLLTRFLNLYGISRDKIFITNVVKCRPPGNRNPAQDEIKSCYPFLEKQI 145

Query: 183 ELISPKILLFIG 194
           E+I PK++L +G
Sbjct: 146 EIIKPKVILCLG 157


>gi|297623507|ref|YP_003704941.1| phage SPO1 DNA polymerase-like protein [Truepera radiovictrix DSM
           17093]
 gi|297164687|gb|ADI14398.1| phage SPO1 DNA polymerase-related protein [Truepera radiovictrix
           DSM 17093]
          Length = 219

 Score = 90.5 bits (223), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 88/177 (49%), Gaps = 10/177 (5%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
             L   S + +        D++I+G  P + +++ G+PF G+ G +LD++L+S  I R  
Sbjct: 30  AALAELSDNLVFGEGNPDADVVIVGEAPGEDEDLLGRPFVGRAGQLLDRILESAHIERED 89

Query: 150 IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKT 209
           ++I+ I  + PPGNRN    E+E   P+++ Q+ LI P+I+  +GN    +F       T
Sbjct: 90  VYITNILKYRPPGNRNPKPEEIEASAPLLLEQLRLIRPQIIATLGNFPTQYFAGTKEGIT 149

Query: 210 YQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNT-----WHALITLKKALKNL 261
            +  G+W +    H +       HP  L++ P  ++ +     W  +  LK A+  L
Sbjct: 150 -KTRGRWFSW---HGVR-VFPMFHPAYLLRNPSRERGSPKWLMWQDIRALKAAIDEL 201


>gi|330991819|ref|ZP_08315768.1| phage SPO1 DNA polymerase-like protein [Gluconacetobacter sp.
           SXCC-1]
 gi|329760840|gb|EGG77335.1| phage SPO1 DNA polymerase-like protein [Gluconacetobacter sp.
           SXCC-1]
          Length = 215

 Score = 90.5 bits (223), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 58/195 (29%), Positives = 95/195 (48%), Gaps = 10/195 (5%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L EL + +R F  C L  T+  ++     +G  LM+IG  P   ++ SG PF+G++G +
Sbjct: 18  TLAELHAAMRDFSACPLRETATHSVGVEGPQGAPLMLIGEAPDADEDRSGHPFAGESGAL 77

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           +  M  SI I    +  + + PW PPG R     E  IC P I R I L  P  ++ +GN
Sbjct: 78  VGAMFASIGIAWDSLLRAPVIPWRPPGGRPPYEAETRICLPFIQRAIILARPAHVIVMGN 137

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTP-HSI--------IPTLATVHPQELIQYPLIKKN 246
              +      A       G+W +L  P H +        +P LA  HPQ+L      +++
Sbjct: 138 LPVSLLLEGGATAARMR-GRWRSLTLPAHGLPPTASAPSVPVLAMRHPQQLRASATARRD 196

Query: 247 TWHALITLKKALKNL 261
           TW  ++++++ L N+
Sbjct: 197 TWRDMLSIRETLGNM 211


>gi|119898004|ref|YP_933217.1| DNA-directed DNA polymerase [Azoarcus sp. BH72]
 gi|119670417|emb|CAL94330.1| DNA-directed DNA polymerase [Azoarcus sp. BH72]
          Length = 283

 Score = 90.1 bits (222), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 82/181 (45%), Gaps = 6/181 (3%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           EL++ +R+   C LC      +         +M +G  P   ++  G+PF G+ G +LD 
Sbjct: 103 ELEADIRACTACALCQRRKQAVPGVGDREARVMFVGEGPGAEEDQRGEPFVGQAGKLLDN 162

Query: 139 MLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT 197
           ML +I + R + ++I+      PP NR     E+  C P + RQI L+ P++L+ +G   
Sbjct: 163 MLAAIGLRRGEGVYIANSVKCRPPLNRTPEAGEIATCLPYLERQIALVQPRLLVALGRPA 222

Query: 198 KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKA 257
                + +   T     K        + IP L T HP  L++ P  K   W  L  +++ 
Sbjct: 223 AQSLLDTEIAIT-----KARGRAFERAGIPVLVTYHPAYLLRNPQDKAKAWEDLCLVRRT 277

Query: 258 L 258
           L
Sbjct: 278 L 278


>gi|149174697|ref|ZP_01853322.1| DNA polymerase, bacteriophage-type [Planctomyces maris DSM 8797]
 gi|148846391|gb|EDL60729.1| DNA polymerase, bacteriophage-type [Planctomyces maris DSM 8797]
          Length = 295

 Score = 90.1 bits (222), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 84/180 (46%), Gaps = 9/180 (5%)

Query: 79  ELKSLLRSFHDCHLC----STSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
           EL  L      C  C     T   T+         +M IG  P   ++  G+PF G+ G 
Sbjct: 109 ELDILATQVSKCTRCPELAETRTQTVFGVGNPRAKIMFIGEAPGADEDKQGEPFVGRAGK 168

Query: 135 MLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           +LDK++++ ++ R+ I+I+ I    PPGNRN +++E   CR  +  QIE++ P  ++  G
Sbjct: 169 LLDKIIEACQMKRSDIYIANILRCRPPGNRNPTDLEASNCRGYLDAQIEIVDPDYIVCWG 228

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITL 254
           +       ++D       +GK       +     + T HP  L++ P  KKN W  +I L
Sbjct: 229 SVAAKNLLHSDLP-----IGKMRGDFYEYGRAKVVCTYHPSYLLRNPSAKKNVWEDMIYL 283


>gi|299139044|ref|ZP_07032221.1| phage SPO1 DNA polymerase-related protein [Acidobacterium sp.
           MP5ACTX8]
 gi|298599198|gb|EFI55359.1| phage SPO1 DNA polymerase-related protein [Acidobacterium sp.
           MP5ACTX8]
          Length = 332

 Score = 90.1 bits (222), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 50/193 (25%), Positives = 93/193 (48%), Gaps = 8/193 (4%)

Query: 61  SPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTIC-ATQTEGQDLMIIGYTPSD 119
           +PL  Q    A++  +L  +++ +     C L      TI  A       LM +G  P  
Sbjct: 131 APLPTQILPAAERPAALEAIRADIGDCTRCPLAYAGRHTIVFADGDPNAKLMFVGEGPGA 190

Query: 120 SDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIM 179
            ++ SG PF GK G +L+ M++++ + R +++I+ I    PPGNR    IE   C   ++
Sbjct: 191 DEDASGLPFVGKAGQLLNNMIKAMGLQREEVYIANIVKCRPPGNRTPEPIEANTCSQFLL 250

Query: 180 RQIELISPKILLFIGNKTKNFFFNNDAQKTYQNL-GKWSNLCTPHSIIPTLATVHPQELI 238
           RQI+++ P++++ +G     +      +++  +L G+W +      ++    T HP  L+
Sbjct: 251 RQIDIVRPQVIVALGGTAATYLLG--VKQSLSSLRGRWHSTRGSKLVV----TYHPAFLL 304

Query: 239 QYPLIKKNTWHAL 251
           + P  K   W  L
Sbjct: 305 RDPRQKGEAWKDL 317


>gi|329890553|ref|ZP_08268896.1| uracil-DNA glycosylase [Brevundimonas diminuta ATCC 11568]
 gi|328845854|gb|EGF95418.1| uracil-DNA glycosylase [Brevundimonas diminuta ATCC 11568]
          Length = 282

 Score = 90.1 bits (222), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 64/252 (25%), Positives = 111/252 (44%), Gaps = 15/252 (5%)

Query: 18  FYADSGVYWVFD-EPNNEATYESQRKEKSIDSAIQPITNIRHIHSP-----LVQQADSIA 71
           F+ D+GV   F+ EP +   + +    K   +    IT +R   +P        +A  +A
Sbjct: 30  FWRDAGVDACFEAEPVDRTVFVAPVAAKGPAT----ITPLRAPGAPPSVDEAAVEARRLA 85

Query: 72  QKACSLHELKSLLRSFHDCHLCS-TSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSG 130
             A +L EL   + +F  C L +  +  ++ A       LMI+G  P   +++ G+PF G
Sbjct: 86  ACATTLDELAEAVAAFEGCPLRAMGARQSVFARGNPQGSLMIVGEGPGAEEDVRGQPFVG 145

Query: 131 KTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKIL 190
           + G +LD++L +  ++      + +  W  PGNR  +  E  +C P + R   L+ PK +
Sbjct: 146 QAGQLLDRILTAAGLLDDAFITNTVF-WKTPGNRTPTPQEQAVCAPFLERAAALLKPKAV 204

Query: 191 LFIGNKTKNFFFNNDAQKTYQNLGKWS--NLCTPHSIIPTLATVHPQELIQYPLIKKNTW 248
           L +G          D     +  G+W    L       P +AT+HP  L++ P  K   W
Sbjct: 205 LLVGAAAAKAVLKTD-DGIMRTRGQWREWRLSEDGIAAPVMATLHPAFLLRQPQAKGLVW 263

Query: 249 HALITLKKALKN 260
             ++ L   L+ 
Sbjct: 264 KDILDLSARLRG 275


>gi|292490788|ref|YP_003526227.1| phage SPO1 DNA polymerase-related protein [Nitrosococcus halophilus
           Nc4]
 gi|291579383|gb|ADE13840.1| phage SPO1 DNA polymerase-related protein [Nitrosococcus halophilus
           Nc4]
          Length = 231

 Score = 90.1 bits (222), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 51/190 (26%), Positives = 86/190 (45%), Gaps = 7/190 (3%)

Query: 74  ACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTG 133
           A    EL + +     C L  +   T+          +I+G  P   ++  G+PF G+ G
Sbjct: 47  APGWEELAARVAGCTACSLHCSRTQTVFGVGDREAKWLIVGEAPGADEDRQGEPFVGRAG 106

Query: 134 NMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFI 193
            +L+ ML+++ + R Q++I+ I    PP NR+    E+  C P +  Q+ L+ P+I+L +
Sbjct: 107 QLLNAMLEALGLQRGQVYIANILKCRPPKNRDPLPEEVASCEPYLRHQMALLQPRIILAV 166

Query: 194 GNKTKNFFFNNDAQKTYQNLGKWSNLC--TPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
           G             KT   LG+   +    P + IP + T HP  L++ P  K+  W  L
Sbjct: 167 GRVAGQNLL-----KTSAPLGRLRGIVHKYPDTTIPLVVTYHPAYLLRSPREKRRAWQDL 221

Query: 252 ITLKKALKNL 261
               K  + L
Sbjct: 222 RLALKVYREL 231


>gi|319790238|ref|YP_004151871.1| phage SPO1 DNA polymerase-related protein [Thermovibrio
           ammonificans HB-1]
 gi|317114740|gb|ADU97230.1| phage SPO1 DNA polymerase-related protein [Thermovibrio
           ammonificans HB-1]
          Length = 235

 Score = 90.1 bits (222), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 73/152 (48%), Gaps = 21/152 (13%)

Query: 43  EKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICA 102
           E  ++ A  PI  +  +           AQK C              C LC T  + +  
Sbjct: 36  EGVVERAFDPIEELEKVKEE--------AQKCCK-------------CRLCKTRHNVVFG 74

Query: 103 TQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPG 162
                 +LM +G  P + +++ G+PF G+ G +L K L    + R QI+I+ +    PP 
Sbjct: 75  EGDPQTNLMFVGEAPGEQEDLQGRPFVGRAGQLLSKFLNLYGVTRDQIYITNVLKCRPPN 134

Query: 163 NRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           NR+ +  E+E C P + +QIELISPK++L +G
Sbjct: 135 NRDPAPDEIEACYPFLEKQIELISPKVILCLG 166


>gi|162455919|ref|YP_001618286.1| DNA-directed DNA polymerase [Sorangium cellulosum 'So ce 56']
 gi|161166501|emb|CAN97806.1| DNA-directed DNA polymerase [Sorangium cellulosum 'So ce 56']
          Length = 215

 Score = 90.1 bits (222), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 50/194 (25%), Positives = 89/194 (45%), Gaps = 7/194 (3%)

Query: 68  DSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKP 127
           D+  ++A  L  L   +R+   C L      T+ +      +++ +G  P   +++ G+P
Sbjct: 21  DTKEERAARLSLLAEEVRTCQKCPLHEGRTHTVFSRGDPSSEVVFVGEGPGAEEDLQGQP 80

Query: 128 FSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISP 187
           F G  G +LDKM+ ++   R +++I  I    PP NR     EM  C P +  Q+ LI P
Sbjct: 81  FVGAAGQLLDKMIAAMGYHRDEVYICNIVKCRPPKNRKPEPAEMAACSPYLTAQLALIKP 140

Query: 188 KILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNT 247
           K+++ +G           ++   +  G W         IP + T HP  L++ P  K+  
Sbjct: 141 KVIVALGATAVQGLIGT-SEGITKLRGTWKLY---KGSIPIMPTFHPAYLLRQPSAKREV 196

Query: 248 WHALITLKKALKNL 261
           W     LK+ +++L
Sbjct: 197 WS---DLKEVMRHL 207


>gi|114777353|ref|ZP_01452350.1| phage SPO1 DNA polymerase domain protein [Mariprofundus
           ferrooxydans PV-1]
 gi|114552135|gb|EAU54637.1| phage SPO1 DNA polymerase domain protein [Mariprofundus
           ferrooxydans PV-1]
          Length = 252

 Score = 90.1 bits (222), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 52/195 (26%), Positives = 86/195 (44%), Gaps = 7/195 (3%)

Query: 67  ADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGK 126
           AD++  K  SL EL +   +   C L  T    +        DL+ IG  P   +++ G+
Sbjct: 62  ADTVVFK--SLDELSATASTCRLCSLADTRTQVVFGVGNPQADLVFIGEAPGRDEDLQGE 119

Query: 127 PFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELIS 186
           PF G+ G +LD+M+ +I + R  ++I       PP NR+    E++ C     +Q++ + 
Sbjct: 120 PFVGRAGQLLDRMMAAIGLDRDAVYIMNTIKCRPPNNRDPRADEVKACNLWFEQQLDALQ 179

Query: 187 PKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKN 246
           PK++  +G          DA      LG        +  IP   T HP  L++ P  K+ 
Sbjct: 180 PKMICLLGRVAAQTVLGTDA-----TLGALRGAWHEYHGIPVWVTYHPAYLLRSPQQKQK 234

Query: 247 TWHALITLKKALKNL 261
            W  L  L    ++L
Sbjct: 235 GWQDLCLLADRYRDL 249


>gi|302872283|ref|YP_003840919.1| phage SPO1 DNA polymerase-related protein [Caldicellulosiruptor
           obsidiansis OB47]
 gi|302575142|gb|ADL42933.1| phage SPO1 DNA polymerase-related protein [Caldicellulosiruptor
           obsidiansis OB47]
          Length = 185

 Score = 89.7 bits (221), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 91/185 (49%), Gaps = 6/185 (3%)

Query: 78  HELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLD 137
            EL++   S   C +     + +     +   L+ +G  P + ++  GKPF G+ G  LD
Sbjct: 5   EELENACISCEKCPISKNRTNVVVGDGNKNAKLVFVGEAPGEEEDKQGKPFVGRAGKFLD 64

Query: 138 KMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
             L S+E+ R +  +I  I    PP NR  + +E + C P +  QI+LISPKI++ +G  
Sbjct: 65  LALTSLELSREKDFYICNILKCRPPNNRVPTEVEAQNCLPFLKAQIKLISPKIIVCLGAT 124

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
              +    D + T Q+ GKW            +AT HP  L++ P  +++ +  L ++K+
Sbjct: 125 AMKYILGKDLKIT-QDRGKWFE----KGGFWIMATYHPAALLRDPGKREDFYRDLKSVKE 179

Query: 257 ALKNL 261
            L+ +
Sbjct: 180 RLEKI 184


>gi|312135590|ref|YP_004002928.1| phage SPO1 DNA polymerase-like protein [Caldicellulosiruptor
           owensensis OL]
 gi|311775641|gb|ADQ05128.1| phage SPO1 DNA polymerase-related protein [Caldicellulosiruptor
           owensensis OL]
          Length = 185

 Score = 89.7 bits (221), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 53/185 (28%), Positives = 90/185 (48%), Gaps = 6/185 (3%)

Query: 78  HELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLD 137
            EL++   S   C +     + +     +   L+ +G  P + ++  GKPF G+ G  LD
Sbjct: 5   EELENACISCEKCPISKNRTNVVVGDGNKNAKLVFVGEAPGEEEDKQGKPFVGRAGKFLD 64

Query: 138 KMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
             L S+E+ R +  +I  I    PP NR  +  E + C P +  QI+LISPKI++ +G  
Sbjct: 65  LALTSLELSREKDFYICNILKCRPPNNRVPTEAEAQNCLPFLRAQIKLISPKIIVCLGAT 124

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
              +    D + T Q+ GKW            +AT HP  L++ P  +++ +  L ++K+
Sbjct: 125 AMKYILGKDLKIT-QDRGKWFE----KGGFWIMATYHPAALLRDPGKREDFYRDLKSVKQ 179

Query: 257 ALKNL 261
            L+ L
Sbjct: 180 KLEKL 184


>gi|149194079|ref|ZP_01871177.1| Uracil-DNA glycosylase [Caminibacter mediatlanticus TB-2]
 gi|149136032|gb|EDM24510.1| Uracil-DNA glycosylase [Caminibacter mediatlanticus TB-2]
          Length = 214

 Score = 89.7 bits (221), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 56/187 (29%), Positives = 97/187 (51%), Gaps = 13/187 (6%)

Query: 78  HELKSLLRSFHDCHLCSTSLSTICATQTEGQ---DLMIIGYTPSDSDNISGKPFSGKTGN 134
           +ELK L     +C LC  S +       EG     LM IG  P + ++ +G+PF G+ G 
Sbjct: 35  NELKELENICKNCTLCDLSKTRTNIVFGEGNPKAKLMFIGEGPGEMEDKTGRPFVGRAGK 94

Query: 135 MLDKMLQSI-EIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFI 193
           +L K+++++ E+ R  ++I+ I    PP NR  +  E E C+P +++QI++I+PKIL+ +
Sbjct: 95  LLTKIIENVLELSREDVYIANIVKCRPPNNRVPTIEEAESCKPYLIKQIDIINPKILVCL 154

Query: 194 GNKTKNFFFNND--AQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
           G     +  NN+    K    + ++        +IPT    HP  L++ P  KK  +   
Sbjct: 155 GKTAFMYLMNNNIPISKIRGQIFEYKG----KKVIPTY---HPSFLLRNPSAKKEAYKDF 207

Query: 252 ITLKKAL 258
           + +K+ L
Sbjct: 208 LLIKELL 214


>gi|85859396|ref|YP_461598.1| uracil DNA glycosylase superfamily protein [Syntrophus
           aciditrophicus SB]
 gi|85722487|gb|ABC77430.1| uracil DNA glycosylase superfamily protein [Syntrophus
           aciditrophicus SB]
          Length = 263

 Score = 89.7 bits (221), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 59/262 (22%), Positives = 109/262 (41%), Gaps = 8/262 (3%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIH 60
           M    IL  E    +        + W    P +  T E  +K   +   +    + + + 
Sbjct: 4   MNESDILKDELYTLVRSLKNQIELAWELRHPLSWTTAEGDQKSPFLGMKLASGVHEQDVK 63

Query: 61  SPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQ---DLMIIGYTP 117
             L+  +D        L  L  + R    CH C    +       EG    +L+ +G  P
Sbjct: 64  ESLIS-SDITGPADNPLETLDDIRRDMEACHRCPLEKTRKNLVFGEGNPHSELVFVGEAP 122

Query: 118 SDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPI 177
              +++ G+PF G+ G++L +++ ++ + R  ++I  I    PPGNRN    E+E+C P 
Sbjct: 123 GADEDLQGRPFVGRAGHLLTRIIDAMGLKREDVYICNILKCRPPGNRNPLPEEIEVCEPW 182

Query: 178 IMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQEL 237
           ++RQ+E I P+I+  +G                   G++ +    +  I  + T HP  L
Sbjct: 183 LIRQLEAIRPRIICALGTFAAQTLLKKKGIPITVLRGQFHD----YHGIKLMPTYHPAYL 238

Query: 238 IQYPLIKKNTWHALITLKKALK 259
           ++ P  K+  W  +  + K L+
Sbjct: 239 LRNPGAKRQVWEDVQKIMKVLE 260


>gi|328953988|ref|YP_004371322.1| phage SPO1 DNA polymerase-related protein [Desulfobacca acetoxidans
           DSM 11109]
 gi|328454312|gb|AEB10141.1| phage SPO1 DNA polymerase-related protein [Desulfobacca acetoxidans
           DSM 11109]
          Length = 251

 Score = 89.7 bits (221), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 50/204 (24%), Positives = 99/204 (48%), Gaps = 12/204 (5%)

Query: 51  QPITNIRHIHSP--LVQQADSIA-QKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEG 107
           +P+     I +P   +Q A  +  Q+  +L E+++ L     C L  T    +       
Sbjct: 41  EPVVKSESIPAPELTLQPASEVPPQEVITLEEVRAELGDCQRCKLWRTRTHLVFGAGDPH 100

Query: 108 QDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLS 167
             L+ IG  P ++++  G+PF G+ G +L+++L  +EI R +++I+ I+   PP NR   
Sbjct: 101 ARLVFIGEAPGEAEDRQGEPFVGRAGQLLNRLLSKLEISRQEVYITNINKCRPPNNRTPE 160

Query: 168 NIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDA--QKTYQNLGKWSNLCTPHSI 225
             E+  CRP + +Q++ I P++++ +G    +      A   +   +  +W  +    ++
Sbjct: 161 ADEIAACRPFLWKQLQAIRPQVIVTLGAVAIHALLETKAPLNRLRGHWQQWRGI----AV 216

Query: 226 IPTLATVHPQELIQYPLIKKNTWH 249
           +PT    HP  L++ P  +  TW 
Sbjct: 217 MPTF---HPSYLLRVPQERVKTWE 237


>gi|152990436|ref|YP_001356158.1| uracil-DNA glycosylase [Nitratiruptor sp. SB155-2]
 gi|151422297|dbj|BAF69801.1| uracil-DNA glycosylase [Nitratiruptor sp. SB155-2]
          Length = 195

 Score = 89.4 bits (220), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 57/185 (30%), Positives = 99/185 (53%), Gaps = 9/185 (4%)

Query: 78  HELKSLLRSFHDCHLCSTSLSTICATQTEGQ---DLMIIGYTPSDSDNISGKPFSGKTGN 134
           ++L++L     +CHLC  S +       EG     LM IG  P  +++ +G+PF G+ G 
Sbjct: 16  NDLEALRAIVLECHLCDLSKTRKNVVFGEGNPHAKLMFIGEGPGATEDETGRPFVGRAGQ 75

Query: 135 MLDKMLQSI-EIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFI 193
           +L KM++++ EI R++++I+ I    PP NR  +  E + C P + +QIE+I+P+IL+ +
Sbjct: 76  LLTKMIENVLEIPRSEVYIANIVKCRPPNNRVPTPQEAQTCIPYLFKQIEIINPEILVAL 135

Query: 194 GNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALIT 253
           G  T   +   D     +  G+  +      +IPT    HP  L++ P  KK  +  L+ 
Sbjct: 136 G-ATSYRWLTGDNTPISKVRGQVISF-RGKKLIPTF---HPSYLLRNPSKKKEAYEDLLK 190

Query: 254 LKKAL 258
           +K+ L
Sbjct: 191 IKEML 195


>gi|312621954|ref|YP_004023567.1| phage SPO1 DNA polymerase-like protein [Caldicellulosiruptor
           kronotskyensis 2002]
 gi|312202421|gb|ADQ45748.1| phage SPO1 DNA polymerase-related protein [Caldicellulosiruptor
           kronotskyensis 2002]
          Length = 185

 Score = 89.4 bits (220), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 90/185 (48%), Gaps = 6/185 (3%)

Query: 78  HELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLD 137
            EL+S       C +     + +     +   L+ +G  P + ++  GKPF G+ G  LD
Sbjct: 5   EELESACLLCEKCPISKNRTNVVVGDGNKNAKLVFVGEAPGEEEDKQGKPFVGRAGKFLD 64

Query: 138 KMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
             L S+E+ R +  +I  I    PP NR  + +E + C P +  QI+LISPKI++ +G  
Sbjct: 65  LALTSLELSREKDFYICNILKCRPPNNRVPTEVEAQNCLPFLRAQIKLISPKIIVCLGAT 124

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
              +    D + T Q+ GKW            +AT HP  L++ P  +++ +  L ++K+
Sbjct: 125 AMKYILGKDLKIT-QDRGKWFE----KGGFWIMATYHPAALLRDPGKREDFYRDLKSVKE 179

Query: 257 ALKNL 261
            L+ +
Sbjct: 180 RLEKI 184


>gi|296134223|ref|YP_003641470.1| phage SPO1 DNA polymerase-related protein [Thermincola sp. JR]
 gi|296032801|gb|ADG83569.1| phage SPO1 DNA polymerase-related protein [Thermincola potens JR]
          Length = 197

 Score = 89.0 bits (219), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 52/176 (29%), Positives = 84/176 (47%), Gaps = 6/176 (3%)

Query: 75  CS-LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTG 133
           CS L +L  L R    C L +     +        DLM IG  P   ++  G PF G  G
Sbjct: 13  CSDLEQLSLLARDCCRCGLRAGCRGVVFGKGNPDADLMFIGEGPGAEEDRQGLPFVGAAG 72

Query: 134 NMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFI 193
            +LDK++ +      +++I+ I    PPGNR  +  E + C+P + +QI LI PKI++ +
Sbjct: 73  QLLDKIILAGGWQLNEVYIANIVKCRPPGNRTPAPQEADACKPWLEKQIALIKPKIIVLL 132

Query: 194 GNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWH 249
           G+       +  A+ T ++ G+W       + I  + T HP  L++ P  K+  W 
Sbjct: 133 GSVAIQNIIDRGARIT-RDRGRWYE----KNGIRIMPTFHPAALLRDPAKKRPVWE 183


>gi|255020844|ref|ZP_05292900.1| putative DNA polymerase-like protein, bacteriophage type
           [Acidithiobacillus caldus ATCC 51756]
 gi|254969635|gb|EET27141.1| putative DNA polymerase-like protein, bacteriophage type
           [Acidithiobacillus caldus ATCC 51756]
          Length = 297

 Score = 89.0 bits (219), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 58/231 (25%), Positives = 100/231 (43%), Gaps = 22/231 (9%)

Query: 38  ESQRKEKSIDSA-----IQPITNIRHIHSPLVQQA--------DSIAQKACSLHELKSLL 84
           E  R E  + +A     I P +     H PL  +         D + ++A S  + ++L 
Sbjct: 62  EVARSEPKVTAATAALVIDPASAEEQEHEPLAVEPMEVMPADRDQVRRQAISAMDWQALK 121

Query: 85  RSFHDCHLCS---TSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQ 141
                C  CS   T  + +    +       +G  P   ++  G+ F G+ G +LD ML 
Sbjct: 122 ERIETCRACSLGSTRQNAVVGAGSPEGSWCFVGEAPGAEEDRRGEAFVGRGGQLLDAMLA 181

Query: 142 SIEIMRT-QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNF 200
           ++ + R  +++I+ +    PP NR+    E+  C P + RQI L+ P+IL+ +G      
Sbjct: 182 AMSLSRAREVYIANVLKCRPPNNRDPLGPEVRSCLPYLERQIALVQPRILVALGR----- 236

Query: 201 FFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
           F      +T   +G+       +  IP + T HP  L++ PL K+  W  L
Sbjct: 237 FAAQSLLQTSTPIGQLRGRVWEYRGIPLVVTYHPAYLLRNPLEKRKVWEDL 287


>gi|254419584|ref|ZP_05033308.1| uracil-DNA glycosylase, family 4, putative [Brevundimonas sp. BAL3]
 gi|196185761|gb|EDX80737.1| uracil-DNA glycosylase, family 4, putative [Brevundimonas sp. BAL3]
          Length = 265

 Score = 89.0 bits (219), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 60/251 (23%), Positives = 110/251 (43%), Gaps = 12/251 (4%)

Query: 18  FYADSGVYWVFDEPNNEATYES-----QRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQ 72
           F+ D+GV   + +   + T+ +     +  +K+  S + P+       +  + +A  +A 
Sbjct: 17  FWRDAGVDACYGDAPVDHTHLAPPPALKAVQKATASVVMPLAGPSAQDA--LAEARRLAT 74

Query: 73  KACSLHELKSLLRSFHDCHLCSTSLS-TICATQTEGQDLMIIGYTPSDSDNISGKPFSGK 131
            A +L +L + + +F  C L     S ++         +M+IG  P   ++  G+PF G+
Sbjct: 75  GASTLQDLAAAVAAFEGCPLRGMGASQSVFGRGNPNAPVMVIGEGPGADEDRLGQPFVGR 134

Query: 132 TGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILL 191
            G +LD+ML +  +   ++ I+    W PPGNR  +  E  +C P + R   L+ PK +L
Sbjct: 135 AGKLLDRMLAAAGLT-DKVFITNTVFWRPPGNRTPTPQEQAVCAPFVERAFALLQPKAVL 193

Query: 192 FIGNKTKNFFFNNDAQKTYQNLGKWS--NLCTPHSIIPTLATVHPQELIQYPLIKKNTWH 249
            +G          +     +  G+W    L       P L T+HP  L++ P  K+  W 
Sbjct: 194 LLGAAAAKSVLQTE-DGIMKMRGQWREWRLAEGGVSAPALPTLHPAFLLRQPQAKRQVWA 252

Query: 250 ALITLKKALKN 260
            L+     L  
Sbjct: 253 DLLAFAAKLDG 263


>gi|124515689|gb|EAY57198.1| Uracil-DNA glycosylase, family 4 [Leptospirillum rubarum]
          Length = 243

 Score = 89.0 bits (219), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 51/183 (27%), Positives = 85/183 (46%), Gaps = 11/183 (6%)

Query: 78  HELKSLLRSFHDCHLCSTSLSTICATQTEGQD---LMIIGYTPSDSDNISGKPFSGKTGN 134
            ++  L R    C +CS S +       EG+    LM +G  P   ++ +G+PF G+ G 
Sbjct: 51  EDIDGLERFVRTCQICSLSETRNQVVFGEGRGTSGLMFVGEGPGADEDRTGRPFVGRAGE 110

Query: 135 MLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           +L KM+Q++ + R +++I+      PPGNR  S  E   C P +  QI L+ PK ++ +G
Sbjct: 111 LLTKMIQAMGLSREEVYIANTVKCRPPGNRVPSPEERNACFPFLEAQIRLLKPKYMILLG 170

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLC---TPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
                        K  + + +    C     +  I  + T HP  L++ P  KK+ W  L
Sbjct: 171 QTATQVIL-----KQSEGITRIRGRCFEMPEYPGIKMMPTYHPAYLLRNPSAKKDVWSDL 225

Query: 252 ITL 254
            T+
Sbjct: 226 QTV 228


>gi|284044347|ref|YP_003394687.1| phage SPO1 DNA polymerase-related protein [Conexibacter woesei DSM
           14684]
 gi|283948568|gb|ADB51312.1| phage SPO1 DNA polymerase-related protein [Conexibacter woesei DSM
           14684]
          Length = 254

 Score = 88.6 bits (218), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 67/130 (51%), Gaps = 3/130 (2%)

Query: 78  HELKSLLRSFHDCHLCS---TSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
             LK + R    C LC+   T  + +        DLM +G  P  +++  G PF G+ G 
Sbjct: 9   ERLKEVWREASTCTLCALSETRQTVVFGAGNADADLMFVGEAPGANEDRGGLPFIGQAGR 68

Query: 135 MLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           +LDK+LQ + + R  + I+ +    PPGNR+    E+  CR  + RQ+ELI PK++  +G
Sbjct: 69  LLDKLLQEVGLERADVFIANVLKCRPPGNRDPRPTEIATCRDYLHRQVELIEPKVICTLG 128

Query: 195 NKTKNFFFNN 204
           N +     ++
Sbjct: 129 NFSTKLLRDD 138


>gi|304319860|ref|YP_003853503.1| hypothetical protein PB2503_01417 [Parvularcula bermudensis
           HTCC2503]
 gi|303298763|gb|ADM08362.1| hypothetical protein PB2503_01417 [Parvularcula bermudensis
           HTCC2503]
          Length = 299

 Score = 88.6 bits (218), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 52/176 (29%), Positives = 79/176 (44%), Gaps = 8/176 (4%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKM 139
           L   +  F  C L + +  T+      G  L+IIG  P   ++  GKPF GK G +LD M
Sbjct: 112 LADAIAGFDGCPLKAAARRTVVYDGVIGARLLIIGEGPGRDEDRIGKPFVGKAGGLLDLM 171

Query: 140 LQSIEIMRTQ------IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFI 193
           L +I   RT+      + I+    W PPGNR  +  E  IC P + R I L +P++++ +
Sbjct: 172 LHAIGYSRTEADGRGDVLITNAVYWRPPGNRAPTGEEQAICLPFLRRFITLAAPEVIILM 231

Query: 194 GNKTKNFFFNNDAQKTYQNLGKWSNL-CTPHSIIPTLATVHPQELIQYPLIKKNTW 248
           GN +    +   A    +  G W     +       L   HP  L++ P  K+  W
Sbjct: 232 GNVSTQALYPG-APGITRTRGSWREWPLSDGRQAAVLPMFHPAFLLRAPAQKRLAW 286


>gi|154499968|ref|ZP_02038006.1| hypothetical protein BACCAP_03625 [Bacteroides capillosus ATCC
           29799]
 gi|150271566|gb|EDM98823.1| hypothetical protein BACCAP_03625 [Bacteroides capillosus ATCC
           29799]
          Length = 188

 Score = 88.6 bits (218), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 88/172 (51%), Gaps = 5/172 (2%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C L  T  + +  T     ++M IG  P + +++ G+PF G+ G +LD ML+ I++ R++
Sbjct: 17  CALAETRHNVVFGTGNPNAEVMFIGEGPGEQEDLKGEPFVGRAGKLLDDMLEIIDLDRSK 76

Query: 150 IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKT 209
           I+I+ +    PP NR+  N+E E C   +  Q+ +I PKI++ +G          D + T
Sbjct: 77  IYITNMVKCRPPQNRDPLNVEQEACIGYLRNQVAIIRPKIIVCLGRIAAMKLIKEDFKIT 136

Query: 210 YQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
            ++ G+W       + +   A  HP  L++ P  +   +  L +L+  +K +
Sbjct: 137 KEH-GQW----VEKAGVQMTAMYHPAALLRNPGWRPAAFEDLKSLQAKIKEI 183


>gi|39996228|ref|NP_952179.1| phage shock protein E [Geobacter sulfurreducens PCA]
 gi|39982993|gb|AAR34452.1| phage SPO1 DNA polymerase-related protein [Geobacter sulfurreducens
           PCA]
          Length = 235

 Score = 88.6 bits (218), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 87/173 (50%), Gaps = 5/173 (2%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L +++  +   H C L +   + +         LMIIG  P   +++ G+PF G+ G +
Sbjct: 47  TLDDIRREMGGCHRCALGAGRTNLVFGVGNPAARLMIIGEAPGRDEDLRGEPFVGEAGQL 106

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           L K+++++   R  ++I  +    PP NR+ ++ E+E C   ++RQ++ ++P+ +L +G 
Sbjct: 107 LTKIIEAMGFAREDVYICNVLKCRPPHNRDPASAEIEACSSFMLRQVKAVAPEAILALGT 166

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTW 248
                F       T + + +       +  IP + T+HP  L++ P  K++ W
Sbjct: 167 -----FAAQTILGTKEPISRLRGRFHDYHGIPLMPTLHPAFLLRNPERKRDVW 214


>gi|147679076|ref|YP_001213291.1| uracil-DNA glycosylase [Pelotomaculum thermopropionicum SI]
 gi|146275173|dbj|BAF60922.1| uracil-DNA glycosylase [Pelotomaculum thermopropionicum SI]
          Length = 202

 Score = 88.6 bits (218), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 55/175 (31%), Positives = 85/175 (48%), Gaps = 5/175 (2%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           SL ELK++  +   C L S     +         LM+IG  P   ++  G+PF GK G +
Sbjct: 17  SLEELKAMAVACTRCGLRSGCSGVVFGEGNPEARLMLIGEGPGADEDRMGRPFVGKAGQL 76

Query: 136 LDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           LDK+L++  + R T  +I+ +    PPGNR     E   C P + RQIEL+SP I++ +G
Sbjct: 77  LDKILEAAGLERFTHTYIANVVKCRPPGNRVPRPDEAARCLPWLYRQIELVSPGIIVLLG 136

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWH 249
           +       +  A+ T +  G+W       S I  + T HP  L++    K+  W 
Sbjct: 137 STALQNLIDPAARIT-EMRGRW---LVSKSGIKIMPTYHPAALLRDVSKKRPVWE 187


>gi|298505240|gb|ADI83963.1| uracil-DNA glycosylase [Geobacter sulfurreducens KN400]
          Length = 243

 Score = 88.6 bits (218), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 87/173 (50%), Gaps = 5/173 (2%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L +++  +   H C L +   + +         LMIIG  P   +++ G+PF G+ G +
Sbjct: 55  TLDDIRREMGGCHRCALGAGRTNLVFGVGNPAARLMIIGEAPGRDEDLRGEPFVGEAGQL 114

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           L K+++++   R  ++I  +    PP NR+ ++ E+E C   ++RQ++ ++P+ +L +G 
Sbjct: 115 LTKIIEAMGFAREDVYICNVLKCRPPHNRDPASAEIEACSSFMLRQVKAVAPEAILALGT 174

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTW 248
                F       T + + +       +  IP + T+HP  L++ P  K++ W
Sbjct: 175 -----FAAQTILGTKEPISRLRGRFHDYHGIPLMPTLHPAFLLRNPERKRDVW 222


>gi|332295615|ref|YP_004437538.1| phage SPO1 DNA polymerase-related protein [Thermodesulfobium
           narugense DSM 14796]
 gi|332178718|gb|AEE14407.1| phage SPO1 DNA polymerase-related protein [Thermodesulfobium
           narugense DSM 14796]
          Length = 209

 Score = 88.6 bits (218), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 70/119 (58%), Gaps = 3/119 (2%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQ---DLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L  +L    +C  C  S + I     EG    D+M+IG  P ++++I G PF GK G +
Sbjct: 24  KLSDILIEAKNCKKCKLSETRINVVFGEGPMNPDIMVIGEGPGETEDIQGLPFVGKAGQL 83

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           L K+ +S+ + R  I+I+ +    PPGNRN    E+E CRP +  QI++++PKI++ +G
Sbjct: 84  LTKIFESVSLNRKDIYITNVVKCRPPGNRNPLPEEIEQCRPFLDAQIKILNPKIIILLG 142


>gi|302382435|ref|YP_003818258.1| phage SPO1 DNA polymerase-related protein [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302193063|gb|ADL00635.1| phage SPO1 DNA polymerase-related protein [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 261

 Score = 88.6 bits (218), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 62/259 (23%), Positives = 114/259 (44%), Gaps = 22/259 (8%)

Query: 12  ILTIALFYADSGVYWVFDEPNNEATYESQRKEKSI--DSAIQPITNIRHIHSPLVQQADS 69
           I ++  F+ D+GV         +A +E   ++++I    A++ +T       P+V   D+
Sbjct: 11  IESLLAFWRDAGV---------DACFEDAPQDRTIVVAPALKAVTRATASVMPVVDMGDA 61

Query: 70  ------IAQKACSLHELKSLLRSFHDCHLCS-TSLSTICATQTEGQDLMIIGYTPSDSDN 122
                 +A  A ++  L++   SF  C L    +   +         +++IG  P   ++
Sbjct: 62  TADARRLANGADTMEALEAAAASFRGCELVGMGARGCVFGRGDPHAPVLVIGEAPGAEED 121

Query: 123 ISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQI 182
            +G+PF G+ G +LDKML +  +   ++ I+    W PPGNR  +  E   C P + R  
Sbjct: 122 ATGQPFVGQPGKLLDKMLAAAGLA-DKVFITNTVFWRPPGNRTPTPQEQAACAPFVERAF 180

Query: 183 ELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWS--NLCTPHSIIPTLATVHPQELIQY 240
            L+ P+ +L +G          +     +  G W    L       P +AT+HP  L++ 
Sbjct: 181 FLMKPRAVLLLGAAAARSVLRTE-DGIMKVRGHWREWRLTEGDVTAPVIATLHPAFLLKQ 239

Query: 241 PLIKKNTWHALITLKKALK 259
           P  K+  W  ++ L   L+
Sbjct: 240 PQAKRQAWADMLELAARLE 258


>gi|78187754|ref|YP_375797.1| Phage SPO1 DNA polymerase-related protein [Chlorobium luteolum DSM
           273]
 gi|78167656|gb|ABB24754.1| Phage SPO1 DNA polymerase-related protein [Chlorobium luteolum DSM
           273]
          Length = 199

 Score = 88.6 bits (218), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 79/172 (45%), Gaps = 5/172 (2%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C L  T  + +         L++IG  P   ++ +GKPF G++G +L K+L +I   R +
Sbjct: 23  CRLAETRNTVVFGEGDPESKLVVIGEGPGAEEDATGKPFVGRSGQLLTKILAAIGFSREE 82

Query: 150 IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKT 209
           + I  I    PP NRN ++ E+  C P +  QIE+I PK++L +G    N    N     
Sbjct: 83  VFICNIVKCRPPQNRNPAHDEIAACTPWLKSQIEIIRPKVILLLGKVAANTILQNSL--- 139

Query: 210 YQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
             ++G           +    T HP  L++ P  K+  W  +  L+    N+
Sbjct: 140 --SMGAMRGKVLQWEGVDCFVTYHPAALLRNPNWKRGCWEDVQLLRHHYDNI 189


>gi|323706586|ref|ZP_08118137.1| phage SPO1 DNA polymerase-related protein [Thermoanaerobacterium
           xylanolyticum LX-11]
 gi|323534064|gb|EGB23864.1| phage SPO1 DNA polymerase-related protein [Thermoanaerobacterium
           xylanolyticum LX-11]
          Length = 187

 Score = 88.2 bits (217), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 52/186 (27%), Positives = 87/186 (46%), Gaps = 8/186 (4%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQ---DLMIIGYTPSDSDNISGKPFSGKT 132
           SL  LK L+    +C  C            EG     +M +G  P   +++ G+PF GK 
Sbjct: 2   SLLPLKELIEQCMNCTKCPLHNVRNNVVFGEGNLRSKIMFVGEGPGRDEDLQGRPFVGKA 61

Query: 133 GNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLF 192
           G +L+KML++I + R  ++I+ I    PP NR     E++ C P +  Q+ +I+PKI++ 
Sbjct: 62  GQLLNKMLEAINLKREDVYIANIVKCRPPNNRVPLQSEVDACLPYLRNQVAIIAPKIIVC 121

Query: 193 IGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALI 252
           +G        + D + T    G+W         +  +AT HP  L++ P  K   W    
Sbjct: 122 LGATAAKAIIDKDFKITAMR-GQWFE----KKGVKIIATYHPAALLRDPEKKYPAWEDFK 176

Query: 253 TLKKAL 258
           +++  L
Sbjct: 177 SIRDEL 182


>gi|206602194|gb|EDZ38676.1| Uracil-DNA glycosylase, family 4 [Leptospirillum sp. Group II
           '5-way CG']
          Length = 245

 Score = 88.2 bits (217), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 53/180 (29%), Positives = 85/180 (47%), Gaps = 5/180 (2%)

Query: 78  HELKSLLRSFHDCHLCSTSLSTICATQTEGQD---LMIIGYTPSDSDNISGKPFSGKTGN 134
            +L  L R    C  CS S +       EG+    LM +G  P   ++ +G+PF G+ G 
Sbjct: 53  EDLDGLERFVLACQACSLSETRNQVVFGEGRGTSGLMFVGEGPGADEDRTGRPFVGRAGE 112

Query: 135 MLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           +L KM+Q++ + R +++I+      PPGNR  S  E + C P +  QI L+ PK ++ +G
Sbjct: 113 LLTKMIQAMGLSREEVYIANTVKCRPPGNRVPSPEERKACFPFLEAQIRLLKPKYMILLG 172

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITL 254
                      A  T +  G    L   +  I  + T HP  L++ P  K++ W  L T+
Sbjct: 173 QTAAQVVLRQSAGIT-RIRGTCCEL-PEYPGIKIMPTYHPAYLLRNPSAKRDVWSDLQTV 230


>gi|320535746|ref|ZP_08035831.1| uracil-DNA glycosylase, family 4 [Treponema phagedenis F0421]
 gi|320147402|gb|EFW38933.1| uracil-DNA glycosylase, family 4 [Treponema phagedenis F0421]
          Length = 265

 Score = 88.2 bits (217), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 56/193 (29%), Positives = 89/193 (46%), Gaps = 16/193 (8%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEGQD----------LMIIGYTPSDSDNISGKPFS 129
           +  + ++ H C  C  + + I A   EG +          +M+IG  P   ++ +G+PF 
Sbjct: 73  MADIAQAVHACRGCGLAATRIHAVPGEGPEELSRLQNSVEVMVIGEGPGADEDKTGRPFV 132

Query: 130 GKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPK 188
           GK G +LDKML++I++ R T  +I+ I    PP NR+ +  E   C   +  QI L  P 
Sbjct: 133 GKAGQLLDKMLEAIQLSRKTNCYITNIVKCRPPQNRDPAPAECAACAQFLEAQIRLQKPL 192

Query: 189 ILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTW 248
            +L  G        N     T + +GK       ++ IP LAT HP  L++   +K+  W
Sbjct: 193 AILVFGRCAAQLLLN-----TTEGIGKLRGRFFDYNGIPLLATYHPSALLRDESLKRPAW 247

Query: 249 HALITLKKALKNL 261
             L   +  L  L
Sbjct: 248 EDLKKFRTQLLQL 260


>gi|239616610|ref|YP_002939932.1| phage SPO1 DNA polymerase-related protein [Kosmotoga olearia TBF
           19.5.1]
 gi|239505441|gb|ACR78928.1| phage SPO1 DNA polymerase-related protein [Kosmotoga olearia TBF
           19.5.1]
          Length = 207

 Score = 87.8 bits (216), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 90/185 (48%), Gaps = 11/185 (5%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEGQ---DLMIIGYTPSDSDNISGKPFSGKTGNML 136
           +  ++R   +C+LC   L+       EG     ++ +G  P   ++ +G+PF G+ G +L
Sbjct: 11  MMGIIRKIEECNLCPLHLTRTNVVPGEGSLDSPVVFVGEGPGADEDATGRPFVGRAGKLL 70

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
            K+L+S+ + R  ++I+ I    PP NR  +  EM+ C P ++ Q+ +I PK+++ +G  
Sbjct: 71  TKILESVGLSREDVYITNIVKCRPPNNRTPTLQEMKACEPYLLSQLAVIKPKLIVCLGAT 130

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLI-----KKNTWHAL 251
               F  ++  +  +  GK  +    H  I      HP  L++ P       K+ TW  +
Sbjct: 131 ALAAFLESEKVQITKYRGKLFDW---HGGIKVFGMFHPSYLLRNPSTAPGSPKRLTWEDI 187

Query: 252 ITLKK 256
             ++K
Sbjct: 188 QKVRK 192


>gi|257457232|ref|ZP_05622407.1| DNA polymerase domain protein [Treponema vincentii ATCC 35580]
 gi|257445383|gb|EEV20451.1| DNA polymerase domain protein [Treponema vincentii ATCC 35580]
          Length = 299

 Score = 87.8 bits (216), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 90/203 (44%), Gaps = 13/203 (6%)

Query: 67  ADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTE-------GQDLMIIGYTPSD 119
           ADS      S+ E+ + +     C L  T    +     E         ++M+IG  P  
Sbjct: 98  ADSSGASFRSMQEIYAAVAQCSACVLGQTRTHPVAGEGPEELSRLTNSVEVMVIGEGPGA 157

Query: 120 SDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPII 178
            ++  G+PF G+ G +LDKML++I++ R T  +I+ +    PP NR+ +  E   C   +
Sbjct: 158 DEDRQGRPFVGRAGQLLDKMLEAIQLSRKTNCYITNVVKCRPPQNRDPAPEERNCCAAFL 217

Query: 179 MRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELI 238
             QI LI PK++L +G             +T   +GK       +  IP + T HP  L+
Sbjct: 218 DAQIRLIRPKMILVMGRIAAQHLL-----QTSDGIGKLRGRFFDYQGIPLMPTYHPSALL 272

Query: 239 QYPLIKKNTWHALITLKKALKNL 261
           +   +K+  W  L   +  L  L
Sbjct: 273 RDESLKRPAWEDLKRFRARLHEL 295


>gi|313679738|ref|YP_004057477.1| phage spo1 DNA polymerase-related protein [Oceanithermus profundus
           DSM 14977]
 gi|313152453|gb|ADR36304.1| phage SPO1 DNA polymerase-related protein [Oceanithermus profundus
           DSM 14977]
          Length = 205

 Score = 87.8 bits (216), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 57/192 (29%), Positives = 91/192 (47%), Gaps = 11/192 (5%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           SL EL +       C L       +         LMI+G  P   ++  G+PF G+ G +
Sbjct: 2   SLEELAAQAAHCTACRLHEGRTHVVFGEGDPDAKLMIVGEGPGADEDAQGRPFVGRAGQL 61

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPI-IMRQIELISPKILLFIG 194
           LD++L++  I R+ ++I+ I    PPGNRN    E +IC  + +++QIELI P+I++ +G
Sbjct: 62  LDRILEAAGIPRSSVYITNIVKCRPPGNRNPLPDEAKICSSLWLLKQIELIRPQIIVPLG 121

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP-----LIKKNTWH 249
           +    FF       T +  G+W       + I      HP  L++ P       K  TW 
Sbjct: 122 SVATQFFLGEKLPIT-KVRGQWFEW----NGIQVFPMFHPAYLLRNPSRAPGSPKALTWK 176

Query: 250 ALITLKKALKNL 261
            + T+K+ L  L
Sbjct: 177 DIQTVKQTLDRL 188


>gi|289208938|ref|YP_003461004.1| phage SPO1 DNA polymerase-related protein [Thioalkalivibrio sp.
           K90mix]
 gi|288944569|gb|ADC72268.1| phage SPO1 DNA polymerase-related protein [Thioalkalivibrio sp.
           K90mix]
          Length = 264

 Score = 87.4 bits (215), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 86/202 (42%), Gaps = 10/202 (4%)

Query: 62  PLVQQADSIAQKACSLHELKSLLRSFHDCHLCST----SLSTICATQTEGQDLMIIGYTP 117
           PLV  AD   +   ++ +   L     +C  C+        T+          + +G  P
Sbjct: 62  PLVSPADVPEEGGVAVLDWPELEARVRECTACAELAAQRTQTVFGVGDRRARWLFVGEAP 121

Query: 118 SDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRP 176
              ++  G+PF G+ G +LD ML ++ + R Q + I+ +    PP NR+ S  E   CR 
Sbjct: 122 GAEEDRRGEPFVGRAGQLLDSMLAALGLDRGQDVFIANVLKCRPPNNRDPSPDESRACRG 181

Query: 177 IIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQE 236
            + RQI L+ P++++ +G          D     Q LG+       +  +P + T HP  
Sbjct: 182 FLDRQIALVQPEVIVALGRIAAQHLLETD-----QPLGRMRGSLHRYREVPLVVTYHPAY 236

Query: 237 LIQYPLIKKNTWHALITLKKAL 258
           L++ P  K   W  L   +  L
Sbjct: 237 LLRKPQDKAKAWQDLQRARACL 258


>gi|332968166|gb|EGK07248.1| uracil-DNA glycosylase [Desmospora sp. 8437]
          Length = 241

 Score = 87.4 bits (215), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 54/213 (25%), Positives = 96/213 (45%), Gaps = 10/213 (4%)

Query: 52  PITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQD-- 109
           P+ +   IH   +Q+   +     +  +L+S+ + +  C  C            EG    
Sbjct: 31  PLCDNTSIHPGGIQKQSEMG--GGTGMDLESVHQRYARCSRCPLHRGRTRIVLGEGNPAS 88

Query: 110 -LMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSN 168
            LM +G  P   ++  G+PF G+ G +L +ML++ EI R +I I+ I    PPGNR   +
Sbjct: 89  PLMFVGEGPGADEDRQGRPFVGRAGQLLSRMLEAAEIPRAEIFITNIVKCRPPGNRTPQD 148

Query: 169 IEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPT 228
            EM  C  I+  Q   I PK+++ +G+       +  A+ T +  G+W         +  
Sbjct: 149 EEMATCITILREQFVAIRPKLIVTLGSAPTRALIDPAARIT-RVRGQWVE----RKGVRM 203

Query: 229 LATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
           + T HP  L++ P  K+  W     ++ A + +
Sbjct: 204 MPTFHPAYLLRNPEAKREAWIDFQAIRDAYREV 236


>gi|331000978|ref|ZP_08324615.1| uracil-DNA glycosylase, family 4 [Parasutterella excrementihominis
           YIT 11859]
 gi|329569937|gb|EGG51694.1| uracil-DNA glycosylase, family 4 [Parasutterella excrementihominis
           YIT 11859]
          Length = 324

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 58/218 (26%), Positives = 94/218 (43%), Gaps = 2/218 (0%)

Query: 32  NNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCH 91
            N     S R E +   A +  +  R +      +A            LK L++    C 
Sbjct: 97  RNAPPPRSARPEPAAKPAYRSASEARGVRPEAYTEARIHQIATADWQTLKQLVQDCRACE 156

Query: 92  LCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ-I 150
           + S+ L  +         LM+IG  P   ++  G+PF G +G +LDK+L++ ++ R + +
Sbjct: 157 ISSSRLHPVFGQGYPPCRLMLIGEAPGAEEDRLGQPFVGPSGKLLDKILEAAKLDREKDL 216

Query: 151 HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTY 210
            I       PP N      E   CRP + RQIELI P++++ +G    ++FF  D +   
Sbjct: 217 CIFNTLKCRPPLNATPEKAETMACRPFLERQIELIDPEVIVAMGKPAASWFF-PDLKTLN 275

Query: 211 QNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTW 248
              GK  NL         + T HP  L++ P  K+  W
Sbjct: 276 PYRGKVHNLTVQGKPRKVIVTYHPSYLLRSPQEKRKAW 313


>gi|291279806|ref|YP_003496641.1| uracil-DNA glycosylase [Deferribacter desulfuricans SSM1]
 gi|290754508|dbj|BAI80885.1| uracil-DNA glycosylase [Deferribacter desulfuricans SSM1]
          Length = 207

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 49/171 (28%), Positives = 82/171 (47%), Gaps = 8/171 (4%)

Query: 84  LRSFHDCHLCSTSLSTICATQTEGQ---DLMIIGYTPSDSDNISGKPFSGKTGNMLDKML 140
           L    DC+ C  + +       EG    +LM +G  P   ++  G+PF G+ G +L KM+
Sbjct: 32  LNEVKDCNKCRLAKNRTNLVFGEGDPNAELMFVGEGPGAEEDKQGRPFVGRAGQLLTKMI 91

Query: 141 QSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNF 200
           +++++ R  ++I+ I    PP NR   N E+  C P + +QIE+I PK ++ +G+   + 
Sbjct: 92  EAMKLKREDVYIANIVKCRPPNNRAPLNDEIGACIPYLHKQIEIIKPKYIICLGSIAASA 151

Query: 201 FFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
             N     T   + K          I  + T HP  L++ P +KK  W  L
Sbjct: 152 LLN-----TTTAISKIRGSFREFKGIKVMPTFHPAYLLRNPKMKKLAWEDL 197


>gi|78223867|ref|YP_385614.1| Phage SPO1 DNA polymerase-related protein [Geobacter
           metallireducens GS-15]
 gi|78195122|gb|ABB32889.1| Phage SPO1 DNA polymerase-related protein [Geobacter
           metallireducens GS-15]
          Length = 253

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 82/180 (45%), Gaps = 8/180 (4%)

Query: 72  QKACSLHELKSLLRSFHDCHLCSTS---LSTICATQTEGQDLMIIGYTPSDSDNISGKPF 128
           Q A +   L  + R   +C  C       + +         L+ IG  P   +++ G+PF
Sbjct: 60  QAATAGETLDDIRRDLGECVRCQLGKQRTNLVFGVGNPRARLVFIGEAPGRDEDLKGEPF 119

Query: 129 SGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPK 188
            G+ G +L K++Q++   R +++I  +    PPGNRN  + E+  C P ++RQ+  I P+
Sbjct: 120 VGEAGQLLTKIIQAMGFARDEVYICNVLKCRPPGNRNPHHDEIVQCAPFMLRQVRAIGPE 179

Query: 189 ILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTW 248
            ++ +G      F       T + +         +  IP + T HP  L++YP  K+  W
Sbjct: 180 AVVALGT-----FAAQTLLATKEPISALRGRFHDYHGIPLMPTFHPAFLVRYPERKREVW 234


>gi|303257069|ref|ZP_07343083.1| arginine biosynthesis bifunctional protein ArgJ [Burkholderiales
           bacterium 1_1_47]
 gi|302860560|gb|EFL83637.1| arginine biosynthesis bifunctional protein ArgJ [Burkholderiales
           bacterium 1_1_47]
          Length = 321

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 58/218 (26%), Positives = 94/218 (43%), Gaps = 2/218 (0%)

Query: 32  NNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCH 91
            N     S R E +   A +  +  R +      +A            LK L++    C 
Sbjct: 94  RNAPPPRSARPEPAAKPAYRSASEARGVRPEAYTEARIHQIATADWQTLKQLVQDCRACE 153

Query: 92  LCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ-I 150
           + S+ L  +         LM+IG  P   ++  G+PF G +G +LDK+L++ ++ R + +
Sbjct: 154 ISSSRLHPVFGQGYPPCRLMLIGEAPGAEEDRLGQPFVGPSGKLLDKILEAAKLDREKDL 213

Query: 151 HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTY 210
            I       PP N      E   CRP + RQIELI P++++ +G    ++FF  D +   
Sbjct: 214 CIFNTLKCRPPLNATPEKAETMACRPFLERQIELIDPEVIVAMGKPAASWFF-PDLKTLN 272

Query: 211 QNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTW 248
              GK  NL         + T HP  L++ P  K+  W
Sbjct: 273 PYRGKVHNLTVQGKPRKVIVTYHPSYLLRSPQEKRKAW 310


>gi|83816180|ref|YP_444183.1| uracil-DNA glycosylase [Salinibacter ruber DSM 13855]
 gi|83757574|gb|ABC45687.1| uracil-DNA glycosylase, family 4 [Salinibacter ruber DSM 13855]
          Length = 287

 Score = 86.7 bits (213), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 51/155 (32%), Positives = 79/155 (50%), Gaps = 9/155 (5%)

Query: 109 DLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSN 168
           DL+IIG  P  +++  G+PF G+ G +LDK+L +I   R  ++I+ I    PP NRN  +
Sbjct: 136 DLVIIGEAPGRNEDEEGEPFVGRAGQLLDKILDAINFEREDVYITNILKSRPPRNRNPKS 195

Query: 169 IEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSI--I 226
            E++   P++ +QI L+ PKI+L +G    N     D   +  NL         H    I
Sbjct: 196 EEIDAHLPVLYKQIALLRPKIILTVGKVAGNTLL--DRSSSLSNLRDQE-----HDFYGI 248

Query: 227 PTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
           P +AT HP  L++    K+ TW  +  L+     L
Sbjct: 249 PLMATYHPAALLRNSQWKRPTWEDVKLLRTRYDQL 283


>gi|302338167|ref|YP_003803373.1| phage SPO1 DNA polymerase-related protein [Spirochaeta smaragdinae
           DSM 11293]
 gi|301635352|gb|ADK80779.1| phage SPO1 DNA polymerase-related protein [Spirochaeta smaragdinae
           DSM 11293]
          Length = 240

 Score = 86.7 bits (213), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 52/186 (27%), Positives = 85/186 (45%), Gaps = 9/186 (4%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEG---QDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           LK + +    C  C        A   EG     ++IIG  P   ++ SG+PF G  G  L
Sbjct: 59  LKEIAQEVSSCTACRLHEGRHHAVPGEGVVHPMVLIIGEGPGAQEDASGRPFVGPAGQYL 118

Query: 137 DKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           DK +++I + R++ + I  +    PPGNR+    E   CRP + RQI+++ PK +L +G 
Sbjct: 119 DKWMKAIGLSRSEHLFIGNVIKCRPPGNRDPLPDEAAACRPFLDRQIDILRPKAILTVGR 178

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
                  +     T   +G+       +  IP + T HP  +++ P  +   W  L  L+
Sbjct: 179 IAMQLLLD-----TTDGIGRRHGKRFEYRGIPLVPTYHPSGVLRNPEYRAPVWKDLKALR 233

Query: 256 KALKNL 261
             L+ L
Sbjct: 234 SLLEEL 239


>gi|225181124|ref|ZP_03734570.1| phage SPO1 DNA polymerase-related protein [Dethiobacter
           alkaliphilus AHT 1]
 gi|225168093|gb|EEG76898.1| phage SPO1 DNA polymerase-related protein [Dethiobacter
           alkaliphilus AHT 1]
          Length = 222

 Score = 86.7 bits (213), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 50/201 (24%), Positives = 94/201 (46%), Gaps = 18/201 (8%)

Query: 62  PLVQQADSIAQKACSLHELKSLLRSFHDCHLC---STSLSTICATQTEGQDLMIIGYTPS 118
           P+V+Q  +IA          +L +   DC  C   S +   +        DL+ +G  P 
Sbjct: 34  PVVEQPQTIA----------ALSKDVLDCAQCGLRSQATQVVFGEGNPDADLLFVGEAPG 83

Query: 119 DSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPII 178
             ++  G+PF G+ G +L+K+L + EI R +++I+ +    PP NR  +  E   C   +
Sbjct: 84  AEEDAQGRPFVGEAGKLLNKILAAAEISREEVYITNVVKCRPPKNRTPNPDEAAACSEHL 143

Query: 179 MRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELI 238
            +QI L+ P+I++ +G+       +  A+ +    G+W         +  +AT HP  L+
Sbjct: 144 QKQIALLKPRIVVCLGSLATQALIDPQARVSAVR-GRWFT----KDGLQMMATFHPAALL 198

Query: 239 QYPLIKKNTWHALITLKKALK 259
           + P  K+  W  +  ++ A +
Sbjct: 199 RDPSRKRPVWEDIQKIRDAYR 219


>gi|294505841|ref|YP_003569899.1| DNA polymerase-related protein,bacteriophage-type [Salinibacter
           ruber M8]
 gi|294342169|emb|CBH22947.1| DNA polymerase-related protein,bacteriophage-type [Salinibacter
           ruber M8]
          Length = 287

 Score = 86.7 bits (213), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 51/155 (32%), Positives = 79/155 (50%), Gaps = 9/155 (5%)

Query: 109 DLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSN 168
           DL+IIG  P  +++  G+PF G+ G +LDK+L +I   R  ++I+ I    PP NRN  +
Sbjct: 136 DLVIIGEAPGRNEDEEGEPFVGRAGQLLDKILDAINFEREDVYITNILKSRPPRNRNPKS 195

Query: 169 IEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSI--I 226
            E++   P++ +QI L+ PKI+L +G    N     D   +  NL         H    I
Sbjct: 196 EEIDAHLPVLYKQIALLRPKIILTVGKVAGNTLL--DRSSSLSNLRDQE-----HDFYGI 248

Query: 227 PTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
           P +AT HP  L++    K+ TW  +  L+     L
Sbjct: 249 PLMATYHPAALLRNSQWKRPTWEDVKLLRTRYDQL 283


>gi|328950429|ref|YP_004367764.1| phage SPO1 DNA polymerase-related protein [Marinithermus
           hydrothermalis DSM 14884]
 gi|328450753|gb|AEB11654.1| phage SPO1 DNA polymerase-related protein [Marinithermus
           hydrothermalis DSM 14884]
          Length = 205

 Score = 86.7 bits (213), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 57/194 (29%), Positives = 90/194 (46%), Gaps = 15/194 (7%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L EL +  ++   C L     + +         LMI+G  P   ++  G+PF GK G +
Sbjct: 2   TLEELAAKAQACTACRLAEGRHTVVFGEGDPDAQLMIVGEGPGADEDAQGRPFVGKAGQL 61

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPI-IMRQIELISPKILLFIG 194
           L+++L++  I R  ++I+ I    PPGNRN    E +IC  + + +QIELI P+I+  +G
Sbjct: 62  LNRILEAAGIPRESVYIANIVKCRPPGNRNPLPDEAKICTGLWLSKQIELIRPQIIAPLG 121

Query: 195 NKTKNFFFNNDAQ--KTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP-----LIKKNT 247
           +    +F        K   N  +W  +     I P     HP  L++ P       K  T
Sbjct: 122 SVAAQYFLGEKISITKVRGNWYEWHGI----KIFPMF---HPAYLLRNPSRAPGSPKALT 174

Query: 248 WHALITLKKALKNL 261
           W  +  LKK L  L
Sbjct: 175 WRDIQELKKTLDAL 188


>gi|56479144|ref|YP_160733.1| DNA polymerase-related protein,bacteriophage-type [Aromatoleum
           aromaticum EbN1]
 gi|56315187|emb|CAI09832.1| DNA polymerase-related protein,bacteriophage-type [Aromatoleum
           aromaticum EbN1]
          Length = 273

 Score = 86.7 bits (213), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 51/203 (25%), Positives = 86/203 (42%), Gaps = 8/203 (3%)

Query: 61  SPLVQQADSIAQKACSL--HELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPS 118
           +P V   D  A++  +L    L + +R+   C LC      +          M +G  P 
Sbjct: 72  APAVDSPDERARRIETLDWEALDADIRACTACRLCERRRQAVPGVGDRQASWMFVGEGPG 131

Query: 119 DSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPI 177
             ++  G+PF G  G +LD ML +I + R + ++I+      PP NR   N E+E C P 
Sbjct: 132 AEEDQRGEPFVGAAGKLLDAMLAAIGLKRGEGVYIANAVKCRPPHNRTPGNDEIEACAPY 191

Query: 178 IMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQEL 237
           + RQI L+ P++L+ +G          D       +G           +P + T HP  L
Sbjct: 192 LARQIALLQPRLLVALGRPAARALLGVDVA-----IGAARGQVFRCRGMPVVVTYHPAYL 246

Query: 238 IQYPLIKKNTWHALITLKKALKN 260
           ++    K   W  L   ++ ++ 
Sbjct: 247 LRNQRDKAKVWEDLCFARELMER 269


>gi|262198188|ref|YP_003269397.1| phage SPO1 DNA polymerase-related protein [Haliangium ochraceum DSM
           14365]
 gi|262081535|gb|ACY17504.1| phage SPO1 DNA polymerase-related protein [Haliangium ochraceum DSM
           14365]
          Length = 380

 Score = 86.7 bits (213), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 51/223 (22%), Positives = 103/223 (46%), Gaps = 9/223 (4%)

Query: 42  KEKSIDSAIQPITNIRH---IHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLS 98
           +++   +A +P  +  H      P  ++     Q+  +L ++++ L     C L S   +
Sbjct: 154 RDRDRTAAARPPESAAHEPLAREPAAREPAPRPQRR-TLTDVRATLGDCQRCKLASGREN 212

Query: 99  TICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPW 158
            +         LM +G  P   ++  G+PF G  G +LDKM+ ++   R  ++I+ +   
Sbjct: 213 IVFGVGDPRAALMFVGEAPGFHEDRRGEPFVGNAGELLDKMIAAMGWTRDTVYIANVLKC 272

Query: 159 HPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSN 218
            PP NR+    E+  C+P +  QI+ ++P+IL+ +G    +      A  +    G++  
Sbjct: 273 RPPNNRDPQPDEIAACQPFLAEQIDAVAPRILVTLGRPAAHLLLQTTAPMSALR-GRFQE 331

Query: 219 LCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
               +  +  + T HP  L++ P  K++TW+ L  +   L+ L
Sbjct: 332 ----YRGVRVMPTFHPAFLLRRPERKRDTWNDLKLVIAELERL 370


>gi|313672976|ref|YP_004051087.1| phage spo1 DNA polymerase-related protein [Calditerrivibrio
           nitroreducens DSM 19672]
 gi|312939732|gb|ADR18924.1| phage SPO1 DNA polymerase-related protein [Calditerrivibrio
           nitroreducens DSM 19672]
          Length = 226

 Score = 86.3 bits (212), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 93/191 (48%), Gaps = 8/191 (4%)

Query: 72  QKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQ---DLMIIGYTPSDSDNISGKPF 128
           Q +    +++ ++     C  C    + +     EG    ++M IG  P + ++  G+PF
Sbjct: 40  QNSSKFEQMQKIIEEVSSCFKCILGKTRLNVVPGEGNLDAEIMFIGEGPGEDEDRQGRPF 99

Query: 129 SGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPK 188
            G+ G +L KM++++   R +++I+ I    PP NR   + E   C   + +QIE+++PK
Sbjct: 100 VGRAGQLLTKMIEAMGYKREEVYIANIVKCRPPNNRAPFDEEAFACIGYVKKQIEIVNPK 159

Query: 189 ILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTW 248
           +++ +G+    +  N D +K     G++      ++ I  + T HP  L++   +KK  W
Sbjct: 160 VIVTLGSTATRYLLNTD-KKISTIRGEFQE----YNGIKVMPTFHPSYLLRNQSMKKPAW 214

Query: 249 HALITLKKALK 259
             L  +   LK
Sbjct: 215 EDLKKVIAFLK 225


>gi|189426388|ref|YP_001953565.1| phage SPO1 DNA polymerase-related protein [Geobacter lovleyi SZ]
 gi|189422647|gb|ACD97045.1| phage SPO1 DNA polymerase-related protein [Geobacter lovleyi SZ]
          Length = 249

 Score = 86.3 bits (212), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 89/188 (47%), Gaps = 8/188 (4%)

Query: 77  LHELKSLLRSFHDCHLCSTSLST---ICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTG 133
           L  L+ L R   DC  C  + S    +     E   L+ +G  P   ++  G+PF G+ G
Sbjct: 56  LQGLEGLRRKIGDCQRCDLAQSRTNLVFGAGPEKARLVFVGEAPGADEDRQGQPFVGEAG 115

Query: 134 NMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFI 193
            +L ++++++ + RTQ++I  +    PP NRN    E+  C P + +Q+++I P++++ +
Sbjct: 116 QVLTRLIEAMGLKRTQVYICNVLKCRPPANRNPHKDEIATCSPFLQQQLQIIKPEVIVAL 175

Query: 194 GNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALIT 253
           G      F      +T + + +          IP + T HP  L+     K++ W     
Sbjct: 176 GT-----FAAQTLLETKEPISRMRGQFHSWHGIPVMPTFHPSFLLHNKENKQHYWDVWSD 230

Query: 254 LKKALKNL 261
           +++ L+ L
Sbjct: 231 MEQVLRKL 238


>gi|218883592|ref|YP_002427974.1| predicted Uracil-DNA glycosylase [Desulfurococcus kamchatkensis
           1221n]
 gi|218765208|gb|ACL10607.1| predicted Uracil-DNA glycosylase [Desulfurococcus kamchatkensis
           1221n]
          Length = 216

 Score = 85.9 bits (211), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 55/186 (29%), Positives = 87/186 (46%), Gaps = 30/186 (16%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQ---DLMIIGYTPSDSDNISGKPFSGKTG 133
           + E  SL+ S  +C  C  S         EG     +M IG  P + ++ +G+PF G  G
Sbjct: 1   MSEWDSLVNSILNCKRCRLSQYRRNPVPGEGNVNAGVMFIGEAPGEKEDETGRPFVGAAG 60

Query: 134 NMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFI 193
            +L ++++S    R  ++I+ I    PPGNR+  + E+E C P +++QIELI P++++ +
Sbjct: 61  KLLIELIESTGFKRGDVYITNIVKCRPPGNRDPEDDEIEACLPYLLKQIELIKPRLIVAL 120

Query: 194 GNKTKNFFFNNDAQKTYQNLG--KWSNLCTPHS-------------IIPTLATVHPQELI 238
           G           A +T   LG  KW N+   H              IIPT    HP   +
Sbjct: 121 GRH---------AARTLFRLGGLKWVNMSMMHGRPYNAVINGLQVVIIPTF---HPAAAL 168

Query: 239 QYPLIK 244
             P +K
Sbjct: 169 YNPGLK 174


>gi|224826345|ref|ZP_03699447.1| phage SPO1 DNA polymerase-related protein [Lutiella nitroferrum
           2002]
 gi|224601446|gb|EEG07627.1| phage SPO1 DNA polymerase-related protein [Lutiella nitroferrum
           2002]
          Length = 284

 Score = 85.9 bits (211), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 50/193 (25%), Positives = 89/193 (46%), Gaps = 8/193 (4%)

Query: 71  AQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSG 130
           A+   S  EL+  +     C LC T   T+          +IIG  P + ++  GKPF G
Sbjct: 95  AKPVLSWDELEQTVARCSHCRLCETRTQTVFGRGNPQARWLIIGEAPGEQEDKQGKPFVG 154

Query: 131 KTGNMLDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKI 189
           + G +LD ML +I +     ++I+ +    PPGNRN S  E+  C+  + +QI  I P +
Sbjct: 155 RAGQLLDNMLAAIGLDSNHDVYIANVLKCRPPGNRNPSADEIVACQDYLRQQIAHIRPTL 214

Query: 190 LLFIGN-KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTW 248
           +L +G    +    +ND      ++ +       +  +P + + HP  L++    K  +W
Sbjct: 215 ILALGRFAAQTLLDSND------SIARLRGRVHRYQDVPMIVSFHPAYLLRNLPDKAKSW 268

Query: 249 HALITLKKALKNL 261
             L+  ++  + L
Sbjct: 269 QDLVFARRTFRQL 281


>gi|220931987|ref|YP_002508895.1| Uracil-DNA glycosylase [Halothermothrix orenii H 168]
 gi|219993297|gb|ACL69900.1| Uracil-DNA glycosylase [Halothermothrix orenii H 168]
          Length = 210

 Score = 85.9 bits (211), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 81/172 (47%), Gaps = 5/172 (2%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C L       +       + +M +G  P   ++  GKPF GK G +L K+L S+ + R  
Sbjct: 35  CQLRQGCTQVVMGYGPIDRKIMFVGEGPGADEDRLGKPFVGKAGKLLTKILNSVGLERED 94

Query: 150 IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKT 209
           ++I+ I    PP NR  +  E E C PI+  +I+LI P +++ +G+       +  A   
Sbjct: 95  VYITNIVKCRPPNNRQPTRSEAEACSPILKAEIKLIDPLVIVPLGSVALKNLVDEKAS-I 153

Query: 210 YQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
            +  GKW  +   +   PT    HP  L++ P +KK  W     ++KA+  +
Sbjct: 154 MRTRGKWKKIGK-YYFFPTF---HPAFLLRNPKMKKLVWRDFKVIRKAVDRI 201


>gi|218295021|ref|ZP_03495857.1| phage SPO1 DNA polymerase-related protein [Thermus aquaticus
           Y51MC23]
 gi|218244224|gb|EED10749.1| phage SPO1 DNA polymerase-related protein [Thermus aquaticus
           Y51MC23]
          Length = 204

 Score = 85.9 bits (211), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 56/192 (29%), Positives = 94/192 (48%), Gaps = 11/192 (5%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L  L++  ++   C L       +        +LMI+G  P + ++ +G PF GK G +
Sbjct: 2   TLEVLEAQAKACTACRLAEGRTQVVFGEGNPDANLMIVGEGPGEEEDKTGHPFVGKAGQL 61

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRP-IIMRQIELISPKILLFIG 194
           L+++L++  I R +I+I+ I    PPGNR     E +IC    +++QIELI+P+I++ +G
Sbjct: 62  LNRILEAAGIRREEIYITNIVKCRPPGNRAPLPDEAKICTDRWLLKQIELIAPQIIVPLG 121

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP-----LIKKNTWH 249
                FF       T +  G+W      H  I      HP  L++ P       K  TW 
Sbjct: 122 AVAAEFFLGEKVSIT-KVRGQWYEW---HG-IKVFPMFHPAYLLRNPSRAPGSPKHLTWL 176

Query: 250 ALITLKKALKNL 261
            +  +K+AL+ L
Sbjct: 177 DIQEVKRALQAL 188


>gi|294339041|emb|CAZ87390.1| putative Uracil-DNA glycosylase [Thiomonas sp. 3As]
          Length = 286

 Score = 85.9 bits (211), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 84/179 (46%), Gaps = 11/179 (6%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           EL++  ++   C L S+    +  + +     MIIG  P   ++  G+PF G  G +LD 
Sbjct: 92  ELQAGAQACRACKLGSSRHQAVFGSGSTQARWMIIGEAPGAEEDRQGQPFVGAAGQLLDA 151

Query: 139 MLQSIEIMRT------QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLF 192
           MLQ+I + R+       ++I+ +    PPGNRN    E+  C P + RQ+ L+ P+++L 
Sbjct: 152 MLQAIGLDRSADDPERAVYIANVLKCRPPGNRNPEPEEVAQCAPWLERQVALLQPQLILA 211

Query: 193 IGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
           +G    +    + A    Q  G+          +P + + HP  L++ P  K   W  L
Sbjct: 212 LGRFAAHSLLGSQA-PISQLRGQVHEFAG----VPVIVSYHPAYLLRNPADKARVWRDL 265


>gi|126180274|ref|YP_001048239.1| phage SPO1 DNA polymerase-related protein [Methanoculleus
           marisnigri JR1]
 gi|125863068|gb|ABN58257.1| phage SPO1 DNA polymerase-related protein [Methanoculleus
           marisnigri JR1]
          Length = 219

 Score = 85.9 bits (211), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 48/194 (24%), Positives = 90/194 (46%), Gaps = 9/194 (4%)

Query: 71  AQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSG 130
           A    ++ EL +++     C L   +   +        DLM+IG  P   ++++G+PF G
Sbjct: 19  AGGEAAIEELAAVIGECRKCLLWENTHHAVPGEGNPRADLMLIGEAPGKQEDLTGRPFVG 78

Query: 131 KTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKIL 190
           + G +L+ +L  I + R  + I+ I    PPGNR+    E+  C P +  QI +I PK++
Sbjct: 79  RAGKLLEGLLSGIGLSRDDVFIANIVKHRPPGNRDPGEEEIRACTPYLEEQIRIIGPKVI 138

Query: 191 LFIGNKTKNF---FFNNDAQKTYQNLGK-WSNLCTPHSI--IPTLATVHPQELIQYPLIK 244
           + +G  +  +   F   +  +  +  G  +  L   H +  IPTL   HP   +  P  +
Sbjct: 139 VMLGRHSSRYILSFLPVEFDRITEIRGTVYPGLLFGHPVRLIPTL---HPAAALYNPRYR 195

Query: 245 KNTWHALITLKKAL 258
           ++     + + + L
Sbjct: 196 ESLEEDFLIIGREL 209


>gi|114319713|ref|YP_741396.1| phage SPO1 DNA polymerase-related protein [Alkalilimnicola
           ehrlichii MLHE-1]
 gi|114226107|gb|ABI55906.1| phage SPO1 DNA polymerase-related protein [Alkalilimnicola
           ehrlichii MLHE-1]
          Length = 264

 Score = 85.5 bits (210), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 88/171 (51%), Gaps = 7/171 (4%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C LC    +T+    +   DL+++G  P   ++  G+PF G+ G +LD+ML +I + R++
Sbjct: 97  CGLCEGRRNTVFGVGSRQADLVLVGEGPGAEEDKRGEPFVGQAGRLLDRMLAAIGLDRSR 156

Query: 150 IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKT 209
           ++I  +    PP NR+    E+  CRP + RQ+ L+ P++++ +G  + +   N      
Sbjct: 157 VYICNVVKCRPPRNRDPRPEEVAACRPYLERQLTLLEPRLIVALGRVSAHQLLN-----V 211

Query: 210 YQNLGKWSNLCTPHSI--IPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
              LG+       ++   +P LAT HP  L++ P  K   W  L  +++ L
Sbjct: 212 TTPLGRLRGGLHRYAPVDVPLLATYHPAYLLRNPADKARAWEDLKRIRRIL 262


>gi|217970656|ref|YP_002355890.1| phage SPO1 DNA polymerase-related protein [Thauera sp. MZ1T]
 gi|217507983|gb|ACK54994.1| phage SPO1 DNA polymerase-related protein [Thauera sp. MZ1T]
          Length = 304

 Score = 85.5 bits (210), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 79/178 (44%), Gaps = 6/178 (3%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKM 139
           L++ +R    C LC      +          M++G  P   ++  G+PF G+ G +LD M
Sbjct: 126 LEAEIRDCKACGLCERRKQAVPGVGDRQARWMLVGEAPGAEEDQRGEPFVGQAGRLLDNM 185

Query: 140 LQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTK 198
           L +I + R + ++I+      PP NR     E+  C+P + RQI L+ P++L+ +G    
Sbjct: 186 LAAIGLKRGEDVYIANAVKCRPPHNRTPERGEIAACQPYLDRQIALVQPQLLVALGRPAA 245

Query: 199 NFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
               + +   +     ++    T     P + T HP  L++ P  K   W  L   ++
Sbjct: 246 QALLDREIAISAARGKRFERAGT-----PVVVTYHPAYLLRNPQDKAKAWEDLCFARR 298


>gi|34498909|ref|NP_903124.1| DNA-directed DNA polymerase [Chromobacterium violaceum ATCC 12472]
 gi|34104758|gb|AAQ61115.1| probable DNA-directed DNA polymerase, bacteriophage-type
           [Chromobacterium violaceum ATCC 12472]
          Length = 280

 Score = 85.5 bits (210), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 85/179 (47%), Gaps = 6/179 (3%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           +L+  +    DC LC T   T+          M+IG  P ++++  G PF G+ G +LD 
Sbjct: 100 QLQRKVSDCQDCRLCETRTQTVFGRGNPQARWMLIGEAPGENEDRQGLPFVGRAGQLLDN 159

Query: 139 MLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT 197
           ML +  + R Q ++I+ +    PPGNRN +  E+  C   +++QI  I P +++ +G   
Sbjct: 160 MLSAAGLDREQDVYIANVLKCRPPGNRNPAPDEIAACNGYLLQQIRHIQPTLIVALGR-- 217

Query: 198 KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
              F      +T  ++G+       +  +P + + HP  L++    K   W  L+  +K
Sbjct: 218 ---FAAQTLLETESSIGRLRGKVHRYQGLPLVVSYHPAYLLRNQPDKAKAWQDLLLARK 273


>gi|268323165|emb|CBH36753.1| conserved hypothetical protein, uracil-DNA glycosylase superfamily
           [uncultured archaeon]
          Length = 195

 Score = 85.5 bits (210), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 67/128 (52%), Gaps = 3/128 (2%)

Query: 78  HELKSLLRSFHDCHLCS---TSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
            E+K + +   DC  C    T  + +         ++ +G  P  ++++ GKPF GK G 
Sbjct: 5   EEMKRIEKEIKDCKRCELWKTRTNPVVGEGALSARILFVGEAPGYNEDLKGKPFVGKAGK 64

Query: 135 MLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           +LD++L+SI   R  I+I+ +    PPGNRN    E+  C P +  Q+ELI P ++  +G
Sbjct: 65  VLDELLESIGWQRANIYITNVLKCRPPGNRNPLTDEIRACTPFLDAQLELIEPAVIATLG 124

Query: 195 NKTKNFFF 202
           N +  + F
Sbjct: 125 NFSLAYIF 132


>gi|332527846|ref|ZP_08403884.1| putative DNA polymerase-like protein [Rubrivivax benzoatilyticus
           JA2]
 gi|332112241|gb|EGJ12217.1| putative DNA polymerase-like protein [Rubrivivax benzoatilyticus
           JA2]
          Length = 227

 Score = 85.5 bits (210), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 84/179 (46%), Gaps = 12/179 (6%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKM 139
           L+  +     C L  +   T+          MI+G  P + +++ G+PF G  G +LD M
Sbjct: 41  LREAVAGCTACALAQSRTQTVFGVGHPQAHWMIVGEAPGEQEDLRGEPFVGAAGQLLDAM 100

Query: 140 LQSIEIMRT-------QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLF 192
           L+++ + R        +++I+      PP NRN +  E++ C P ++RQIEL+ P+I+L 
Sbjct: 101 LRALALSRAADGDPAQRVYIANTLKCRPPRNRNPAPDELQRCEPFLVRQIELVKPRIILA 160

Query: 193 IGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
           +G      F      ++ + +GK       +  +P + T HP  L++    K   W  L
Sbjct: 161 MGR-----FAVQALLRSSEPIGKLRGRVHRYQGVPLVVTYHPAYLLRNLPDKARAWDDL 214


>gi|169830501|ref|YP_001716483.1| phage SPO1 DNA polymerase-like protein [Candidatus Desulforudis
           audaxviator MP104C]
 gi|169637345|gb|ACA58851.1| phage SPO1 DNA polymerase-related protein [Candidatus Desulforudis
           audaxviator MP104C]
          Length = 207

 Score = 85.5 bits (210), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 86/186 (46%), Gaps = 5/186 (2%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L +L+ ++    +C L +   + +         LM+IG  P   ++  G+PF G  G +
Sbjct: 19  ALEDLREMMSDCRECGLHAGRTNLVFGEGHPRARLMLIGEGPGAEEDRLGRPFVGAAGRL 78

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           LD++L +  + RT+++I+ +    PPGNR  +  E + C   + +Q  LI P +++ +G+
Sbjct: 79  LDRILDAAGLARTEVYIANVVKCRPPGNRVPNREEAQACLRWLRKQFSLIGPPLVVILGS 138

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
                  +  A  T      W         +  + T HP  L++ P  K++ W     ++
Sbjct: 139 TALKNLIDPGASIT-----AWRGQWIVRGRVRFMPTYHPAALLRDPGKKRDVWRDFQLIR 193

Query: 256 KALKNL 261
            A + +
Sbjct: 194 DAYREI 199


>gi|116747914|ref|YP_844601.1| phage SPO1 DNA polymerase-like protein [Syntrophobacter
           fumaroxidans MPOB]
 gi|116696978|gb|ABK16166.1| phage SPO1 DNA polymerase-related protein [Syntrophobacter
           fumaroxidans MPOB]
          Length = 264

 Score = 85.5 bits (210), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 82/189 (43%), Gaps = 9/189 (4%)

Query: 74  ACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTG 133
           A  L  +   L     C L S     +    +    L+ +G  P   ++  G+PF G+ G
Sbjct: 58  AGGLTVIAGELEGCRRCRLHSERTRIVFGEGSAHAPLVFVGEGPGLEEDRQGRPFVGRAG 117

Query: 134 NMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFI 193
            +LD+M++++   R  ++I  +    PP NR   + E+  C P ++RQIE I P+++  +
Sbjct: 118 RLLDQMIKALGFHREAVYICNVVKCRPPKNRTPESEEIARCGPFLIRQIEAIRPRVICAL 177

Query: 194 GNKTKNFFFNNDA--QKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
           G           +   +   ++  W         IP + T HP  L++ P  K   W  L
Sbjct: 178 GACAAQTLVGTGSSISRLRGSVHYWRG-------IPLICTFHPAYLLRTPAQKAAAWEDL 230

Query: 252 ITLKKALKN 260
           I ++  LK 
Sbjct: 231 ILVRDLLKT 239


>gi|320106538|ref|YP_004182128.1| phage SPO1 DNA polymerase-like protein [Terriglobus saanensis
           SP1PR4]
 gi|319925059|gb|ADV82134.1| phage SPO1 DNA polymerase-related protein [Terriglobus saanensis
           SP1PR4]
          Length = 319

 Score = 85.1 bits (209), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 46/177 (25%), Positives = 85/177 (48%), Gaps = 11/177 (6%)

Query: 80  LKSLLRSFHDCHLCSTSLST----ICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           L+S+     DC  C  + +     + A       LM +G  P   ++ SG PF GK G +
Sbjct: 138 LQSVRHHIGDCTRCPLAYAGRRNIVFADGNPNARLMFVGEGPGADEDASGVPFVGKAGQL 197

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           L+ M+ ++ + R +++I+ I    PPGNRN   +E   C   ++ QI+++ P+I++ +G 
Sbjct: 198 LNNMINAMGLKREEVYIANIVKCRPPGNRNPEPVEANTCSQFLVDQIDIVQPQIIVALGA 257

Query: 196 KTKNFFFNNDAQKTYQNL-GKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
               +      ++    L G+W ++    + +    T HP  L++ P +K   W  L
Sbjct: 258 IAATYLLG--VKRPLVALRGQWHDVRGSKTAV----TYHPAYLLRDPSMKGEAWKDL 308


>gi|148264964|ref|YP_001231670.1| phage SPO1 DNA polymerase-related protein [Geobacter uraniireducens
           Rf4]
 gi|146398464|gb|ABQ27097.1| phage SPO1 DNA polymerase-related protein [Geobacter uraniireducens
           Rf4]
          Length = 259

 Score = 85.1 bits (209), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 80/159 (50%), Gaps = 5/159 (3%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C L  T  + +         L+ +G  P   +++ G+PF G+ G +L K++++++  R +
Sbjct: 89  CKLGETRTNLVFGVGNPHARLVFVGEAPGRDEDLQGEPFVGEAGQLLTKIIEAMQFKRNE 148

Query: 150 IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKT 209
           ++I  +    PP NRN    E+E C+P ++RQ++ I P++++ +G      F      +T
Sbjct: 149 VYICNVLKCRPPNNRNPQQDEIEQCQPFLLRQLKAIGPEVIVCLGT-----FAAQTLLET 203

Query: 210 YQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTW 248
            + + K       +  IP + T HP  L++   +K+  W
Sbjct: 204 KEPISKMRGRFHDYHGIPLMPTFHPAYLLRNAGMKREVW 242


>gi|220905704|ref|YP_002481015.1| phage SPO1 DNA polymerase-like protein [Cyanothece sp. PCC 7425]
 gi|219862315|gb|ACL42654.1| phage SPO1 DNA polymerase-related protein [Cyanothece sp. PCC 7425]
          Length = 238

 Score = 85.1 bits (209), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 89/196 (45%), Gaps = 19/196 (9%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           SL E+       H C L  +    +         +MIIG  P  +++ +G PF GK G +
Sbjct: 45  SLEEMAPHCDRCHRCDLGQSRTHAVVGRGHPQAPIMIIGEGPGQTEDETGLPFVGKAGQL 104

Query: 136 LDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           L+K+L ++++   Q ++I  I    PPGNR  +  EM  CRP ++ Q+ L+ PKI+L  G
Sbjct: 105 LEKILAAVQLDSQQDVYICNIVKCRPPGNRVPTPEEMAACRPYLLEQLRLVDPKIILLTG 164

Query: 195 NKTKNFFFNNDAQKTYQNLGKW----SNLCTPHSIIPTLATVHPQELIQYPLIKKNT--- 247
             T       D +   +  G+W      LC P         +HP  L++ P  +  +   
Sbjct: 165 -ATAVKGLTGDKRGITKIRGQWLEWEGRLCMP--------ILHPAYLLRNPSKEPGSPKW 215

Query: 248 --WHALITLKKALKNL 261
             W  + T++  L  L
Sbjct: 216 LMWQDIQTVRAKLDEL 231


>gi|268315592|ref|YP_003289311.1| phage SPO1 DNA polymerase-like protein [Rhodothermus marinus DSM
           4252]
 gi|262333126|gb|ACY46923.1| phage SPO1 DNA polymerase-related protein [Rhodothermus marinus DSM
           4252]
          Length = 263

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 47/147 (31%), Positives = 76/147 (51%), Gaps = 5/147 (3%)

Query: 109 DLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSN 168
           DLM+IG  P   ++  G+PF G  G +L+KML++I   R +++I+ +    PP NR+   
Sbjct: 110 DLMVIGEAPGAEEDRQGEPFVGPAGQLLNKMLKAIGFEREEVYITNVLKSRPPHNRDPQP 169

Query: 169 IEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPT 228
            E+E   PI+ +QI L+ P+I+L +G    N     +        GK  +    H  +P 
Sbjct: 170 DEIEAHLPILYKQIALVKPRIILCVGRIAGNALLGRNGSLRALR-GKVHDF---HG-LPV 224

Query: 229 LATVHPQELIQYPLIKKNTWHALITLK 255
           + T HP  L++ P  K+  W  L  L+
Sbjct: 225 VVTFHPAALLRNPQWKRLAWEDLQLLR 251


>gi|160931927|ref|ZP_02079320.1| hypothetical protein CLOLEP_00759 [Clostridium leptum DSM 753]
 gi|156869264|gb|EDO62636.1| hypothetical protein CLOLEP_00759 [Clostridium leptum DSM 753]
          Length = 193

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 49/175 (28%), Positives = 86/175 (49%), Gaps = 6/175 (3%)

Query: 88  HDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR 147
           H C LC    + +     E  ++M IG  P +++++ G+PF G+ G +LDKML ++++ R
Sbjct: 16  HKCGLCEGRHNVVFGIGVETAEVMFIGEGPGENEDLQGEPFVGRGGQLLDKMLAAVDLSR 75

Query: 148 TQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDA 206
            + I+I+ I    PP NR+    E E C   +  Q  LI PKI++ +G          D 
Sbjct: 76  EKNIYIANIVKCRPPQNRDPLPEEQEACIDWLRNQTALIRPKIIVCLGRIAAAKIIKPDI 135

Query: 207 QKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
           + T     K   +    + +  +AT+HP  L++ P  K   +   + L++ +  L
Sbjct: 136 KIT-----KEHGVFFEKNGVVMMATLHPAALLRNPSQKPGAFDDFLKLREKIHEL 185


>gi|320162563|ref|YP_004175788.1| uracil-DNA glycosylase [Anaerolinea thermophila UNI-1]
 gi|319996417|dbj|BAJ65188.1| uracil-DNA glycosylase [Anaerolinea thermophila UNI-1]
          Length = 217

 Score = 84.3 bits (207), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 51/178 (28%), Positives = 77/178 (43%), Gaps = 9/178 (5%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEG---QDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           LK + +   +C  C    S   A   EG    ++M+IG  P   +N  G+PF G  G  L
Sbjct: 7   LKEIAQQVSECKRCQLHYSRKKAVPGEGPAQAEIMMIGEGPGFYENEQGRPFVGAAGKFL 66

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
           D++L+   I R  + I+ +    PPGNR+    E+E C   + RQIE ISPK+++ +G  
Sbjct: 67  DELLEKCGIARKDVFITNVVKCRPPGNRDPQPEELEACNAYLERQIEAISPKVIVTLGRF 126

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITL 254
           +   F              W N      I+P     HP   +  P +K +       L
Sbjct: 127 SMAKFLPGVKISEVHGQSFWRNG---RLIVPMF---HPAAALHQPSLKASVERDFARL 178


>gi|288574896|ref|ZP_06393253.1| phage SPO1 DNA polymerase-related protein [Dethiosulfovibrio
           peptidovorans DSM 11002]
 gi|288570637|gb|EFC92194.1| phage SPO1 DNA polymerase-related protein [Dethiosulfovibrio
           peptidovorans DSM 11002]
          Length = 206

 Score = 84.3 bits (207), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 51/189 (26%), Positives = 90/189 (47%), Gaps = 14/189 (7%)

Query: 78  HELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLD 137
           HE+ S  R    C LC      +         LM +G  P + ++ SG PF G+ G +LD
Sbjct: 20  HEVSSCRR----CDLCKERTQPVLGEGPPDAALMFVGEGPGEDEDRSGIPFVGRAGRLLD 75

Query: 138 KMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT 197
           K+L++ +I R  ++I+ +    PP NR     E  +C+  +  QI +I+P+I++ +GN  
Sbjct: 76  KILEAAKIDRKGVYITNVVKCRPPKNRTPMVEETMVCQRFLEAQIAVINPRIIVCLGNTP 135

Query: 198 KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKN-----TWHALI 252
             +F    ++   +  G+W +       I  +   HP  L++    KKN     TW  ++
Sbjct: 136 MKWFLGT-SEGITKLRGQWFSW----KGIDVMPMFHPSYLLRNESRKKNSPKALTWRDIL 190

Query: 253 TLKKALKNL 261
            +++ L  L
Sbjct: 191 EVRRRLDEL 199


>gi|308271358|emb|CBX27966.1| hypothetical protein N47_G32900 [uncultured Desulfobacterium sp.]
          Length = 228

 Score = 84.3 bits (207), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 50/201 (24%), Positives = 92/201 (45%), Gaps = 10/201 (4%)

Query: 63  LVQQADSIAQKACSLHELKSLLRSFHDCHLCSTS---LSTICATQTEGQDLMIIGYTPSD 119
           +V++ D I   + SL  L S+     +C  C  S    + +  T      L  +G  P  
Sbjct: 35  VVEKLDKIT--SFSLDNLDSIRSELGECKRCKLSGGRTNIVFGTGNPNARLAFVGEGPGY 92

Query: 120 SDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIM 179
            +++ G+PF G+ G +L K++++I + R +++I  I    PP NRN    E++ C P + 
Sbjct: 93  DEDVKGEPFVGRAGQLLTKIIEAINLTRDEVYICNIIKCRPPSNRNPEPDEIKACFPFLK 152

Query: 180 RQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ 239
           RQ++ I+P  +  +G      F       T + + K       +  +  + T HP  L++
Sbjct: 153 RQLDAIAPDFICALGT-----FAAQTLLDTNEPISKLRGRLFDYRGMQVMPTYHPAYLLR 207

Query: 240 YPLIKKNTWHALITLKKALKN 260
            P  K++ W  +  L   +K 
Sbjct: 208 SPEKKRDVWEDMKKLIGMMKG 228


>gi|302342653|ref|YP_003807182.1| phage SPO1 DNA polymerase-related protein [Desulfarculus baarsii
           DSM 2075]
 gi|301639266|gb|ADK84588.1| phage SPO1 DNA polymerase-related protein [Desulfarculus baarsii
           DSM 2075]
          Length = 236

 Score = 84.3 bits (207), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 51/185 (27%), Positives = 80/185 (43%), Gaps = 8/185 (4%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQD---LMIIGYTPSDSDNISGKPFSGKTGNM 135
           EL+S+  +   C  C  +     A   +G D   LM IG  P   ++  G PF G  G +
Sbjct: 57  ELESMALAVGQCKRCPLAHGRNKAVFGQGPDDARLMFIGEAPGAQEDQQGLPFVGPAGRL 116

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           LD ML ++ + R  ++++ I    PP NR+    E+  CRP +  Q   + PK++  +G 
Sbjct: 117 LDNMLAAVGLRREAVYVTNIVKCRPPNNRDPRPEEVAACRPWLEAQARAVGPKVICTLGR 176

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
                   +DA  +    G W            L T HP  L++ P  K   +  +  L 
Sbjct: 177 PAALAVLGSDAPISALR-GNWHEALGAR----VLPTFHPAYLLRSPQRKGQAYQDMKALA 231

Query: 256 KALKN 260
            ALK+
Sbjct: 232 LALKD 236


>gi|145592499|ref|YP_001154501.1| phage SPO1 DNA polymerase-related protein [Pyrobaculum arsenaticum
           DSM 13514]
 gi|145284267|gb|ABP51849.1| phage SPO1 DNA polymerase-related protein [Pyrobaculum arsenaticum
           DSM 13514]
          Length = 192

 Score = 84.3 bits (207), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 86/186 (46%), Gaps = 5/186 (2%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L EL  ++++   C L  T  + +         +MI+G  P  S++  G+PF G  G +
Sbjct: 2   TLEELHEVIKNCTRCPLHKTRRNAVPGEGDIKLGIMIVGEAPGASEDEVGRPFVGAAGQL 61

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           L K L  + I R  ++I+ +    PPGNR  +  E+E C P +++QI ++ PK ++ +G 
Sbjct: 62  LTKALAELGIQRGDVYITNVVKCRPPGNRPPAREEVEACLPYLLKQISILKPKRVVALGA 121

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSI----IPTLATVHPQELIQYPLIKKNTWHAL 251
            +          K  + +G     C P  I    +    T HP  +++ P + ++    +
Sbjct: 122 VSAKTLLGL-VGKEVEKVGDVRGKCYPGKIAGVQLEICVTYHPAAILRNPRLGEDFRRDI 180

Query: 252 ITLKKA 257
            T  K 
Sbjct: 181 ATFFKG 186


>gi|40063236|gb|AAR38063.1| phage SPO1 DNA polymerase-related protein [uncultured marine
           bacterium 577]
          Length = 236

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 81/176 (46%), Gaps = 10/176 (5%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRT- 148
           C L      T+     +  D + IG  PS  ++  G+P  G +G +LD ML+++ + R  
Sbjct: 65  CSLFQDRTKTVFGAGDKNADWLFIGDVPSTEEDTQGEPLIGLSGELLDNMLEAVSLKRGG 124

Query: 149 QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQK 208
            I+I+      P G+R+  N E + C P ++RQIELI PK+++ +G           A  
Sbjct: 125 NIYIANTVKCRPSGDRSPDNSEEQQCEPFLIRQIELIKPKLIIVLGEIAAQNLLGTSA-- 182

Query: 209 TYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALI----TLKKALKN 260
               +         +S IP + T HP  L+Q    K+  W  L      ++K LK+
Sbjct: 183 ---TIDSLRGRLHEYSSIPLIVTYHPAYLLQIQSDKEKVWQDLCFARNIMQKELKD 235


>gi|320449933|ref|YP_004202029.1| uracil-DNA glycosylase, family 4 [Thermus scotoductus SA-01]
 gi|320150102|gb|ADW21480.1| uracil-DNA glycosylase, family 4 [Thermus scotoductus SA-01]
          Length = 205

 Score = 83.6 bits (205), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 54/192 (28%), Positives = 92/192 (47%), Gaps = 11/192 (5%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L  L++  ++   C L       +         LMI+G  P + ++ +G+PF GK G +
Sbjct: 2   TLELLQAQAKACTACRLAEGRTQVVFGEGNPDAQLMIVGEGPGEEEDKTGRPFVGKAGQL 61

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICR-PIIMRQIELISPKILLFIG 194
           L+++L++  I R  ++I+ I    PPGNR     E ++C    +++QIELI+P+I++ +G
Sbjct: 62  LNRILEAAGIPRESVYITNIVKCRPPGNRAPLPDEAKVCTDKWLLKQIELIAPQIIVPLG 121

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP-----LIKKNTWH 249
                FF       T +  G+W      H I       HP  L++ P       K  TW 
Sbjct: 122 AVAAEFFLGEKVSIT-KVRGQWFEW---HGIR-VFPMFHPAYLLRNPSRTPGSPKHLTWL 176

Query: 250 ALITLKKALKNL 261
            +  +K+AL  L
Sbjct: 177 DIQEVKRALDAL 188


>gi|291296318|ref|YP_003507716.1| phage SPO1 DNA polymerase-related protein [Meiothermus ruber DSM
           1279]
 gi|290471277|gb|ADD28696.1| phage SPO1 DNA polymerase-related protein [Meiothermus ruber DSM
           1279]
          Length = 205

 Score = 83.6 bits (205), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 90/194 (46%), Gaps = 15/194 (7%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L  L +  ++   C L       +         LMI+G  P + +++ G+PF G++G +
Sbjct: 2   NLELLAAQAKACTACGLARQRTHVVFGEGNPDAKLMIVGEGPGEDEDLQGRPFVGRSGQL 61

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPI-IMRQIELISPKILLFIG 194
           LDK+L++  I R  ++I+ I    PPGNR    +E + C  + +++QI+L+ P+I++ +G
Sbjct: 62  LDKILEAAGIPRASVYIANIVKCRPPGNRAPEPLEAKTCTSLWLVKQIQLVKPQIIIPLG 121

Query: 195 NKTKNFFFNNDAQ--KTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKN-----T 247
                FF        K      +W  +     I P     HP  L++ P  +       T
Sbjct: 122 ATALEFFAGEKLSITKARGKFFEWQGI----RIFPMF---HPAYLLRNPSREAGSPKHLT 174

Query: 248 WHALITLKKALKNL 261
           W  +  +KK L  L
Sbjct: 175 WQDIQLVKKTLDEL 188


>gi|210631731|ref|ZP_03296973.1| hypothetical protein COLSTE_00858 [Collinsella stercoris DSM 13279]
 gi|210159851|gb|EEA90822.1| hypothetical protein COLSTE_00858 [Collinsella stercoris DSM 13279]
          Length = 235

 Score = 83.6 bits (205), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 48/180 (26%), Positives = 84/180 (46%), Gaps = 10/180 (5%)

Query: 73  KACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKT 132
           +  SL E++S+L     C LC T  + +         +M +G  P  ++++ G+PF G+ 
Sbjct: 15  REVSLEEIRSVLGECRLCELCQTRTNIVFGVGNPHARVMFVGEAPGKNEDLRGEPFVGRA 74

Query: 133 GNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLF 192
           G  L+ +L    + R  I+I+ +    PPGNRN    E+  C P +  QI  I P I++ 
Sbjct: 75  GENLNGILSLAGLKREDIYIANVLKCRPPGNRNPKADEVLACSPFLREQIRSIWPDIIVT 134

Query: 193 IGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALI 252
           +GN   +F    +   T    G++  +   H ++  + T HP   ++ P      W  L+
Sbjct: 135 LGNPATHFVLKTEVGITKLR-GRFHEMG--HFVV--MPTFHPAAALRNP-----AWQELL 184


>gi|206890143|ref|YP_002248500.1| uracil-DNA glycosylase, family 4 [Thermodesulfovibrio yellowstonii
           DSM 11347]
 gi|206742081|gb|ACI21138.1| uracil-DNA glycosylase, family 4 [Thermodesulfovibrio yellowstonii
           DSM 11347]
          Length = 237

 Score = 83.6 bits (205), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 87/182 (47%), Gaps = 3/182 (1%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKM 139
           L   ++    C L ++  + +C        LM +G  P   +++ G+PF G+ G +L  +
Sbjct: 58  LNEEIKKCKKCPLSNSRKNPVCGEGNINAKLMFVGEAPGVDEDLQGRPFVGEAGKLLTSL 117

Query: 140 LQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKN 199
           ++ +   R  ++I+     HPP NR+    E+  C   + R+IE+ISP++++ +G     
Sbjct: 118 IEKMGFKREDVYITNTVKCHPPMNRDPFESEISTCFDYLKREIEIISPQVIISLGKVATY 177

Query: 200 FFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALK 259
                + +    ++ K      P++ IP + T HP  L++    KK+ W      ++AL+
Sbjct: 178 TLMGMNGKLKDLHISKLRGKVFPYNQIPVIPTFHPAYLLRN---KKDKWLTWEDAQEALR 234

Query: 260 NL 261
            L
Sbjct: 235 RL 236


>gi|332654096|ref|ZP_08419840.1| arginine biosynthesis bifunctional protein ArgJ [Ruminococcaceae
           bacterium D16]
 gi|332517182|gb|EGJ46787.1| arginine biosynthesis bifunctional protein ArgJ [Ruminococcaceae
           bacterium D16]
          Length = 188

 Score = 83.6 bits (205), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 92/184 (50%), Gaps = 6/184 (3%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           EL+    S   C L  T  + +  T     ++M+IG  P +++++ G PF G+ G +LD 
Sbjct: 5   ELEQECLSCQKCALSQTRHNVVFGTGPRDAEVMLIGEGPGENEDLQGLPFVGRGGKLLDD 64

Query: 139 MLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT 197
           ML+ I++ R + ++I+ +    PP NR+  N E + C   +  Q+ LI PKI++ +G   
Sbjct: 65  MLEVIDLSREKNVYIANMVKCRPPQNRDPLNTEQDACIGYLRNQVALIRPKIIVCLGRIA 124

Query: 198 KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKA 257
                  D + T ++ G+W       S +  +A  HP  +++ P  +  T+  L  L+  
Sbjct: 125 AMRLIKPDFKITKEH-GQWFE----KSGVQMMALFHPAAILRDPRRRPETFEDLKRLQAK 179

Query: 258 LKNL 261
           ++ +
Sbjct: 180 IQEI 183


>gi|325981465|ref|YP_004293867.1| phage SPO1 DNA polymerase-like protein [Nitrosomonas sp. AL212]
 gi|325530984|gb|ADZ25705.1| phage SPO1 DNA polymerase-related protein [Nitrosomonas sp. AL212]
          Length = 251

 Score = 83.6 bits (205), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 50/173 (28%), Positives = 80/173 (46%), Gaps = 6/173 (3%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C L  T   T+  T  +    + +G  P   ++ +G+PF G+ G +LD+ML +I++ R  
Sbjct: 70  CPLSKTRTHTVFGTGDKNASWLFVGEGPGAREDETGEPFVGQAGKLLDQMLFAIQLNRRH 129

Query: 150 -IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQK 208
            I+I+ I    PP NRN S  E   C P + +QI LI PKI++ +G          D   
Sbjct: 130 MIYITNIVKCRPPNNRNPSTYEAAQCEPFLTQQIALIKPKIIIALGKVAAQSLLKCD--- 186

Query: 209 TYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
              ++         +S IP + T HP  L++    K   W  L   +  + +L
Sbjct: 187 --NSISSLRGKIHDYSGIPLIVTYHPAYLLRSLPEKAKAWRDLCFARSVMGSL 237


>gi|296135025|ref|YP_003642267.1| phage SPO1 DNA polymerase-related protein [Thiomonas intermedia
           K12]
 gi|295795147|gb|ADG29937.1| phage SPO1 DNA polymerase-related protein [Thiomonas intermedia
           K12]
          Length = 288

 Score = 83.6 bits (205), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 83/178 (46%), Gaps = 11/178 (6%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKM 139
           L++  ++   C L S+    +  + +     MIIG  P   ++  G+PF G  G +LD M
Sbjct: 94  LQAGAQACRACKLGSSRHQAVFGSGSTQARWMIIGEAPGAEEDRQGQPFVGAAGQLLDAM 153

Query: 140 LQSIEIMRTQ------IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFI 193
           LQ+I + R+       ++I+ +    PPGNRN    E+  C P + RQ+ L+ P+++L +
Sbjct: 154 LQAIGLDRSADDPERAVYIANVLKCRPPGNRNPEPEEVGQCAPWLERQVALLQPQLILAL 213

Query: 194 GNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
           G    +    + A    Q  G+          IP + + HP  L++ P  K   W  L
Sbjct: 214 GRFAAHSLLGSQA-PISQLRGQVHEFAG----IPVIVSYHPAYLLRNPADKARVWRDL 266


>gi|328954809|ref|YP_004372142.1| phage SPO1 DNA polymerase-related protein [Coriobacterium glomerans
           PW2]
 gi|328455133|gb|AEB06327.1| phage SPO1 DNA polymerase-related protein [Coriobacterium glomerans
           PW2]
          Length = 222

 Score = 83.2 bits (204), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 84/174 (48%), Gaps = 10/174 (5%)

Query: 73  KACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKT 132
           +   L E++++L     C L  T    +  T  E   ++ IG  P  ++++ G+PF G  
Sbjct: 15  REVELREVRAVLGECRRCQLAQTRTKIVFGTGDENARVLFIGEAPGKNEDLQGEPFVGAA 74

Query: 133 GNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLF 192
           G  LD +L    + R +++I+ +    PPGNR+    E+  C P +  QI  I P +++ 
Sbjct: 75  GKNLDGILSLAGLRREEVYIANVLKCRPPGNRDPRPEEVLACAPFLREQIRSIWPDVIVT 134

Query: 193 IGNKTKNFFFNNDAQKT-----YQNLGKWSNLCTPHSIIPTLATVHP--QELIQ 239
           +GN   +F    +   T     +  +G+++ + T H   P  A  +P  Q+LI+
Sbjct: 135 MGNPATHFILKTEIGITRLRGRFHQMGRFAVMPTFH---PAAALRNPAWQDLIE 185


>gi|325967890|ref|YP_004244082.1| uracil-DNA glycosylase [Vulcanisaeta moutnovskia 768-28]
 gi|323707093|gb|ADY00580.1| predicted Uracil-DNA glycosylase [Vulcanisaeta moutnovskia 768-28]
          Length = 214

 Score = 83.2 bits (204), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 84/172 (48%), Gaps = 6/172 (3%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           EL  L+ S   C L +T    +         +MIIG  P + ++  G+PF G  G +L K
Sbjct: 15  ELVQLMLSCTKCDLHTTRKRVVPGEGPLNARIMIIGEAPGEKEDEEGRPFVGAAGQLLTK 74

Query: 139 MLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTK 198
           +L ++ I R +++I+ I    PPGNR+    E+E C+P ++ QI +I P++++ +G  + 
Sbjct: 75  LLSNVGIRREEVYITNIVKCRPPGNRDPEPNEIEACKPYLITQIFMIKPQVIICLGRHSA 134

Query: 199 N--FFFNNDAQKTYQNL----GKWSNLCTPHSIIPTLATVHPQELIQYPLIK 244
                     +K+  N+    GK  N+      +  L T HP   +  P ++
Sbjct: 135 REILVMAGYPEKSVSNISSIRGKVFNVRLGDLNVKVLPTYHPAAALYNPKLR 186


>gi|327400521|ref|YP_004341360.1| phage SPO1 DNA polymerase-like protein [Archaeoglobus veneficus
           SNP6]
 gi|327316029|gb|AEA46645.1| phage SPO1 DNA polymerase-related protein [Archaeoglobus veneficus
           SNP6]
          Length = 202

 Score = 83.2 bits (204), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 87/173 (50%), Gaps = 3/173 (1%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           SL ++++ +RS   C+L  T  + +        +++ +G  P   ++  G+PF G  G +
Sbjct: 3   SLEDIEAEIRSCKKCNLWKTKTNYVPGEGNPKAEVVFVGEAPGREEDRQGRPFVGNAGKI 62

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           L +M++ + + R  + I  I    PP NR+    E+E C P ++RQ+++I P I++ +G 
Sbjct: 63  LTEMIEKLGLRREDVFIGNILKCRPPNNRDPLPEEIEACSPYLIRQLDVIKPSIIVCLGR 122

Query: 196 KTKNF---FFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKK 245
            + +F   FF  + +   +  G+   +      +  +A  HP  ++  P +++
Sbjct: 123 HSASFLFNFFGIEFRGISKERGRVKEVERWGKKVRLIAIYHPAAILYRPQLRE 175


>gi|225849981|ref|YP_002730215.1| uracil-DNA glycosylase family 4 protein [Persephonella marina
           EX-H1]
 gi|225645579|gb|ACO03765.1| uracil-DNA glycosylase family 4 protein [Persephonella marina
           EX-H1]
          Length = 216

 Score = 82.8 bits (203), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 68/141 (48%)

Query: 69  SIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPF 128
            I +K   + ++   +++  +C L  +    +         LM IG  P   ++  G+PF
Sbjct: 29  DIKEKEKLMSQINEQIQNCTNCDLYKSRTQAVLGEGNLNAKLMFIGEAPGGEEDKQGRPF 88

Query: 129 SGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPK 188
            G+ G +L K++++    R   +I+ I    PPGNR  +  EME C P + +QIE+I PK
Sbjct: 89  VGRAGKLLTKLIEAAGYRREDFYIANICKCRPPGNRTPTPWEMERCFPYLKKQIEIIDPK 148

Query: 189 ILLFIGNKTKNFFFNNDAQKT 209
           +L  +G      F N +   T
Sbjct: 149 VLCLLGATAGRAFLNRNVAIT 169


>gi|52840517|ref|YP_094316.1| bacteriophage related DNA polymerase [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|52627628|gb|AAU26369.1| bacteriophage related DNA polymerase [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
          Length = 212

 Score = 82.8 bits (203), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 88/188 (46%), Gaps = 9/188 (4%)

Query: 74  ACSLHELKSLLRSFHDCHLCS---TSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSG 130
           +C  H L +L      C  CS   T   T+ +       LMIIG  P   ++  G+PF G
Sbjct: 26  SCEKH-LAALADEVASCVRCSLHKTRTQTVFSRGNPKAKLMIIGEAPGFYEDQKGQPFVG 84

Query: 131 KTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKIL 190
           K G +L+KM++SIE+    I+I+ +    PP NR+ +  E+  C   + RQI+LI P ++
Sbjct: 85  KAGLLLNKMIRSIEMTENDIYIANVLKCRPPNNRDPALEEISQCSSFLTRQIQLIKPHLI 144

Query: 191 LFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHA 250
           L +G     F  +         L +  N    +   P + + HP  L++ P  KK  +  
Sbjct: 145 LALGRFAGQFLLDKPLP-----LKQLRNHIHYYDNTPFIVSYHPAYLLRNPSDKKKAYID 199

Query: 251 LITLKKAL 258
            + +K  L
Sbjct: 200 WLAVKNFL 207


>gi|94970801|ref|YP_592849.1| phage SPO1 DNA polymerase-related protein [Candidatus Koribacter
           versatilis Ellin345]
 gi|94552851|gb|ABF42775.1| phage SPO1 DNA polymerase-related protein [Candidatus Koribacter
           versatilis Ellin345]
          Length = 273

 Score = 82.8 bits (203), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 65/268 (24%), Positives = 106/268 (39%), Gaps = 36/268 (13%)

Query: 5   RILSQEQILTIALFYADSGVYWVFDEP-------NNEATYESQR--KEKSIDSAIQPITN 55
           R L Q  +     FY + G+Y ++  P        N  T + Q   K+K +    +   N
Sbjct: 3   RTLDQNALSARLEFYREMGIYGLYRRPVDATAVSENPETPDEQYLPKKKEVTVTAEKTLN 62

Query: 56  IRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLC----STSLSTICATQTEGQDLM 111
           +     P + + D           LK++     DC  C          +        +LM
Sbjct: 63  VLQ---PTLSKPDG----------LKAIREDLGDCTRCVLHKQGRKQIVFGVGNPSAELM 109

Query: 112 IIGYTPSDSDNISGKPFSGKTGNMLDKML-QSIEIMRTQIHISMISPWHPPGNRNLSNIE 170
            +G  P   ++  G PF G+ G +L  M+   + + R  ++I+ +    PPGNR     E
Sbjct: 110 FVGEGPGADEDEQGIPFIGRAGQLLTNMITNGMGLKREDVYIANVVKCRPPGNRTPEREE 169

Query: 171 MEICRPIIMRQIELISPKILLFIGN-KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTL 229
            + C P + RQIE+I PK+++ +G    K     N+A    +  G+  +  TP      L
Sbjct: 170 CDTCSPFLFRQIEVIQPKMIVALGAVAAKTLLGVNEAMARLR--GQIYDFSTPRRPGSDL 227

Query: 230 ------ATVHPQELIQYPLIKKNTWHAL 251
                  T HP  L++ P  K   W  L
Sbjct: 228 YDGKLVVTYHPAYLLRDPRQKSEAWKDL 255


>gi|320334828|ref|YP_004171539.1| phage SPO1 DNA polymerase-like protein [Deinococcus maricopensis
           DSM 21211]
 gi|319756117|gb|ADV67874.1| phage SPO1 DNA polymerase-related protein [Deinococcus maricopensis
           DSM 21211]
          Length = 216

 Score = 82.8 bits (203), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 89/193 (46%), Gaps = 9/193 (4%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           ++ +L++  R    C L +T    + A       L+I+G  P   ++  G+PF G+ G +
Sbjct: 6   AIADLEATARGCTACRLRATCTQVVVADGNPDAPLLILGEGPGGDEDRLGRPFVGRAGQL 65

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEIC-RPIIMRQIELISPKILLFIG 194
           LDK+L ++ + R   +IS I    PP NR     E+E+C R  +  Q+ L+ P++++ +G
Sbjct: 66  LDKILGAVGLTRDDAYISNIVKCRPPANRTPEPDEIEVCTRLWLSGQLALLRPRVIVTLG 125

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSI--IPTLATVHPQELI----QYPLIKKN-T 247
           N    +        T +  G+W        +   P L   HP  L+    + P   K+ T
Sbjct: 126 NVPTQYMLGTRTGIT-RTRGQWYTYAQAERLWTAPLLPMFHPAYLLRNDTRAPGGPKSLT 184

Query: 248 WHALITLKKALKN 260
           W  +  +K AL  
Sbjct: 185 WRDIQAVKAALDG 197


>gi|329850866|ref|ZP_08265711.1| uracil DNA glycosylase superfamily protein [Asticcacaulis
           biprosthecum C19]
 gi|328841181|gb|EGF90752.1| uracil DNA glycosylase superfamily protein [Asticcacaulis
           biprosthecum C19]
          Length = 278

 Score = 82.4 bits (202), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 57/200 (28%), Positives = 99/200 (49%), Gaps = 16/200 (8%)

Query: 63  LVQQADSIAQKACSLHELKSLLRSFHDC---HLCSTSLSTICATQTEGQDLMIIGYTPSD 119
           ++ +A   A  A SL EL + L +F      H  +T L     T     DL+++G  P  
Sbjct: 83  VLHEAKQRAGSARSLDELYAELEAFQHMPLRHEGATQLVKFRGTADP--DLIVVGECPDA 140

Query: 120 SDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISP---WHPPGNRNLSNIEMEICRP 176
            ++ SG+ F+GK G ++DK LQ+  +    +  ++++P   W P G R L++ ++ +  P
Sbjct: 141 EEDASGQAFAGKPGALIDKALQAAGV----VERTLLTPCVFWRPAGGRPLTDEDVSLTAP 196

Query: 177 IIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNL-CTPHSIIPTLATVHPQ 235
            +   I L SPK +L +G    +   N D Q+  +  G+       P+  +P++A+  P 
Sbjct: 197 FMHALIRLASPKAILLLGAGAVSVVLNLD-QRLSELRGRVVGYHGEPN--VPSMASYPPN 253

Query: 236 ELIQYPLIKKNTWHALITLK 255
            L++ PL K   W  L+ LK
Sbjct: 254 FLLRQPLAKGLFWRDLLQLK 273


>gi|320100863|ref|YP_004176455.1| phage SPO1 DNA polymerase-like protein [Desulfurococcus mucosus DSM
           2162]
 gi|319753215|gb|ADV64973.1| phage SPO1 DNA polymerase-related protein [Desulfurococcus mucosus
           DSM 2162]
          Length = 216

 Score = 82.4 bits (202), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 88/186 (47%), Gaps = 30/186 (16%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQ---DLMIIGYTPSDSDNISGKPFSGKTG 133
           + E  SL+ S   C  C  S         EG     +M++G  P + ++ +G+PF G  G
Sbjct: 1   MDEWGSLVNSILSCKRCRLSEHRKNPVPGEGDTNSRVMLVGEAPGEREDETGRPFVGAAG 60

Query: 134 NMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFI 193
            +L ++++SI   R  ++I+ +    PP NR+  + E++ C P +++QIEL+ P++++ +
Sbjct: 61  KLLTELIESIGFKRESLYITNVVKCRPPNNRDPEDDEIKACLPYLLKQIELLKPRVIVAL 120

Query: 194 GNKTKNFFFNNDAQKTYQNLG--KWSNLCTPHS-------------IIPTLATVHPQELI 238
           G           A +T   LG  KW N+ + H              IIPT    HP   +
Sbjct: 121 GRH---------AARTLFELGGLKWVNMSSMHGKAFNAVINGVHTVIIPTF---HPAAAL 168

Query: 239 QYPLIK 244
             P +K
Sbjct: 169 YNPGLK 174


>gi|307609081|emb|CBW98520.1| hypothetical protein LPW_03501 [Legionella pneumophila 130b]
          Length = 212

 Score = 82.4 bits (202), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 54/188 (28%), Positives = 88/188 (46%), Gaps = 9/188 (4%)

Query: 74  ACSLHELKSLLRSFHDCHLCS---TSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSG 130
           +C  H L +L      C  CS   T   T+ +       LMIIG  P   ++  G+PF G
Sbjct: 26  SCEKH-LAALADEVASCVRCSLHKTRTQTVFSRGNPKAKLMIIGEAPGFYEDQKGQPFVG 84

Query: 131 KTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKIL 190
           K G +L+KM++SIE+    ++I+ +    PP NR+ +  E+  C   + RQI+LI P ++
Sbjct: 85  KAGFLLNKMIRSIEMTENDVYIANVLKCRPPNNRDPALEEISQCSSFLTRQIKLIKPHLI 144

Query: 191 LFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHA 250
           L +G     F  +         L +  N    +   P + + HP  L++ P  KK  +  
Sbjct: 145 LALGRFAGQFLLDKPLP-----LKQLRNHIHYYDNTPFIVSYHPAYLLRNPSDKKKAYID 199

Query: 251 LITLKKAL 258
            + +K  L
Sbjct: 200 WLAVKNFL 207


>gi|148358472|ref|YP_001249679.1| bacteriophage-like DNA polymerase [Legionella pneumophila str.
           Corby]
 gi|296105821|ref|YP_003617521.1| DNA polymerase bacteriophage-type [Legionella pneumophila 2300/99
           Alcoy]
 gi|148280245|gb|ABQ54333.1| bacteriophage related DNA polymerase [Legionella pneumophila str.
           Corby]
 gi|295647722|gb|ADG23569.1| DNA polymerase bacteriophage-type [Legionella pneumophila 2300/99
           Alcoy]
          Length = 212

 Score = 82.4 bits (202), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 54/188 (28%), Positives = 88/188 (46%), Gaps = 9/188 (4%)

Query: 74  ACSLHELKSLLRSFHDCHLCS---TSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSG 130
           +C  H L +L      C  CS   T   T+ +       LMIIG  P   ++  G+PF G
Sbjct: 26  SCEKH-LAALADEVASCVRCSLHKTRTQTVFSRGNPKAKLMIIGEAPGFYEDQKGQPFVG 84

Query: 131 KTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKIL 190
           K G +L+KM++SIE+    ++I+ +    PP NR+ +  E+  C   + RQI+LI P ++
Sbjct: 85  KAGFLLNKMIRSIEMTENDVYIANVLKCRPPNNRDPALEEISQCSSFLTRQIKLIKPHLI 144

Query: 191 LFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHA 250
           L +G     F  +         L +  N    +   P + + HP  L++ P  KK  +  
Sbjct: 145 LALGRFAGQFLLDKPLP-----LKQLRNHIHYYDNTPFIVSYHPAYLLRNPSDKKKAYID 199

Query: 251 LITLKKAL 258
            + +K  L
Sbjct: 200 WLAVKNFL 207


>gi|54293266|ref|YP_125681.1| hypothetical protein lpl0314 [Legionella pneumophila str. Lens]
 gi|53753098|emb|CAH14545.1| hypothetical protein lpl0314 [Legionella pneumophila str. Lens]
          Length = 200

 Score = 82.4 bits (202), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 54/188 (28%), Positives = 88/188 (46%), Gaps = 9/188 (4%)

Query: 74  ACSLHELKSLLRSFHDCHLCS---TSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSG 130
           +C  H L +L      C  CS   T   T+ +       LMIIG  P   ++  G+PF G
Sbjct: 14  SCEKH-LAALADEVASCVRCSLHKTRTQTVFSRGNPKAKLMIIGEAPGFYEDQKGQPFVG 72

Query: 131 KTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKIL 190
           K G +L+KM++SIE+    ++I+ +    PP NR+ +  E+  C   + RQI+LI P ++
Sbjct: 73  KAGFLLNKMIRSIEMTENDVYIANVLKCRPPNNRDPALEEISQCSSFLTRQIKLIKPHLI 132

Query: 191 LFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHA 250
           L +G     F  +         L +  N    +   P + + HP  L++ P  KK  +  
Sbjct: 133 LALGRFAGQFLLDKPLP-----LKQLRNHIHYYDNTPFIVSYHPAYLLRNPSDKKKAYID 187

Query: 251 LITLKKAL 258
            + +K  L
Sbjct: 188 WLAVKNFL 195


>gi|223935707|ref|ZP_03627623.1| phage SPO1 DNA polymerase-related protein [bacterium Ellin514]
 gi|223895715|gb|EEF62160.1| phage SPO1 DNA polymerase-related protein [bacterium Ellin514]
          Length = 307

 Score = 82.4 bits (202), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 56/221 (25%), Positives = 101/221 (45%), Gaps = 16/221 (7%)

Query: 49  AIQP--ITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDC-HLCSTSLSTICATQT 105
           A++P  +  I    +P+     S   K  +  +L+S   S   C HL ++  + +    +
Sbjct: 77  AVKPAALFPISPAETPITVAPLSPEAKVAAFADLRSRAMSCVKCAHLAASRKNVVFGVGS 136

Query: 106 EGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMI------SPWH 159
               LM +G  P   ++  G+PF GK G +L K++Q++ + R  ++I+ I      +P  
Sbjct: 137 IDAQLMFVGEAPGADEDEQGEPFVGKAGQLLTKIIQTMGLQRGDVYIANILKCRPDTPGQ 196

Query: 160 PPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNL 219
             GNR  ++ EM  C P +  QI+LI PK+L+ +G              T    G W+  
Sbjct: 197 SAGNRKPTSEEMATCIPYLHEQIDLIRPKVLVALGATAVEGLLGKTVGITKLR-GTWNT- 254

Query: 220 CTPHSIIPTLATVHPQELIQYPLI--KKNTWHALITLKKAL 258
              +  IP + T HP  L++   +  K+  W  ++ + + L
Sbjct: 255 ---YRGIPLMPTYHPAYLLRNQAMSEKRRVWEDMLAVMEKL 292


>gi|41615161|ref|NP_963659.1| hypothetical protein NEQ372 [Nanoarchaeum equitans Kin4-M]
 gi|40068885|gb|AAR39220.1| NEQ372 [Nanoarchaeum equitans Kin4-M]
          Length = 198

 Score = 82.4 bits (202), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 81/160 (50%), Gaps = 3/160 (1%)

Query: 78  HELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLD 137
            EL+  + +   C L   + + +     +  D++ IG  P + ++  GKPF G+ G +L+
Sbjct: 4   EELEKQILNCKKCPLYKYARNKVIGDGNKNSDIVFIGEAPGEEEDKQGKPFVGRAGQLLN 63

Query: 138 KMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN-K 196
           K+L+ I + R QI+I+ +    PP NR+    E+E C+P ++ Q++LI P  ++ +G   
Sbjct: 64  KLLEKIGLTRDQIYITNVLKCRPPNNRDPKEEEIEACKPYLVIQLDLIKPTYIVTLGRFA 123

Query: 197 TKNFF--FNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHP 234
           TK  F  F        +  GK   +   + I+    T+HP
Sbjct: 124 TKEIFDLFGLKFSSITKVRGKPYYVRRWNKIVTIFPTLHP 163


>gi|300087337|ref|YP_003757859.1| phage SPO1 DNA polymerase-like protein [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
 gi|299527070|gb|ADJ25538.1| phage SPO1 DNA polymerase-related protein [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
          Length = 214

 Score = 82.4 bits (202), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 87/186 (46%), Gaps = 11/186 (5%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEGQ---DLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L+ + R    C  C  +     A   EG    ++M IG  P  +++ +G+PF G  G  L
Sbjct: 9   LEDIAREIGSCEACGLASGRNQAVPGEGHAETEIMFIGEAPGFNEDRTGRPFCGAAGQFL 68

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
            +M++SI + R Q++I+ I    PPGNR+    E+  CR  + RQ+  I P++++ +G  
Sbjct: 69  TQMIESIGLNRNQVYITNIVKCRPPGNRDPLPEEITACRHWLDRQLAAIRPRVVVTLGRY 128

Query: 197 TKNFFFNNDAQKTYQNL-GKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
           + + FF     KT   + G+W         +  LA  HP   +    ++      +  L 
Sbjct: 129 SMSRFFPG---KTISRIHGQWEK----QGDLVCLAMYHPAAALHQGSLRATILADMARLP 181

Query: 256 KALKNL 261
           + +K L
Sbjct: 182 EIIKEL 187


>gi|54296304|ref|YP_122673.1| hypothetical protein lpp0333 [Legionella pneumophila str. Paris]
 gi|53750089|emb|CAH11481.1| hypothetical protein lpp0333 [Legionella pneumophila str. Paris]
          Length = 200

 Score = 82.4 bits (202), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 54/188 (28%), Positives = 89/188 (47%), Gaps = 9/188 (4%)

Query: 74  ACSLHELKSLLRSFHDCHLCS---TSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSG 130
           +C  H L +L      C  CS   T   T+ +       LMIIG  P   ++  G+PF G
Sbjct: 14  SCEKH-LATLADEVASCVRCSLHKTRTQTVFSRGNPKAKLMIIGEAPGFYEDQKGQPFVG 72

Query: 131 KTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKIL 190
           K G +L+KM++SIE+    ++I+ +    PP NR+ +  E+  C   + RQI+LI P ++
Sbjct: 73  KAGFLLNKMIRSIEMTENDVYIANVLKCRPPNNRDPALEEISQCSSFLTRQIKLIKPHLI 132

Query: 191 LFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHA 250
           L +G     F  +         L +  N    ++  P + + HP  L++ P  KK  +  
Sbjct: 133 LALGRFAGQFLLDKPLP-----LKQLRNHIHYYNNTPFIVSYHPAYLLRNPSDKKKAYID 187

Query: 251 LITLKKAL 258
            + +K  L
Sbjct: 188 WLAVKSFL 195


>gi|171186390|ref|YP_001795309.1| phage SPO1 DNA polymerase-related protein [Thermoproteus
           neutrophilus V24Sta]
 gi|170935602|gb|ACB40863.1| phage SPO1 DNA polymerase-related protein [Thermoproteus
           neutrophilus V24Sta]
          Length = 190

 Score = 82.0 bits (201), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 81/169 (47%), Gaps = 12/169 (7%)

Query: 84  LRSFHD----CHLCSTSLSTICATQTEGQ---DLMIIGYTPSDSDNISGKPFSGKTGNML 136
           + + HD    C  C   L    A   EG+    +M++G  P  +++  G+PF G  G++L
Sbjct: 1   MEALHDAIRRCTKCPLHLHRRNAVPGEGRARLGVMVVGEAPGAAEDAEGRPFVGAAGSLL 60

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
            K L  + + R  ++I+ +    PP NR  +  E+E C P +++QIEL+ P+ +L +G  
Sbjct: 61  TKTLAKLGVSRDDLYITNVVKCRPPNNRTPTREEVEACLPYLLKQIELVKPRRVLALGLV 120

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSI----IPTLATVHPQELIQYP 241
           +         ++  + +G+    C P  I    +    T HP  +++ P
Sbjct: 121 SAKALLGLIGREV-EKVGEVRGRCFPGRISGVELEVCVTYHPAAVLRNP 168


>gi|259418076|ref|ZP_05741995.1| uracil-DNA glycosylase [Silicibacter sp. TrichCH4B]
 gi|259346982|gb|EEW58796.1| uracil-DNA glycosylase [Silicibacter sp. TrichCH4B]
          Length = 134

 Score = 82.0 bits (201), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 38/116 (32%), Positives = 67/116 (57%), Gaps = 1/116 (0%)

Query: 64  VQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNI 123
           V +A  +A+ A +L  L++ L +F  C L   + + + +    G  +MIIG  P   +++
Sbjct: 9   VAEAVKLAKSADALPGLRAALETFEHCDLKRGARNLVFSDGQAGARVMIIGEAPGRDEDL 68

Query: 124 SGKPFSGKTGNMLDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPII 178
            GKPF G+ G +LDKML +I++ R + ++I+ + PW PP NR+     + IC  ++
Sbjct: 69  QGKPFVGRAGQLLDKMLAAIDLSRDENVYITNVLPWRPPQNRDPLPAALVICSDVL 124


>gi|149921262|ref|ZP_01909718.1| phage SPO1 DNA polymerase-related protein [Plesiocystis pacifica
           SIR-1]
 gi|149817922|gb|EDM77384.1| phage SPO1 DNA polymerase-related protein [Plesiocystis pacifica
           SIR-1]
          Length = 464

 Score = 82.0 bits (201), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 83/191 (43%), Gaps = 13/191 (6%)

Query: 51  QPITNIRHIHSPLVQQADS--IAQKACSLHELKSLLRSFHDCHLC---STSLSTICATQT 105
           QP  N       L +QA+    A+K   L +     RS  DC  C    T  + +     
Sbjct: 214 QPDANANANKGTLRRQAEQWPAAKKLAYLRD-----RSVGDCRRCRLAETRRNLVFGVGN 268

Query: 106 EGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRN 165
              D+M +G  P   ++  G+PF G  G  LD  L  + + R++++I+ +    PPGNR+
Sbjct: 269 PDADMMFVGEAPGAEEDRRGEPFVGAAGQRLDAWLHELGLQRSEVYIANVLKCRPPGNRD 328

Query: 166 LSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSI 225
              +E++ C P +  QI  I P++L+ +G        +    K YQ  G       P + 
Sbjct: 329 PHPVEIQRCSPFLHAQIRAIQPRVLVALGRFAGCLLLDRQL-KMYQMRGSVHRYREPKTG 387

Query: 226 --IPTLATVHP 234
              P + T HP
Sbjct: 388 TEFPLVVTYHP 398


>gi|146304819|ref|YP_001192135.1| phage SPO1 DNA polymerase-like protein [Metallosphaera sedula DSM
           5348]
 gi|145703069|gb|ABP96211.1| phage SPO1 DNA polymerase-related protein [Metallosphaera sedula
           DSM 5348]
          Length = 211

 Score = 82.0 bits (201), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 50/180 (27%), Positives = 85/180 (47%), Gaps = 19/180 (10%)

Query: 90  CHLCSTSLSTICATQTEGQ---DLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQS-IEI 145
           CH CS S +   A   EG    D++ +G  P   ++ +G+PF G  G +L ++++  +  
Sbjct: 14  CHKCSLSRTRTHAVPGEGNPTSDVVFVGEAPGAKEDETGRPFVGSAGQLLTELIRKYLRR 73

Query: 146 MRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNND 205
            R++I+I+ I    PP NR+    E+E C P ++ QI LI PK+++ +G  +  FF    
Sbjct: 74  DRSEIYITNIVKCRPPNNRDPEKEEIEACSPYLLTQIRLIKPKVIVTLGRHSTGFF---- 129

Query: 206 AQKTYQNL---------GKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
             +T   L         GK  +L   +  +    T HP   +  P +K++       L K
Sbjct: 130 --QTLAGLPLTPISRCHGKPFHLDLGYGTVTVFPTYHPAAALYNPPLKRDLEEDFQRLSK 187


>gi|297170986|gb|ADI22001.1| uracil-DNA glycosylase [uncultured myxobacterium HF0200_01L06]
          Length = 257

 Score = 82.0 bits (201), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 46/205 (22%), Positives = 90/205 (43%), Gaps = 12/205 (5%)

Query: 51  QPITNIRHIHSPLVQQADSI------AQKACSLHELKSLLRSFHDCHLCSTSLSTICATQ 104
           +P+     + SP   Q+ ++       Q    L ++++ L     C L       +    
Sbjct: 43  KPVEEEPALASPTAAQSTALPTPGPLTQTRPDLAQVRATLGECTRCALSEKRTQIVFGDG 102

Query: 105 TEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQ-SIEIMRTQIHISMISPWHPPGN 163
               D++ +G  P + +++ G PF G+ G +L +M++  + + R  ++I  I    PPGN
Sbjct: 103 NPDADILFVGEGPGEQEDLRGLPFVGRAGELLTQMIEKGMGLARQDVYICNIVKCRPPGN 162

Query: 164 RNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPH 223
           RN    E+  CRP +  QI+ ++P++++ +G    +     D   T    G W      +
Sbjct: 163 RNPLPTEVNACRPFLDGQIDAVAPRVIVSLGKPAASLLLGRDVAITRVR-GTWHE----Y 217

Query: 224 SIIPTLATVHPQELIQYPLIKKNTW 248
             I  + T+HP  L++    +   W
Sbjct: 218 RGIALMPTLHPAYLLRQYTAENRRW 242


>gi|256371255|ref|YP_003109079.1| phage SPO1 DNA polymerase-related protein [Acidimicrobium
           ferrooxidans DSM 10331]
 gi|256007839|gb|ACU53406.1| phage SPO1 DNA polymerase-related protein [Acidimicrobium
           ferrooxidans DSM 10331]
          Length = 189

 Score = 82.0 bits (201), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 67/136 (49%), Gaps = 4/136 (2%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQD---LMIIGYTPSDSDNISGKPFSGKT 132
            L EL++L      CH C  S     A   EG     L+++G  P   ++  G+PF G++
Sbjct: 2   GLPELEALEAEVRACHACRLSAGRHQAVPGEGAAPAPLLVVGEGPGAREDELGRPFVGRS 61

Query: 133 GNMLDKML-QSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILL 191
           G +LD +L     + R+ ++I+      PPGNR     E+E CR  + RQI L+ P +++
Sbjct: 62  GQLLDALLADETGLDRSGLYIANTVKCRPPGNRTPRPDEVEACRGFLARQIHLVDPVVIV 121

Query: 192 FIGNKTKNFFFNNDAQ 207
            +G     +F    A+
Sbjct: 122 ALGQSAAAWFLGPGAR 137


>gi|46198674|ref|YP_004341.1| uracil-DNA glycosylase [Thermus thermophilus HB27]
 gi|21464612|emb|CAD29336.1| uracil-DNA glycosylase [Thermus thermophilus HB27]
 gi|46196297|gb|AAS80714.1| uracil-DNA glycosylase [Thermus thermophilus HB27]
          Length = 205

 Score = 82.0 bits (201), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 55/192 (28%), Positives = 92/192 (47%), Gaps = 11/192 (5%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L  L++  ++   C L       +         LMI+G  P + ++ +G+PF GK G +
Sbjct: 2   TLELLQAQAQNCTACRLAEGRTRVVFGEGNPDAKLMIVGEGPGEEEDKTGRPFVGKAGQL 61

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICR-PIIMRQIELISPKILLFIG 194
           L+++L++  I R +++I+ I    PP NR     E +IC    +++QIELI+P+I++ +G
Sbjct: 62  LNRILEAAGIPREEVYITNIVKCRPPQNRAPLPDEAKICTDKWLLKQIELIAPQIIVPLG 121

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP-----LIKKNTWH 249
                FF       T +  GKW      H I       HP  L++ P       K  TW 
Sbjct: 122 AVAAEFFLGEKVSIT-KVRGKWYEW---HGIK-VFPMFHPAYLLRNPSRAPGSPKHLTWL 176

Query: 250 ALITLKKALKNL 261
            +  +K+AL  L
Sbjct: 177 DIQEVKRALDAL 188


>gi|56751576|ref|YP_172277.1| bacteriophage-type DNA polymerase [Synechococcus elongatus PCC
           6301]
 gi|81301352|ref|YP_401560.1| phage SPO1 DNA polymerase-related protein [Synechococcus elongatus
           PCC 7942]
 gi|56686535|dbj|BAD79757.1| DNA polymerase bacteriophage-type [Synechococcus elongatus PCC
           6301]
 gi|81170233|gb|ABB58573.1| phage SPO1 DNA polymerase-related protein [Synechococcus elongatus
           PCC 7942]
          Length = 235

 Score = 82.0 bits (201), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 54/224 (24%), Positives = 99/224 (44%), Gaps = 15/224 (6%)

Query: 48  SAIQPITNI-RHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTE 106
           +A +P+ +    +    +  + SI   A +   ++ LL   + C  C    +   A    
Sbjct: 13  AAAEPVADAPATVDRAAIPTSASIPIPAGTFSTVEELLEPCNACQRCGLGQTRTHAVVGR 72

Query: 107 GQ---DLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ-IHISMISPWHPPG 162
           G     LM+IG  P +++++ G PF GK G +LD++L ++ +   + ++I+ I    PPG
Sbjct: 73  GNPQAKLMVIGEGPGENEDLQGLPFVGKAGQLLDRILAAVSLDSNRDVYIANIVKCRPPG 132

Query: 163 NRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTP 222
           NR  +  EM  C P +  Q+ L+ PKI+L  G         +      + + K   L   
Sbjct: 133 NRKPTPEEMAACVPYLQEQVRLVQPKIILLAGATAVQGLLGDK-----RGITKIRGLWME 187

Query: 223 HSIIPTLATVHPQELIQYPLIKKNT-----WHALITLKKALKNL 261
              I  +   HP  L++ P  ++ +     W  +  +K+ L  L
Sbjct: 188 WQGIACMPVFHPAYLLRNPSKEQGSPKWLMWQDIQEVKRRLDEL 231


>gi|57642078|ref|YP_184556.1| Uracil-DNA glycosylase [Thermococcus kodakarensis KOD1]
 gi|57160402|dbj|BAD86332.1| Uracil-DNA glycosylase [Thermococcus kodakarensis KOD1]
          Length = 196

 Score = 81.6 bits (200), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 91/188 (48%), Gaps = 3/188 (1%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           + +L+  +R+   C L +   + +    +    +M +G  P   ++  G PF G+ G +L
Sbjct: 9   MKKLEEKIRNCQKCPLGTLRTNAVPGAGSYDAKVMFVGEAPGYWEDQKGLPFVGRAGKLL 68

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
           D++L  I + R +++I+ I    PP NR+ +  E++ C P + RQI++I PK+++ +G  
Sbjct: 69  DELLAEIGLSRDEVYITNIVKCRPPENRDPTEEEIKACSPYLDRQIDIIRPKVIIPLGRY 128

Query: 197 TKNFF---FNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALIT 253
           + N+    F  + +   +  GK     T    I  +   HP   +  P +++        
Sbjct: 129 SMNYLLRKFGFEPEPISRIHGKTFEAHTLFGKIIIMPMYHPAAALYKPPLREELRKDFQK 188

Query: 254 LKKALKNL 261
           LK  L+N+
Sbjct: 189 LKSLLENI 196


>gi|317970146|ref|ZP_07971536.1| phage SPO1 DNA polymerase-related protein [Synechococcus sp.
           CB0205]
          Length = 199

 Score = 81.6 bits (200), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 55/193 (28%), Positives = 90/193 (46%), Gaps = 14/193 (7%)

Query: 78  HELKSLLRSFHDCHLC--STSLSTICATQTEGQ-DLMIIGYTPSDSDNISGKPFSGKTGN 134
            +L SL  S   C LC   +S S +  ++   Q  LM+IG  P   ++  G+PF G++G 
Sbjct: 8   QDLASLAESCDACRLCKLGSSRSQVVVSRGNPQARLMVIGEGPGAQEDEQGQPFVGRSGQ 67

Query: 135 MLDKMLQSIEIMRT-QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFI 193
           +LD+ML+S+ I      ++  I    PP NR  + +EM  C+P + RQI L+ P ++L  
Sbjct: 68  LLDRMLESVGIDSNHDAYVCNIVKCRPPENRKPTALEMASCKPWLDRQIALVDPAVILLA 127

Query: 194 GNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKN-----TW 248
           G              T +  G+W        ++P     HP  L++ P  ++      TW
Sbjct: 128 GATAVEGLLGIKGGMT-KIRGQWRQW-EGRWLMPVF---HPSYLLRNPSKERGAPKWLTW 182

Query: 249 HALITLKKALKNL 261
             L  +++ L  L
Sbjct: 183 QDLQDVQRRLAQL 195


>gi|210620993|ref|ZP_03292378.1| hypothetical protein CLOHIR_00321 [Clostridium hiranonis DSM 13275]
 gi|210154977|gb|EEA85983.1| hypothetical protein CLOHIR_00321 [Clostridium hiranonis DSM 13275]
          Length = 194

 Score = 81.6 bits (200), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 85/182 (46%), Gaps = 5/182 (2%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKM 139
           L+S  ++ + C L     + +         +++IG  P + +++SG PF G  G +LDKM
Sbjct: 10  LESACKTCNRCRLAENRTNVVVGGGNRKAKILLIGEGPGEKEDLSGVPFVGPAGQLLDKM 69

Query: 140 LQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKN 199
           L  I++ R  ++I+ +    PPGNR+    E   C   +  Q  LI P+I++ +G     
Sbjct: 70  LACIDLSRNDVYIANVVKCRPPGNRDPEPDEKNCCIEYLRYQFALIKPQIIVCLGRIAAQ 129

Query: 200 FFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALK 259
              ++  + T ++ G W            +AT HP  L++    K+  +  L  +KK + 
Sbjct: 130 SIIDSKFRITKEH-GIWYK----KKNCWMIATYHPSALLRDAAKKRTAFEDLKEIKKKID 184

Query: 260 NL 261
            L
Sbjct: 185 EL 186


>gi|268679863|ref|YP_003304294.1| phage SPO1 DNA polymerase-related protein [Sulfurospirillum
           deleyianum DSM 6946]
 gi|268617894|gb|ACZ12259.1| phage SPO1 DNA polymerase-related protein [Sulfurospirillum
           deleyianum DSM 6946]
          Length = 220

 Score = 81.6 bits (200), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 101/187 (54%), Gaps = 7/187 (3%)

Query: 74  ACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTG 133
           +C+L ELK+ +   H C L  +  + I         +M IG  PS S++ +G  FSGK+G
Sbjct: 39  SCNLEELKATVAQCHLCALSKSRKNIIFGAGNLKAKVMFIGDNPSVSEDETGMLFSGKSG 98

Query: 134 NMLDKMLQSIEIM-RTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLF 192
            +L KM++++ ++ + +++++ I     P NR  +  E+  C+P +M+QI+LI PKI++ 
Sbjct: 99  ELLAKMIENVLLIPKEEVYVTHILKCKTPENRVPTPEEVACCKPYMMQQIQLIQPKIIVT 158

Query: 193 IGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHS-IIPTLATVHPQELIQYPLIKKNTWHAL 251
           +G  + +F       +T  +  + S L    + +IPT    HP  L++ P  KK  +  L
Sbjct: 159 LG--STSFHHLTGEYETPMDTIRGSVLHFGEAKLIPTF---HPNFLLRNPSAKKEVYADL 213

Query: 252 ITLKKAL 258
           + ++  L
Sbjct: 214 LKVRSML 220


>gi|189219157|ref|YP_001939798.1| Uracil-DNA glycosylase [Methylacidiphilum infernorum V4]
 gi|189186015|gb|ACD83200.1| Uracil-DNA glycosylase [Methylacidiphilum infernorum V4]
          Length = 276

 Score = 81.6 bits (200), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 49/183 (26%), Positives = 87/183 (47%), Gaps = 13/183 (7%)

Query: 80  LKSLLRSFHDC-HLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           LK  + +  +C HL S    T+  T     +LM +G  P   +++ G+PF G  G +L K
Sbjct: 79  LKEKVEACRNCPHLVSFRTQTVFGTGNPYAELMFVGEAPGAEEDLQGEPFVGPAGQLLTK 138

Query: 139 MLQSIEIMRTQIHISMISPWHP------PGNRNLSNIEMEICRPIIMRQIELISPKILLF 192
           M++++ + R Q++I+ +    P       GNR  +  EM  C P ++ Q++LI+PK+++ 
Sbjct: 139 MIRAMGLSREQVYIANVLKCRPDIPKGQKGNRKPTTEEMSTCLPYLLSQLKLINPKVIVA 198

Query: 193 IGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLI--KKNTWHA 250
           +G             K  +  G+    C   +    + T HP  L+  P +  K+  W  
Sbjct: 199 LGATAYEGLTGKVGIKISEVRGR----CFSFNGATLIPTYHPSFLLHNPSLTNKRKVWED 254

Query: 251 LIT 253
           L+T
Sbjct: 255 LLT 257


>gi|254424996|ref|ZP_05038714.1| uracil-DNA glycosylase, family 4 [Synechococcus sp. PCC 7335]
 gi|196192485|gb|EDX87449.1| uracil-DNA glycosylase, family 4 [Synechococcus sp. PCC 7335]
          Length = 233

 Score = 81.6 bits (200), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 77/171 (45%), Gaps = 13/171 (7%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           SL  L    +S   C L  T  + + +       +M+IG  P   ++  G PF G++G +
Sbjct: 42  SLTPLAVHCKSCQRCELAQTRTNVVVSRGNPNAPIMVIGEGPGQQEDEQGLPFVGRSGQL 101

Query: 136 LDKMLQSIEI-MRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           L+K+L ++ +     ++I  I    PPGNRN    E+  CRP I+ QI L+ PKI+L  G
Sbjct: 102 LEKILGAVRLDTEKDVYICNIVKCRPPGNRNPLASEINACRPYILEQIRLVDPKIILLTG 161

Query: 195 NKTKNFFFNNDAQKTYQNLGKW----SNLCTPHSIIPTLATVHPQELIQYP 241
                    ++ +   +  G W       C P         +HP  L++ P
Sbjct: 162 ATAVKGIIPSEKRGITKIRGTWIEWEGRQCMP--------ILHPAYLLRNP 204


>gi|257785043|ref|YP_003180260.1| phage SPO1 DNA polymerase-like protein [Atopobium parvulum DSM
           20469]
 gi|257473550|gb|ACV51669.1| phage SPO1 DNA polymerase-related protein [Atopobium parvulum DSM
           20469]
          Length = 221

 Score = 81.6 bits (200), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 84/172 (48%), Gaps = 5/172 (2%)

Query: 72  QKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGK 131
           Q   +L E+   +     C L  T  + +         +MI+G  P  ++++SG+PF G 
Sbjct: 30  QAGQTLDEICEQIADCKKCPLWETRTNIVFGGPNPTARIMIVGEAPGKNEDLSGQPFVGT 89

Query: 132 TGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILL 191
           +G  LD +L+ + +    + IS +    PP NRN    E+E C P +  QI  I P +++
Sbjct: 90  SGKKLDALLEEVGLSHQDVFISNVVKCRPPSNRNPKVAEVEECSPYLRDQIRAIKPDVIV 149

Query: 192 FIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTL---ATVHPQELIQY 240
            +GN    F  + D   T +  GK+  +    S++PT+   +T++ +E  Q+
Sbjct: 150 CLGNFATQFVMHTDKGVT-ELRGKFYQIGA-FSVLPTMHPASTIYRKEWAQF 199


>gi|317121114|ref|YP_004101117.1| phage SPO1 DNA polymerase-related protein [Thermaerobacter
           marianensis DSM 12885]
 gi|315591094|gb|ADU50390.1| phage SPO1 DNA polymerase-related protein [Thermaerobacter
           marianensis DSM 12885]
          Length = 333

 Score = 81.6 bits (200), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 42/175 (24%), Positives = 82/175 (46%), Gaps = 6/175 (3%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
            +  L+ +++    C L +     +         LM+IG  P   ++  G+PF G+ G +
Sbjct: 13  DMAALEQVVKGCTACRLRAGCRGVVFGDGNPAARLMLIGEGPGADEDRLGRPFVGRAGQL 72

Query: 136 LDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           LD++L +    R + ++I+ +    PPGNR  +  E   C P +  Q+ L++P I++ +G
Sbjct: 73  LDRILAACGFDRQRHVYIANVVKCRPPGNRTPTPDERAACLPNLRAQMRLVNPVIVVLLG 132

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWH 249
           +       +  A+ T     +W         +  + T HP  L++ P +K++ WH
Sbjct: 133 STALQALIDPAARIT-----RWRGQWIHRDGVWYMPTYHPAALLRNPSLKRDCWH 182


>gi|315231723|ref|YP_004072159.1| uracil-DNA glycosylase [Thermococcus barophilus MP]
 gi|315184751|gb|ADT84936.1| uracil-DNA glycosylase [Thermococcus barophilus MP]
          Length = 194

 Score = 81.6 bits (200), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 90/187 (48%), Gaps = 3/187 (1%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           + +L+  +R+   C L +   + +  + +    +M +G  P   ++  G PF G+ G +L
Sbjct: 7   MKKLEERIRNCKKCPLSALRTNAVPGSGSYDAKVMFVGEAPGYWEDQKGLPFVGRAGKVL 66

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
           D++L  I + R  ++I+ I    PP NR+ +  E++ C P + RQI++I PKI++ +G  
Sbjct: 67  DELLSEIGLKREDVYITNIVKCRPPNNRDPNEDEIKACSPYLDRQIDIIRPKIIVPLGRH 126

Query: 197 TKNFF---FNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALIT 253
           + ++    F  +A+   +  GK     T    +  +   HP   +  P +K+        
Sbjct: 127 SMSYILRKFGFEAEPISRIHGKTFEARTLFGKVIIMPMYHPAVALYRPQLKEELRKDFKK 186

Query: 254 LKKALKN 260
           LK  L N
Sbjct: 187 LKNVLMN 193


>gi|258646788|ref|ZP_05734257.1| uracil-DNA glycosylase, family 4 [Dialister invisus DSM 15470]
 gi|260404216|gb|EEW97763.1| uracil-DNA glycosylase, family 4 [Dialister invisus DSM 15470]
          Length = 248

 Score = 81.3 bits (199), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 52/182 (28%), Positives = 83/182 (45%), Gaps = 12/182 (6%)

Query: 83  LLRSFHDCHLC----STSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           L  + H C LC          + +T      LMI+G  P   ++  G P  G +G +LDK
Sbjct: 33  LENAIHRCRLCPLCNEGGRGPVLSTGPVDAPLMIVGEGPGGVEDEYGGPLVGPSGQLLDK 92

Query: 139 MLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEIC-RPIIMRQIELISPKILLFIGNKT 197
            L S+ I R  ++++ I    P GNR  +  E   C R  +  +I L+ PK+++ +G   
Sbjct: 93  ALLSVGITRDHVYVTNIVKCRPRGNRTPTIAEGNECGRRWLAEEIRLLQPKVIIALGKVA 152

Query: 198 KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQY--PLIKKNTWHALITLK 255
             FF  +DA    ++ G W +    +  IP + T HP  L++     +K+  W     LK
Sbjct: 153 LRFFLGHDA-GIIRSRGHWID----YKGIPVMPTFHPAYLLRQTGEGLKEAKWQVYYDLK 207

Query: 256 KA 257
            A
Sbjct: 208 AA 209


>gi|297527109|ref|YP_003669133.1| phage SPO1 DNA polymerase-related protein [Staphylothermus
           hellenicus DSM 12710]
 gi|297256025|gb|ADI32234.1| phage SPO1 DNA polymerase-related protein [Staphylothermus
           hellenicus DSM 12710]
          Length = 212

 Score = 81.3 bits (199), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 55/193 (28%), Positives = 94/193 (48%), Gaps = 23/193 (11%)

Query: 78  HELKSLLRSFHDCHLCSTSLSTICATQTEG---QDLMIIGYTPSDSDNISGKPFSGKTGN 134
           +EL  L      C  C+  LS   A   EG    D+M +G  P   ++ +G+PF G  G 
Sbjct: 7   NELARLAEEIKKCRKCTLYLSRKNAVPGEGPCNADVMFVGEAPGSKEDETGRPFVGAAGK 66

Query: 135 MLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           +L ++L+ I + R+ ++I+ +    PP NR+ +  E+E C P ++RQI++I PKI++ +G
Sbjct: 67  LLMQLLELIGLKRSDVYITNVVKCRPPNNRDPTPEEIEACSPYLIRQIKIIKPKIIVALG 126

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSI----------IPTLATVHPQELIQYPLIK 244
             +  F F+           KWSN+   H            +  +AT HP   +  P ++
Sbjct: 127 RHSARFLFSRAGL-------KWSNMRRMHGKVFSARIDGVEVKIMATYHPAAALYSPKLR 179

Query: 245 ---KNTWHALITL 254
              +N +  L +L
Sbjct: 180 PDLENDFRVLESL 192


>gi|188997005|ref|YP_001931256.1| phage SPO1 DNA polymerase-related protein [Sulfurihydrogenibium sp.
           YO3AOP1]
 gi|188932072|gb|ACD66702.1| phage SPO1 DNA polymerase-related protein [Sulfurihydrogenibium sp.
           YO3AOP1]
          Length = 217

 Score = 81.3 bits (199), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 76/156 (48%), Gaps = 5/156 (3%)

Query: 59  IHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQ---DLMIIGY 115
           +  P++ Q  S   +   + EL  +      C  C    S       EG     +M IG 
Sbjct: 20  LDKPILNQKSS--NQIDKIEELNKIYEEIKVCTKCDLHKSRTNPVLGEGNINAKIMFIGE 77

Query: 116 TPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICR 175
            P + ++  G+PF G+ G +L K +++   +R +++I+ I+   PP NR  +  E E C 
Sbjct: 78  APGEEEDKQGRPFVGRAGKLLTKCIENAGHIREEVYIANINKCRPPNNRTPTIEEQEACI 137

Query: 176 PIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQ 211
           P ++RQIE+I+PK+L  +G       F  +A+ T +
Sbjct: 138 PFLLRQIEIINPKVLCLLGATAYRGIFKKEAKITKE 173


>gi|325283880|ref|YP_004256421.1| phage SPO1 DNA polymerase-related protein [Deinococcus
           proteolyticus MRP]
 gi|324315689|gb|ADY26804.1| phage SPO1 DNA polymerase-related protein [Deinococcus
           proteolyticus MRP]
          Length = 224

 Score = 81.3 bits (199), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 51/205 (24%), Positives = 94/205 (45%), Gaps = 9/205 (4%)

Query: 64  VQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNI 123
           + + D  A    +L EL+   +    C L +  L  + A  T   DL+IIG  P   ++ 
Sbjct: 3   IPERDLWAPDLRALDELERENKGCTACPLRAGCLQVVVADGTPAADLLIIGEGPGGDEDR 62

Query: 124 SGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIM-RQI 182
           +G+PF G+ G +LD++L ++++ R   +I+ I    PP NR  +  E++ C  + + RQ+
Sbjct: 63  TGRPFVGRAGQLLDRILAAVDLRREDTYITNIVKCRPPANRAPTPPEIQTCTELWLNRQL 122

Query: 183 ELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHS--IIPTLATVHPQELIQY 240
            L+ P++++ +GN           Q   +  G+W     P S      +   HP  L++ 
Sbjct: 123 ALLRPRVIVTMGNTPTRHLLGTQ-QGITRLRGQWHPYRLPGSDATAALMPMFHPAYLLRN 181

Query: 241 PLIKKN-----TWHALITLKKALKN 260
               K      TW  ++ +   L+ 
Sbjct: 182 DTRVKGGPKSLTWGDILEVAGVLRG 206


>gi|296120473|ref|YP_003628251.1| phage SPO1 DNA polymerase-related protein [Planctomyces limnophilus
           DSM 3776]
 gi|296012813|gb|ADG66052.1| phage SPO1 DNA polymerase-related protein [Planctomyces limnophilus
           DSM 3776]
          Length = 305

 Score = 81.3 bits (199), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 82/178 (46%), Gaps = 11/178 (6%)

Query: 77  LHELKSLLRSFHDCHLC----STSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKT 132
           +HEL+ L +   +C  C    ST   T+         +M +G  P   ++ +G PF G+ 
Sbjct: 120 VHELEKLKKCVANCTRCPELASTRKQTVFGVGNPQAKIMFLGEAPGADEDATGVPFVGRA 179

Query: 133 GNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLF 192
           G +LD ++ + ++ R +I+I  I    PPGNR  S  E   CR  +  QI +++P+ ++ 
Sbjct: 180 GQLLDGIIAACKLKREEIYICNILRCRPPGNRLPSPEEAGNCREWLDGQISIVNPEYIIC 239

Query: 193 IGN-KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWH 249
            G+   KN     +A      +GK       +       T HP  L++ P  KK+ W 
Sbjct: 240 WGSTAAKNLLGTTEA------IGKLRGKLFEYGRAKVCCTYHPSYLLRNPPAKKDVWQ 291


>gi|55980687|ref|YP_143984.1| uracil-DNA glycosylase [Thermus thermophilus HB8]
 gi|38493048|pdb|1UI0|A Chain A, Crystal Structure Of Uracil-Dna Glycosylase From Thermus
           Thermophilus Hb8
 gi|32698481|dbj|BAC79245.1| uracil-DNA glycosylase [Thermus thermophilus]
 gi|55772100|dbj|BAD70541.1| uracil-DNA glycosylase [Thermus thermophilus HB8]
          Length = 205

 Score = 81.3 bits (199), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 55/192 (28%), Positives = 92/192 (47%), Gaps = 11/192 (5%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L  L++  ++   C L       +         LMI+G  P + ++ +G+PF GK G +
Sbjct: 2   TLELLQAQAQNCTACRLMEGRTRVVFGEGNPDAKLMIVGEGPGEEEDKTGRPFVGKAGQL 61

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICR-PIIMRQIELISPKILLFIG 194
           L+++L++  I R +++I+ I    PP NR     E +IC    +++QIELI+P+I++ +G
Sbjct: 62  LNRILEAAGIPREEVYITNIVKCRPPQNRAPLPDEAKICTDKWLLKQIELIAPQIIVPLG 121

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP-----LIKKNTWH 249
                FF       T +  GKW      H I       HP  L++ P       K  TW 
Sbjct: 122 AVAAEFFLGEKVSIT-KVRGKWYEW---HGIK-VFPMFHPAYLLRNPSRAPGSPKHLTWL 176

Query: 250 ALITLKKALKNL 261
            +  +K+AL  L
Sbjct: 177 DIQEVKRALDAL 188


>gi|20806609|ref|NP_621780.1| Uracil-DNA glycosylase [Thermoanaerobacter tengcongensis MB4]
 gi|20515053|gb|AAM23384.1| Uracil-DNA glycosylase [Thermoanaerobacter tengcongensis MB4]
          Length = 186

 Score = 81.3 bits (199), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 75/152 (49%), Gaps = 5/152 (3%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C L  T  + +         +M +G  P   +++ G+PF G+ G +L+KML+ + + R +
Sbjct: 19  CDLHKTKTNMVFGEGNLRAKVMFVGEGPGRDEDLQGRPFVGRAGQLLNKMLEDVGLKREE 78

Query: 150 IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKT 209
           ++I+ +    PP NR     E++ C P +  Q+ +I+PKI++ +G        + D + T
Sbjct: 79  VYIANVVKCRPPNNRVPLQSEIDACLPYLRNQVAIIAPKIIVCLGATAAKAIIDKDFKIT 138

Query: 210 YQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
               G+W         +  +AT HP  +++ P
Sbjct: 139 TMR-GQWFE----RKGVKIIATYHPAAILRDP 165


>gi|307299315|ref|ZP_07579116.1| phage SPO1 DNA polymerase-related protein [Thermotogales bacterium
           mesG1.Ag.4.2]
 gi|306915111|gb|EFN45497.1| phage SPO1 DNA polymerase-related protein [Thermotogales bacterium
           mesG1.Ag.4.2]
          Length = 205

 Score = 81.3 bits (199), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 44/154 (28%), Positives = 77/154 (50%), Gaps = 6/154 (3%)

Query: 89  DCHLCSTSLSTICATQTEGQ---DLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEI 145
           DC LC  S S       EG     ++ +G  P   ++ SG+PF G+ G +L K+L+S+++
Sbjct: 20  DCSLCPLSSSRTNTVPGEGSIETPVVFVGEGPGADEDASGRPFVGRAGELLTKILESVKL 79

Query: 146 MRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNND 205
            R  I I+ I    PP NR  +  E + C P ++ Q+ +I PK+++ +G    ++F N +
Sbjct: 80  SREDIFITNIVKCRPPKNRVPTAEEQKACSPYMLSQLAIIRPKLIVALGATALSYFVNEE 139

Query: 206 AQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ 239
             +  +  G+  +       I   A  HP  L++
Sbjct: 140 GIQITKVRGRIFDWI---GGIKVFAMFHPSYLLR 170


>gi|257063504|ref|YP_003143176.1| uracil-DNA glycosylase, family 4 [Slackia heliotrinireducens DSM
           20476]
 gi|256791157|gb|ACV21827.1| uracil-DNA glycosylase, family 4 [Slackia heliotrinireducens DSM
           20476]
          Length = 213

 Score = 80.9 bits (198), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 52/188 (27%), Positives = 83/188 (44%), Gaps = 11/188 (5%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L  +   +R+   C+LC    + +      G  +M+IG  P  ++++ GKPF G  GN L
Sbjct: 23  LGMIGDAVRACRKCYLCEGRTNAVPGFGNAGARIMLIGEAPGKNEDLQGKPFVGAAGNYL 82

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
            ++L    + R ++ I+ I    PP NRN    E+  C P +  Q+  I P+ ++ +GN 
Sbjct: 83  TELLGYAGLTREEVFIANILKCRPPSNRNPQPDEIFECTPYLRDQVRAIMPEYIVTMGNF 142

Query: 197 TKNFFFNNDAQKT--YQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHA-LIT 253
              F    D   T    NL K        S++P     HP   I Y   K+    A  + 
Sbjct: 143 ATKFILRTDRGITGLRGNLQKTGQF----SVLPVF---HPAAAI-YDRTKREVLEADFVY 194

Query: 254 LKKALKNL 261
           L + L N+
Sbjct: 195 LGRLLGNV 202


>gi|223939226|ref|ZP_03631107.1| phage SPO1 DNA polymerase-related protein [bacterium Ellin514]
 gi|223892058|gb|EEF58538.1| phage SPO1 DNA polymerase-related protein [bacterium Ellin514]
          Length = 201

 Score = 80.9 bits (198), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 73/137 (53%), Gaps = 5/137 (3%)

Query: 63  LVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQ---DLMIIGYTPSD 119
           ++Q A   A K+  + EL+SL      C  C    S   A   EG+    +MIIG  P  
Sbjct: 6   VIQSAPGPA-KSKVVKELESLDSKIRVCTACPLYKSRTLAVPGEGKFNSKVMIIGEAPGR 64

Query: 120 SDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIM 179
           +++++G+PF G +G  LD +L+  E  R+   I+ I    PP NR     E+E C  + +
Sbjct: 65  NEDLTGRPFVGSSGKFLDHVLEGSEFDRSDFFITNICKCRPPSNRTPKTGEIETCTSLYL 124

Query: 180 -RQIELISPKILLFIGN 195
            RQIELI+P+I++ +G 
Sbjct: 125 YRQIELINPRIIVLLGG 141


>gi|258593155|emb|CBE69469.1| protein of unknown function [NC10 bacterium 'Dutch sediment']
          Length = 244

 Score = 80.9 bits (198), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 45/197 (22%), Positives = 91/197 (46%), Gaps = 5/197 (2%)

Query: 65  QQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNIS 124
           ++A+ + + + +L +++  +     C L       +         L+ +G  P   ++  
Sbjct: 40  ERAEGLPEPSPTLTKVRETVGECTRCKLHKDRKHIVFGIGNPKAWLVFVGEAPGADEDEQ 99

Query: 125 GKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIEL 184
           G+PF G+ G +L ++++++++ R Q++I  I    PP NRN    E+  C P ++ Q++ 
Sbjct: 100 GEPFVGRAGQLLTRIIEAMKLTREQVYICNIVKCRPPANRNPEPDEIAACEPFLVAQLQA 159

Query: 185 ISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIK 244
           I PK++  +G      F      +T + + K       +  I  L T HP  L++ P  K
Sbjct: 160 IRPKLICALGT-----FAAQTLLRTREPISKLRGRFHDYHGILVLPTFHPAYLLRNPHEK 214

Query: 245 KNTWHALITLKKALKNL 261
           K  W  +  L +  + L
Sbjct: 215 KTVWEDMKLLMREYEQL 231


>gi|284162809|ref|YP_003401432.1| phage SPO1 DNA polymerase-related protein [Archaeoglobus profundus
           DSM 5631]
 gi|284012806|gb|ADB58759.1| phage SPO1 DNA polymerase-related protein [Archaeoglobus profundus
           DSM 5631]
          Length = 199

 Score = 80.9 bits (198), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 37/166 (22%), Positives = 83/166 (50%), Gaps = 3/166 (1%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L +++  +R    C L     + +         ++ IG  P   +++ G+PF GK G  L
Sbjct: 3   LEDVEGEIRKCRKCKLWKYKTNYVPGEGNPNAKIVFIGEAPGKEEDLQGRPFVGKAGKYL 62

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
            ++L+ + + R+ ++I+ +    PP NR+    E+E C+P ++RQ+E+I P +++ +G  
Sbjct: 63  TEVLKKLGVERSDVYITNVLKCRPPNNRDPKPEEIEACKPHLLRQLEIIKPDVIVCLGRF 122

Query: 197 TKNFFFNNDA---QKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ 239
           + +   N      +   ++ GK  ++     ++  + T HP  +++
Sbjct: 123 SSDVILNEFGIGFRGISRDRGKVFDVEKWGKVVKIIPTYHPAAVLR 168


>gi|83590984|ref|YP_430993.1| phage SPO1 DNA polymerase-related protein [Moorella thermoacetica
           ATCC 39073]
 gi|83573898|gb|ABC20450.1| phage SPO1 DNA polymerase-related protein [Moorella thermoacetica
           ATCC 39073]
          Length = 191

 Score = 80.9 bits (198), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 47/175 (26%), Positives = 82/175 (46%), Gaps = 12/175 (6%)

Query: 79  ELKSLLRSFHDCHLCSTSLST---ICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +LK L      C  CS    T   +  +   G  LM++G      ++  G+PF+G  G +
Sbjct: 2   DLKGLKAKSPACRGCSLRTGTRQVVSGSGNPGAGLMLVGEGLGAREDRVGRPFAGAAGQL 61

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           L ++L++    R +++I+ I    PPGNR   + E+E CRP++   I+ + P+I++ +G 
Sbjct: 62  LGRLLKAAGFRREEVYITNIVKCRPPGNRMPESAEVEACRPLLDAAIDFVRPQIIVCLGA 121

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ----YPLIKKN 246
                     A  T    G+W         I  L T HP  L++     PL++++
Sbjct: 122 LATRTLVAPGASITRLR-GRWIE----KDGIRYLPTFHPAALLRDGGKIPLVEED 171


>gi|15639221|ref|NP_218669.1| DNA polymerase [Treponema pallidum subsp. pallidum str. Nichols]
 gi|189025462|ref|YP_001933234.1| DNA polymerase, bacteriophage-type [Treponema pallidum subsp.
           pallidum SS14]
 gi|3322496|gb|AAC65215.1| DNA polymerase, bacteriophage-type [Treponema pallidum subsp.
           pallidum str. Nichols]
 gi|189018037|gb|ACD70655.1| DNA polymerase, bacteriophage-type [Treponema pallidum subsp.
           pallidum SS14]
          Length = 277

 Score = 80.9 bits (198), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/190 (26%), Positives = 83/190 (43%), Gaps = 9/190 (4%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEG---QDLMIIGYTPSDSDNISGKPFSGKT 132
           S++  ++L      C  C        A   EG    D++++G  P   ++ SG+PF G++
Sbjct: 85  SVYTDETLREEIFACRACELYQRRTHAVVGEGVADADVLVVGEAPGAEEDRSGRPFVGRS 144

Query: 133 GNMLDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILL 191
           G +LD ML +I + R Q  +I+ +    PP NR  +  E   C   +   + L  P  +L
Sbjct: 145 GKLLDAMLAAIGLSRQQNCYITNVVKCRPPRNRTPTPHETACCARFLHAHLTLHRPCAIL 204

Query: 192 FIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
            +G             +T   +GK       +  IP LAT HP  L++   +K+  W  L
Sbjct: 205 VLGRCAAQHML-----QTTDGIGKLRGRFFTYQGIPLLATYHPSALLRDEALKRPAWEDL 259

Query: 252 ITLKKALKNL 261
            T +  L  L
Sbjct: 260 KTFRARLLQL 269


>gi|221195029|ref|ZP_03568085.1| uracil-DNA glycosylase, family 4 [Atopobium rimae ATCC 49626]
 gi|221184932|gb|EEE17323.1| uracil-DNA glycosylase, family 4 [Atopobium rimae ATCC 49626]
          Length = 226

 Score = 80.9 bits (198), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 77/184 (41%), Gaps = 22/184 (11%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L E++  +R    C LC    + +         +M IG  P  ++++ G+PF G  G  
Sbjct: 13  TLEEVREQMRDCRLCRLCEGRNTIVFGDGNPHARVMFIGEGPGKNEDLGGRPFIGAAGKK 72

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           LD  L +  + R  I I+ +    PP NRN    E+E C P +  Q+  I P  ++ +GN
Sbjct: 73  LDGYLAAAGLSRDDIFITNVVKCRPPSNRNPRPEEIEACAPYLRNQVRAIWPDAIVCLGN 132

Query: 196 KTKNFFFNNDAQKT------YQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWH 249
               F    +   T      YQ         T H ++  L T HP   I +P      W 
Sbjct: 133 FASQFILRTEKGVTSLRGRLYQ---------TGHFVV--LPTFHPAATIYHP-----AWE 176

Query: 250 ALIT 253
            L+T
Sbjct: 177 PLLT 180


>gi|291059633|gb|ADD72368.1| DNA polymerase, bacteriophage-type [Treponema pallidum subsp.
           pallidum str. Chicago]
          Length = 270

 Score = 80.9 bits (198), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/190 (26%), Positives = 83/190 (43%), Gaps = 9/190 (4%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEG---QDLMIIGYTPSDSDNISGKPFSGKT 132
           S++  ++L      C  C        A   EG    D++++G  P   ++ SG+PF G++
Sbjct: 78  SVYTDETLREEIFACRACELYQRRTHAVVGEGVADADVLVVGEAPGAEEDRSGRPFVGRS 137

Query: 133 GNMLDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILL 191
           G +LD ML +I + R Q  +I+ +    PP NR  +  E   C   +   + L  P  +L
Sbjct: 138 GKLLDAMLAAIGLSRQQNCYITNVVKCRPPRNRTPTPHETACCARFLHAHLTLHRPCAIL 197

Query: 192 FIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
            +G             +T   +GK       +  IP LAT HP  L++   +K+  W  L
Sbjct: 198 VLGRCAAQHML-----QTTDGIGKLRGRFFTYQGIPLLATYHPSALLRDEALKRPAWEDL 252

Query: 252 ITLKKALKNL 261
            T +  L  L
Sbjct: 253 KTFRARLLQL 262


>gi|11499858|ref|NP_071102.1| DNA polymerase [Archaeoglobus fulgidus DSM 4304]
 gi|2648243|gb|AAB88977.1| DNA polymerase, bacteriophage-type [Archaeoglobus fulgidus DSM
           4304]
          Length = 199

 Score = 80.9 bits (198), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 67/128 (52%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           SL ++   + S   C L  T  + +     E  +++ +G  P   +++ G+PF G  G +
Sbjct: 3   SLDDIVREIMSCRKCDLHKTKTNYVPGVGNEKAEIVFVGEAPGRDEDLKGEPFVGAAGKL 62

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           L +ML SI + R  ++I+ +    PP NR+ +  E+E C   ++RQ+E I P +++ +G 
Sbjct: 63  LTEMLASIGLRREDVYITNVLKCRPPNNRDPTPEEVEKCGDYLVRQLEAIRPNVIVCLGR 122

Query: 196 KTKNFFFN 203
               F FN
Sbjct: 123 FAAQFIFN 130


>gi|319941916|ref|ZP_08016237.1| hypothetical protein HMPREF9464_01456 [Sutterella wadsworthensis
           3_1_45B]
 gi|319804569|gb|EFW01439.1| hypothetical protein HMPREF9464_01456 [Sutterella wadsworthensis
           3_1_45B]
          Length = 316

 Score = 80.5 bits (197), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 62/222 (27%), Positives = 99/222 (44%), Gaps = 28/222 (12%)

Query: 61  SPLVQQADSIAQKACSLH-ELKSLLRSF---------HDCHLCSTSL----STICATQTE 106
           SP V QA  +AQ A  +  EL S + S            C  C+ S       + +    
Sbjct: 88  SPTVPQA--VAQPAVGMSTELLSKIASADWQALQTLSQHCTACALSAMGRQHVVFSDGGP 145

Query: 107 GQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISM-ISPWHPPGNRN 165
           G  L+++G  P   +++ G PF GK+G +L  ML S+ ++R +  + + +    PP NRN
Sbjct: 146 GPKLVVVGEAPGAEEDLQGIPFVGKSGKLLTAMLDSLGLVRRRDCVILNVLKCRPPRNRN 205

Query: 166 LSNIEMEICRPIIMRQIELISPKILLFIGN-------KTKNFFFNNDAQKTYQNLGKWSN 218
               E+  C   + RQ+ELI P +L   G        K  +  F+    +   +L +  +
Sbjct: 206 PQPEEIVCCGHWLARQLELIKPDVLFLAGRFAISSLLKPADEMFSISKMRGRIHLAQLPD 265

Query: 219 LCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
                  +P +AT HP  L++ P  K   W  L+ LK A+K 
Sbjct: 266 ----GRQVPAVATYHPSYLLRSPAAKSKAWEDLLLLKAAMKQ 303


>gi|257792514|ref|YP_003183120.1| phage SPO1 DNA polymerase-like protein [Eggerthella lenta DSM 2243]
 gi|317490382|ref|ZP_07948866.1| uracil-DNA glycosylase, family 4 [Eggerthella sp. 1_3_56FAA]
 gi|325833538|ref|ZP_08165987.1| uracil-DNA glycosylase A [Eggerthella sp. HGA1]
 gi|257476411|gb|ACV56731.1| phage SPO1 DNA polymerase-related protein [Eggerthella lenta DSM
           2243]
 gi|316910517|gb|EFV32142.1| uracil-DNA glycosylase, family 4 [Eggerthella sp. 1_3_56FAA]
 gi|325485462|gb|EGC87931.1| uracil-DNA glycosylase A [Eggerthella sp. HGA1]
          Length = 211

 Score = 80.5 bits (197), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 68/145 (46%), Gaps = 5/145 (3%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L E+++ +     C L      T+         +MIIG  P  ++++ G+PF G  G  L
Sbjct: 8   LDEIRAQVEGCRKCPLADGRTQTVFGVGNPEARVMIIGEAPGKNEDLQGEPFVGAAGKYL 67

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
           +++L    ++R  + I+ +    PPGNR+    E+E+C P +  Q   I P+ L+ +GN 
Sbjct: 68  NELLAVAGLVREDVFIANVLKCRPPGNRDPRPEEIELCTPYLREQTRTIDPEFLVTLGNF 127

Query: 197 TKNFFFNND-----AQKTYQNLGKW 216
           +  F    D        T Q  GK+
Sbjct: 128 STKFILKTDIGITRLHGTVQRAGKF 152


>gi|307266580|ref|ZP_07548111.1| phage SPO1 DNA polymerase-related protein [Thermoanaerobacter
           wiegelii Rt8.B1]
 gi|326391764|ref|ZP_08213285.1| phage SPO1 DNA polymerase-related protein [Thermoanaerobacter
           ethanolicus JW 200]
 gi|306918377|gb|EFN48620.1| phage SPO1 DNA polymerase-related protein [Thermoanaerobacter
           wiegelii Rt8.B1]
 gi|325992202|gb|EGD50673.1| phage SPO1 DNA polymerase-related protein [Thermoanaerobacter
           ethanolicus JW 200]
          Length = 186

 Score = 80.5 bits (197), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 82/169 (48%), Gaps = 8/169 (4%)

Query: 76  SLHELKSL-LRSFH--DCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKT 132
           +L  LK L L   H   C L  T  + +         +M +G  P   +++ G+PF G+ 
Sbjct: 2   ALLPLKELYLECLHCTKCDLSKTKTNMVFGEGNLRAKVMFVGEGPGRDEDLQGRPFVGRA 61

Query: 133 GNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLF 192
           G +L+KML+ + + R +++I+ +    PP NR     E++ C P +  Q+ +I+PKI++ 
Sbjct: 62  GQLLNKMLEEVGLKREEVYIANVVKCRPPNNRVPLQSEIDACLPYLRNQVAIIAPKIIVC 121

Query: 193 IGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
           +G        + + + T    G+W         +  +AT HP  +++ P
Sbjct: 122 LGATAAKAIIDKNFKITTMR-GQWFE----RKGVKIIATYHPAAILRDP 165


>gi|323135754|ref|ZP_08070837.1| Uracil-DNA glycosylase superfamily [Methylocystis sp. ATCC 49242]
 gi|322398845|gb|EFY01364.1| Uracil-DNA glycosylase superfamily [Methylocystis sp. ATCC 49242]
          Length = 281

 Score = 80.5 bits (197), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 53/234 (22%), Positives = 94/234 (40%), Gaps = 26/234 (11%)

Query: 8   SQEQILTIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNI-----RHIHSP 62
           ++E +L +  +Y +SG  +  D+  ++   +S R   ++     P   +     R   +P
Sbjct: 9   TREALLALLDWYVESGADFALDDSPHDRYADSARAPTAVSEPPPPSRAVERGEPRAPLTP 68

Query: 63  LVQQA----------------DSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTE 106
             ++A                ++ A  A  L +L + L  F        +   +      
Sbjct: 69  APRRARPETLIAPPDEAARAAEATAAAARDLDDLAARLADFPHAPFRDMARHFLFGAGAP 128

Query: 107 GQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNL 166
           G  LM     P  ++   G  FSG+   +LD ML +I + R    ++ +SPW PPG++ L
Sbjct: 129 GARLMAFDAAPGATEESGGAAFSGERAKLLDNMLAAIGLDRGSARLAYVSPWRPPGDKAL 188

Query: 167 SNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLC 220
           +  EM +  P   R +EL  P++LL  G             +T + L K    C
Sbjct: 189 TPQEMAVFAPFARRHVELARPEVLLLFGEAPARIML-----ETGEPLAKLRGKC 237


>gi|313114128|ref|ZP_07799680.1| uracil-DNA glycosylase, family 4 [Faecalibacterium cf. prausnitzii
           KLE1255]
 gi|310623537|gb|EFQ06940.1| uracil-DNA glycosylase, family 4 [Faecalibacterium cf. prausnitzii
           KLE1255]
          Length = 191

 Score = 80.1 bits (196), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 49/189 (25%), Positives = 87/189 (46%), Gaps = 18/189 (9%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKM 139
           L+S   +   C LC T  + +     E  +++ +G  P  +++  G PF G++G +LDK 
Sbjct: 6   LRSSCLACTRCELCKTRTNVVFGQGVEDAEVLFVGEGPGQNEDEQGLPFVGRSGQLLDKY 65

Query: 140 LQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT- 197
           L +I++ RT+  +I+ I    PP NR+    E E C P +  Q  L+ PKI++ +G    
Sbjct: 66  LFAIDLDRTKNCYIANIVKCRPPQNRDPQPAESEACMPWLREQFRLLKPKIVVCLGRIAA 125

Query: 198 -----KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALI 252
                K+F    +  + Y+  G           I  + T HP  L++ P  K   +    
Sbjct: 126 QRMIRKDFSVTKEHGQLYEKGG-----------ILFMGTFHPAALLRSPQNKPAAFADFT 174

Query: 253 TLKKALKNL 261
            L+  ++ +
Sbjct: 175 ALRDNIETV 183


>gi|332709104|ref|ZP_08429072.1| uracil-DNA glycosylase, family 4 [Lyngbya majuscula 3L]
 gi|332352110|gb|EGJ31682.1| uracil-DNA glycosylase, family 4 [Lyngbya majuscula 3L]
          Length = 231

 Score = 80.1 bits (196), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 79/167 (47%), Gaps = 5/167 (2%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           ++  L    +S   C L +T    +         +MIIG  P   ++ +G PF G+ G +
Sbjct: 43  TMESLTEHCQSCQRCELGATRTKAVIGRGNPKALIMIIGEGPGKQEDETGMPFVGRAGKL 102

Query: 136 LDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           L+K+L S++I   Q ++I  +    PPGNR  +  E+E C+P ++ QI L+ P+I+LF G
Sbjct: 103 LEKILASVKIDTEQDVYICNMVKCRPPGNRTPTPNEIEACKPYLLEQIRLVEPQIILFTG 162

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
                    N  Q   +  G W         +P L   HP  L++ P
Sbjct: 163 ATAVKGLTGN-KQGITKIRGTWMEWEGHKWCMPIL---HPAYLLRNP 205


>gi|94265274|ref|ZP_01289033.1| Phage SPO1 DNA polymerase-related protein [delta proteobacterium
           MLMS-1]
 gi|93454255|gb|EAT04571.1| Phage SPO1 DNA polymerase-related protein [delta proteobacterium
           MLMS-1]
          Length = 276

 Score = 80.1 bits (196), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 50/181 (27%), Positives = 87/181 (48%), Gaps = 6/181 (3%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQ-DLMIIGYTPSDSDNISGKPFSGKTGNMLD 137
           EL ++      C+ C      I   Q   +  L+I+   P  ++  +G P  G+ G +LD
Sbjct: 97  ELAAVAGRIRACNRCPLQRPRIIVGQGNPEARLLIVAPPPGPAEEAAGLPCQGEAGALLD 156

Query: 138 KMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT 197
           KML +I + R+ ++++ +    PP  R  +  E   CRP ++ QI  I P +L  +G + 
Sbjct: 157 KMLAAIGLARSTVYLTTVVKCDPPDCRPPTPEESRQCRPWLLEQIAAIRPTLLCTMGQEA 216

Query: 198 KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKA 257
                 + ++   Q  G++ + C   +++PTLA   P  L+  P +KK  WH L  + K 
Sbjct: 217 AQSLLKS-SRNLLQLRGRFHD-CQGIALMPTLA---PDFLLPNPEMKKAAWHDLQLIAKR 271

Query: 258 L 258
           L
Sbjct: 272 L 272


>gi|125975586|ref|YP_001039496.1| phage SPO1 DNA polymerase-related protein [Clostridium thermocellum
           ATCC 27405]
 gi|256005909|ref|ZP_05430854.1| phage SPO1 DNA polymerase-related protein [Clostridium thermocellum
           DSM 2360]
 gi|281416598|ref|ZP_06247618.1| phage SPO1 DNA polymerase-related protein [Clostridium thermocellum
           JW20]
 gi|125715811|gb|ABN54303.1| phage SPO1 DNA polymerase-related protein [Clostridium thermocellum
           ATCC 27405]
 gi|255990113|gb|EEU00250.1| phage SPO1 DNA polymerase-related protein [Clostridium thermocellum
           DSM 2360]
 gi|281408000|gb|EFB38258.1| phage SPO1 DNA polymerase-related protein [Clostridium thermocellum
           JW20]
 gi|316939705|gb|ADU73739.1| phage SPO1 DNA polymerase-related protein [Clostridium thermocellum
           DSM 1313]
          Length = 189

 Score = 80.1 bits (196), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 87/186 (46%), Gaps = 5/186 (2%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           S  EL  +  +   C L  T  + +         +M++G  P + +++ G PF G  G +
Sbjct: 3   SWEELIKVCSNCTKCGLSKTRTNIVIGRGNINAPMMLVGEGPGEQEDLQGLPFVGPAGKL 62

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           LD +L+++ I     +I+ I    PPGNR  ++ E E+C P +  Q+ L+ P+I++ +G 
Sbjct: 63  LDLLLKAMRIKEDMYYIANIVKCRPPGNRVPTDDEAEMCLPYLRNQLVLVKPRIIVCLGA 122

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
               +  + +A+ T    G+W            +AT HP  L++    K   W     +K
Sbjct: 123 TAMKYIIDRNAKITNVR-GQW----IERKGYWIIATFHPAALLRDESKKVLMWEDFKKVK 177

Query: 256 KALKNL 261
           + L ++
Sbjct: 178 QRLDSI 183


>gi|189345810|ref|YP_001942339.1| phage SPO1 DNA polymerase-related protein [Chlorobium limicola DSM
           245]
 gi|189339957|gb|ACD89360.1| phage SPO1 DNA polymerase-related protein [Chlorobium limicola DSM
           245]
          Length = 211

 Score = 80.1 bits (196), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 85/180 (47%), Gaps = 5/180 (2%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +LH L    R+   C L ST  + +         L++IG  P   ++  G+PF G++G +
Sbjct: 24  ALHSLYERSRTCTKCRLASTRTNFVFGEGNPHARLVVIGEAPGADEDALGRPFVGRSGQL 83

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           LDK+LQ+++  R ++ I  I    PP NRN    E+  C P ++ Q++L+ P +LL +G 
Sbjct: 84  LDKILQAVQFRREEVFICNIIKCRPPQNRNPLQDEIASCMPWLLDQLDLLKPSMLLLLGR 143

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
              N    N       +LG              +AT HP  L++ P  K+  W  +  ++
Sbjct: 144 VAANTILQNTL-----SLGAMRGKIIRWKQFDCVATYHPAALLRNPNWKRGCWEDVQMMR 198


>gi|51894053|ref|YP_076744.1| Uracil-DNA glycosylase [Symbiobacterium thermophilum IAM 14863]
 gi|51857742|dbj|BAD41900.1| Uracil-DNA glycosylase [Symbiobacterium thermophilum IAM 14863]
          Length = 206

 Score = 80.1 bits (196), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 47/177 (26%), Positives = 80/177 (45%), Gaps = 6/177 (3%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           ++  L  +++    C L +     +         LM IG  P   ++  G+PF G+ G +
Sbjct: 15  TMEALAEVVKGCQRCGLRAGCTQVVFGEGVWPAGLMCIGEGPGADEDRLGRPFVGRAGQL 74

Query: 136 LDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           LD++L+     R +  +I+ I    PPGNR     E + C P +  QI L+ PKI++ +G
Sbjct: 75  LDRILEVSGFDRKRNCYIANIVKCRPPGNRAPEPAERQACWPYLRAQIRLVRPKIIVLLG 134

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
                   +  A+ T    G+W         I  + T HP  L++ P  KK+ W+ +
Sbjct: 135 ATALQGIIDPSARITRMR-GQWIE----REGIHFMPTYHPAALLRDPSKKKDVWNDM 186


>gi|303242850|ref|ZP_07329314.1| phage SPO1 DNA polymerase-related protein [Acetivibrio
           cellulolyticus CD2]
 gi|302589596|gb|EFL59380.1| phage SPO1 DNA polymerase-related protein [Acetivibrio
           cellulolyticus CD2]
          Length = 189

 Score = 79.7 bits (195), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 88/184 (47%), Gaps = 5/184 (2%)

Query: 78  HELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLD 137
            EL +     ++C L     + +         L++IG  P + +++ G PF G  G +LD
Sbjct: 5   EELINSCTGCYNCQLGRKRNNIVIGRGNRNASLLMIGEGPGEQEDLQGLPFVGAAGKLLD 64

Query: 138 KMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT 197
            +L++  I   Q +I+ +    PPGNR  ++ E E C P +  Q+ LI PKI++ +G   
Sbjct: 65  LLLKAQMIKEDQYYIANVVKCRPPGNRVPTDEEAEKCLPYLRNQVYLIKPKIIVCLGATA 124

Query: 198 KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKA 257
             +  + +A+ T Q  G+W      + I+PT    HP  L++    K   W  +  +K+ 
Sbjct: 125 MKYVVDKNARIT-QIRGQWIER-KGYWIMPTF---HPAALLRDESKKILMWEDIKKVKQR 179

Query: 258 LKNL 261
           +  L
Sbjct: 180 MDCL 183


>gi|242398863|ref|YP_002994287.1| Uracil-DNA glycosylase [Thermococcus sibiricus MM 739]
 gi|242265256|gb|ACS89938.1| Uracil-DNA glycosylase [Thermococcus sibiricus MM 739]
          Length = 194

 Score = 79.7 bits (195), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 49/191 (25%), Positives = 89/191 (46%), Gaps = 3/191 (1%)

Query: 73  KACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKT 132
           K+ S+  L+  +     C L     + +  + +    +M +G  P   ++  G PF G+ 
Sbjct: 4   KSESMKRLEERIIKCRKCPLGELRTNAVPGSGSYESKVMFVGEGPGYWEDQEGLPFVGRA 63

Query: 133 GNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLF 192
           G +LD++L+SI + R +++I+ I    PP NR+ +  E++ C P +  QI+LI PKI++ 
Sbjct: 64  GKVLDELLESIGLTRDKVYITNIVKCRPPNNRDPTEEEVKACSPYLDMQIDLIRPKIIVP 123

Query: 193 IGNKTKNFF---FNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWH 249
           +G  +  +    F  D +   +  GK     T    I  +   HP   +  P +K+    
Sbjct: 124 LGRHSMAYILRKFGFDPEPISKIHGKTFEARTLFGKIVIMPVYHPAVALYRPQLKEELQQ 183

Query: 250 ALITLKKALKN 260
               LK   +N
Sbjct: 184 DFKKLKDFYRN 194


>gi|126460679|ref|YP_001056957.1| phage SPO1 DNA polymerase-related protein [Pyrobaculum calidifontis
           JCM 11548]
 gi|126250400|gb|ABO09491.1| phage SPO1 DNA polymerase-related protein [Pyrobaculum calidifontis
           JCM 11548]
          Length = 194

 Score = 79.7 bits (195), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 84/173 (48%), Gaps = 5/173 (2%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L +L   ++    C L  T  + +    +    +MI+G  P  S++  G+PF G  G++
Sbjct: 3   TLEQLHEEIKRCTRCPLHKTRRNAVPGEGSGRLGIMIVGEAPGSSEDEQGRPFVGAAGSL 62

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           L+K L ++ + R  ++I+ +    PPGNR  +  E+  C P ++RQIE++ P+ ++ +G 
Sbjct: 63  LNKTLSTLGVERGDLYITNVVKCRPPGNRTPTREEVAACLPYLLRQIEILRPRRIIALGA 122

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSI----IPTLATVHPQELIQYPLIK 244
            +         ++  + +G     C    +    +    T HP  +++ P ++
Sbjct: 123 VSAGALLGLIGRQV-ERVGDVRGKCFRGKVAGVDVEICVTYHPAAVLRNPRLR 174


>gi|237746081|ref|ZP_04576561.1| DNA polymerase bacteriophage-type [Oxalobacter formigenes HOxBLS]
 gi|229377432|gb|EEO27523.1| DNA polymerase bacteriophage-type [Oxalobacter formigenes HOxBLS]
          Length = 317

 Score = 79.7 bits (195), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 48/168 (28%), Positives = 78/168 (46%), Gaps = 6/168 (3%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           CHLC T    +        D + IG  P   ++  G+PF G++G +LD M+ ++ + R +
Sbjct: 135 CHLCKTRNKVVPGIGDREADWLFIGEGPGFHEDRQGEPFVGRSGKLLDAMMAAMRMKRGE 194

Query: 150 -IHISMI----SPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNN 204
            ++I+ I    +      +R  +  E  IC P + RQI+LI PKI++ +G        N 
Sbjct: 195 NVYIANIVKCRASNESGKDRQPTEEEAAICMPYLERQIDLIRPKIMVALGKTAAVALLNT 254

Query: 205 DAQKTYQNLGKWSNLC-TPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
               +  +L    +   T    IP + T HP  L++ P  KK  W  L
Sbjct: 255 GRDVSLGSLRNREHFFRTGGRKIPLVVTYHPSYLLRTPGGKKQAWQDL 302


>gi|289577329|ref|YP_003475956.1| phage SPO1 DNA polymerase-related protein [Thermoanaerobacter
           italicus Ab9]
 gi|297543618|ref|YP_003675920.1| phage SPO1 DNA polymerase-like protein [Thermoanaerobacter
           mathranii subsp. mathranii str. A3]
 gi|289527042|gb|ADD01394.1| phage SPO1 DNA polymerase-related protein [Thermoanaerobacter
           italicus Ab9]
 gi|296841393|gb|ADH59909.1| phage SPO1 DNA polymerase-related protein [Thermoanaerobacter
           mathranii subsp. mathranii str. A3]
          Length = 186

 Score = 79.3 bits (194), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 82/169 (48%), Gaps = 8/169 (4%)

Query: 76  SLHELKSL-LRSFH--DCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKT 132
           +L  LK L L   H   C L  T  + +         ++ +G  P   +++ G+PF G+ 
Sbjct: 2   ALLPLKELYLECLHCTKCDLSKTKTNMVFGEGNLRAKVIFVGEGPGRDEDLQGRPFVGRA 61

Query: 133 GNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLF 192
           G +L+KML+ + + R +++I+ I    PP NR     E++ C P +  Q+ +I+PKI++ 
Sbjct: 62  GQLLNKMLEEVGLKRGEVYIANIVKCRPPNNRVPLQSEVDACLPYLRNQVAIIAPKIIVC 121

Query: 193 IGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
           +G        + + + T    G+W         +  +AT HP  +++ P
Sbjct: 122 LGATAAKAIIDKNFKITVMR-GQWFE----RKGVKIIATYHPAAILRDP 165


>gi|126466206|ref|YP_001041315.1| phage SPO1 DNA polymerase-related protein [Staphylothermus marinus
           F1]
 gi|126015029|gb|ABN70407.1| phage SPO1 DNA polymerase-related protein [Staphylothermus marinus
           F1]
          Length = 212

 Score = 79.3 bits (194), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 55/192 (28%), Positives = 90/192 (46%), Gaps = 23/192 (11%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEG---QDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           EL  L      C  C   LS   A   EG    ++M +G  P   ++  G+PF G  G +
Sbjct: 8   ELTKLAEEIKKCQKCPLHLSRKNAVPGEGPCNAEIMFVGEAPGSKEDEIGRPFVGAAGKL 67

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           L ++L+ I + R  ++I+ +    PP NR+ +  E+E C P ++RQI++I PKI++ +G 
Sbjct: 68  LTQLLELIGLKRPDVYITNVVKCRPPNNRDPTPEEIEACSPYLIRQIKIIKPKIIVALGR 127

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSI----------IPTLATVHPQELIQYPLIK- 244
            +  F F+           KWSN+   H            +  +AT HP   +  P ++ 
Sbjct: 128 HSARFLFSRAGL-------KWSNMKAMHGKVFSARIDGVEVKIMATYHPAAALYSPKLRP 180

Query: 245 --KNTWHALITL 254
             +N +H L  L
Sbjct: 181 ELENDFHVLERL 192


>gi|302334972|ref|YP_003800179.1| phage SPO1 DNA polymerase-related protein [Olsenella uli DSM 7084]
 gi|301318812|gb|ADK67299.1| phage SPO1 DNA polymerase-related protein [Olsenella uli DSM 7084]
          Length = 203

 Score = 79.3 bits (194), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 65/130 (50%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           SL E++SL+ +   C L  T  + +         +MIIG  P  ++++ G+PF G  G  
Sbjct: 18  SLEEIRSLMGNCQLCELGQTRSNLVFGVGDPHARVMIIGEGPGKNEDLQGEPFVGAAGKK 77

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           LD +L +  + R +++I+ +    PP NRN    E+E C P +  Q+  I P  ++ +GN
Sbjct: 78  LDALLGNAGLTRDEVYIANVVKCRPPSNRNPRPAEIEACSPFLREQVRSIWPDAIICLGN 137

Query: 196 KTKNFFFNND 205
               +    D
Sbjct: 138 FASQWVLKTD 147


>gi|269925911|ref|YP_003322534.1| phage SPO1 DNA polymerase-related protein [Thermobaculum terrenum
           ATCC BAA-798]
 gi|269789571|gb|ACZ41712.1| phage SPO1 DNA polymerase-related protein [Thermobaculum terrenum
           ATCC BAA-798]
          Length = 219

 Score = 79.3 bits (194), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 85/173 (49%), Gaps = 8/173 (4%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           SL  + S +R    C L +T  + +         +M IG  P  +++  G+PF G  G  
Sbjct: 11  SLELIASEVRKCTKCPLSATRTNAVPGEGNPSAQIMFIGEGPGFNEDRQGRPFVGAAGAF 70

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           L+++LQS+ + R  + I+ +    PPGNR+    E++ C   + RQIELI P +++ +G 
Sbjct: 71  LNELLQSVGLRREDVFITNVVKCRPPGNRDPLPEEIQACSCYLDRQIELIKPAVIVTLGR 130

Query: 196 KTKNFFFNNDA-QKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNT 247
            +   +F N+   + +    +  +L    +++P     HP   +  P +K+ +
Sbjct: 131 YSMARYFPNERISRIHGQPRRIGDL----TVVPLF---HPAAALHQPALKETS 176


>gi|91774769|ref|YP_544525.1| phage SPO1 DNA polymerase-related protein [Methylobacillus
           flagellatus KT]
 gi|91708756|gb|ABE48684.1| phage SPO1 DNA polymerase-related protein [Methylobacillus
           flagellatus KT]
          Length = 330

 Score = 79.3 bits (194), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 48/186 (25%), Positives = 88/186 (47%), Gaps = 11/186 (5%)

Query: 81  KSLLRSFHDCHLCSTS---LSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLD 137
           ++L +S  +C  C  +     T+        + + +G  P   ++  G+PF G  G +LD
Sbjct: 141 QALQQSVSECEACDLAQKRTQTVFGIGDPNAEWLFVGEAPGAEEDRWGEPFVGPAGQLLD 200

Query: 138 KMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
            ML +I + R + ++I+ +    PP NR+    E+  C P + RQ+ELI PK+++ +G  
Sbjct: 201 NMLAAIALKRGENVYIANVLKCRPPANRDPQGEEVVKCDPYLKRQVELIKPKLIVALGKF 260

Query: 197 TKNFFFNNDAQKTYQNL-GKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
                  +D  K+   L G   +    H  +P + T HP  L++    K   W  L   +
Sbjct: 261 AAQSLLASD--KSIAGLRGALHDF---HG-VPVIVTYHPAYLLRNLADKAKAWDDLCFAR 314

Query: 256 KALKNL 261
           + +++L
Sbjct: 315 ETMQHL 320


>gi|307596060|ref|YP_003902377.1| phage SPO1 DNA polymerase-related protein [Vulcanisaeta distributa
           DSM 14429]
 gi|307551261|gb|ADN51326.1| phage SPO1 DNA polymerase-related protein [Vulcanisaeta distributa
           DSM 14429]
          Length = 215

 Score = 79.3 bits (194), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 87/186 (46%), Gaps = 6/186 (3%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           EL +L+ +   C L  +    +         +MIIG  P + ++  G+PF G  G +L K
Sbjct: 15  ELVNLMLNCTKCKLHKSRRRVVPGEGPLNAKIMIIGEAPGEREDEEGRPFVGAAGQLLTK 74

Query: 139 MLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTK 198
           +L ++ I R +++I+ +    PP NR+    E+E CRP ++ QI +I P+I++ +G  + 
Sbjct: 75  LLNNVGIRREEVYITNVVKCRPPNNRDPEPDEIEACRPYLITQILMIRPQIIICLGRHSA 134

Query: 199 NFFFNNDA--QKTYQNL----GKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALI 252
                     +K+  N+    GK  N+      +  L T HP   +  P ++      L 
Sbjct: 135 REILTMAGYPEKSVSNISSIRGKVFNVKLGDLNVKVLPTYHPAAALYNPRLRGVIEEDLR 194

Query: 253 TLKKAL 258
            +K  L
Sbjct: 195 KVKTLL 200


>gi|154248846|ref|YP_001409671.1| phage SPO1 DNA polymerase-related protein [Fervidobacterium nodosum
           Rt17-B1]
 gi|154152782|gb|ABS60014.1| phage SPO1 DNA polymerase-related protein [Fervidobacterium nodosum
           Rt17-B1]
          Length = 202

 Score = 79.3 bits (194), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 89/182 (48%), Gaps = 9/182 (4%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKM 139
           ++  +++   CHL     +T+         +M +G  P + ++  G+PF GK G +L K+
Sbjct: 10  IEERIKNCQSCHLHLLRKNTVPGEGNIYSPIMFVGEGPGEEEDNQGRPFVGKAGQLLTKI 69

Query: 140 LQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKN 199
           ++S+ I R  ++I+ +    PP NR  +N+E++ C   +  QIE+I+P++++ +G+    
Sbjct: 70  IESVNIKREDVYITNVVKCRPPNNRVPTNLEIQSCSHYLTAQIEIINPRMIIPLGSTAAT 129

Query: 200 FFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKN-----TWHALITL 254
           FF   +   T     K+    T    I      HP  L++ P  +K      TW  +  +
Sbjct: 130 FFLGKEEPITKIRGKKF----TWKGDIIIFPMFHPSYLLRNPSKEKGSPKDLTWQDIKEV 185

Query: 255 KK 256
           ++
Sbjct: 186 RR 187


>gi|22299499|ref|NP_682746.1| hypothetical protein tll1956 [Thermosynechococcus elongatus BP-1]
 gi|22295682|dbj|BAC09508.1| tll1956 [Thermosynechococcus elongatus BP-1]
          Length = 235

 Score = 79.3 bits (194), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 42/128 (32%), Positives = 65/128 (50%), Gaps = 2/128 (1%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEI-MRT 148
           C L +T    + +       LMIIG  P  +++ SG+PF GK G +LDK+L S+ +    
Sbjct: 61  CGLAATRTHVVVSRGNPAAKLMIIGEGPGQAEDESGRPFVGKAGQLLDKILASVNLDSER 120

Query: 149 QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQK 208
             +I  I    PPGNR  + IE   C P ++ QI L++P+I+L  G    +     D + 
Sbjct: 121 DAYICNIVKCRPPGNRVPTPIEAAACIPYLLEQIRLVNPRIILLAGATAVSGLL-KDHRG 179

Query: 209 TYQNLGKW 216
             +  G+W
Sbjct: 180 ITKIRGQW 187


>gi|322436205|ref|YP_004218417.1| phage SPO1 DNA polymerase-related protein [Acidobacterium sp.
           MP5ACTX9]
 gi|321163932|gb|ADW69637.1| phage SPO1 DNA polymerase-related protein [Acidobacterium sp.
           MP5ACTX9]
          Length = 290

 Score = 79.0 bits (193), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 77/150 (51%), Gaps = 7/150 (4%)

Query: 110 LMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNI 169
           LM +G  P   ++  G PF GK+G +L+ M+ ++ + R Q++I+ I    PP NR    +
Sbjct: 141 LMFVGEGPGADEDEQGLPFVGKSGQLLNNMIGAMGLSREQVYIANIVKCRPPANRAPEPV 200

Query: 170 EMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNL-GKWSNLCTPHSIIPT 228
           E   C   ++RQ++++ P+ ++ +G     +      +++  +L G+W ++    +++  
Sbjct: 201 EANTCTQFLVRQMDVVQPEYVVALGATAATYLLG--VKQSLASLRGRWHDVRGAKAVV-- 256

Query: 229 LATVHPQELIQYPLIKKNTWHALITLKKAL 258
             T HP  L++ P  K   W  L  +  A+
Sbjct: 257 --TYHPAFLLRDPRQKGEAWKDLQMVMAAM 284


>gi|167038549|ref|YP_001666127.1| phage SPO1 DNA polymerase-like protein [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|256752669|ref|ZP_05493520.1| phage SPO1 DNA polymerase-related protein [Thermoanaerobacter
           ethanolicus CCSD1]
 gi|320116945|ref|YP_004187104.1| phage SPO1 DNA polymerase-like protein [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
 gi|166857383|gb|ABY95791.1| phage SPO1 DNA polymerase-related protein [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|256748431|gb|EEU61484.1| phage SPO1 DNA polymerase-related protein [Thermoanaerobacter
           ethanolicus CCSD1]
 gi|319930036|gb|ADV80721.1| phage SPO1 DNA polymerase-related protein [Thermoanaerobacter
           brockii subsp. finnii Ako-1]
          Length = 186

 Score = 79.0 bits (193), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 81/169 (47%), Gaps = 8/169 (4%)

Query: 76  SLHELKSL-LRSFH--DCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKT 132
           +L  LK L L   H   C L  T  + +         +M +G  P   +++ G+PF G+ 
Sbjct: 2   ALLPLKELYLECLHCTKCDLSKTKTNMVFGEGNLRAKVMFVGEGPGRDEDLQGRPFVGRA 61

Query: 133 GNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLF 192
           G  L+KML+ + + R +++I+ I    PP NR     E++ C P +  Q+ +I+PK+++ 
Sbjct: 62  GQFLNKMLEDVGLKREEVYIANIVKCRPPNNRVPLQSEIDACLPYLRNQVAIIAPKMIVC 121

Query: 193 IGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
           +G        + + + T    G+W         +  +AT HP  +++ P
Sbjct: 122 LGATAAKAIIDKNFKITVMR-GQWFE----RKGVKIIATYHPAAILRDP 165


>gi|283779751|ref|YP_003370506.1| phage SPO1 DNA polymerase-like protein [Pirellula staleyi DSM 6068]
 gi|283438204|gb|ADB16646.1| phage SPO1 DNA polymerase-related protein [Pirellula staleyi DSM
           6068]
          Length = 292

 Score = 79.0 bits (193), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 82/183 (44%), Gaps = 9/183 (4%)

Query: 80  LKSLLRSFHDCHLCS----TSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           L  L      C LC     T   T+         ++I G  P   ++ +G+PF G+ G +
Sbjct: 107 LDDLKAEVAGCKLCKELARTRKQTVFGIGNPQPRVVIFGEAPGADEDRTGEPFVGRAGQL 166

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           L K++++    R +++I  +    PP NR     E+E CRP   RQIEL++P+ ++ +G 
Sbjct: 167 LTKIIEACGWKREEVYILNVLKCRPPDNRTPVEEEIENCRPFFERQIELLAPEYIVCVGT 226

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
                       +T + +G+       ++    L T HP  L++ P  KK  W  +  L 
Sbjct: 227 VPSQALL-----RTKEPVGRLRGRFHEYNGRSVLVTYHPSYLLRNPSAKKFVWDDMQMLL 281

Query: 256 KAL 258
           K +
Sbjct: 282 KKM 284


>gi|113474288|ref|YP_720349.1| phage SPO1 DNA polymerase-like protein [Trichodesmium erythraeum
           IMS101]
 gi|110165336|gb|ABG49876.1| phage SPO1 DNA polymerase-related protein [Trichodesmium erythraeum
           IMS101]
          Length = 242

 Score = 79.0 bits (193), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 85/182 (46%), Gaps = 19/182 (10%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C L     + +        ++M+IG  P  +++  G PF GK+G +LDK+LQS+E+   +
Sbjct: 61  CELGENRTNAVIGRGNPEAEIMVIGEAPGQNEDEQGLPFVGKSGQLLDKILQSVELSSDR 120

Query: 150 -IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQK 208
            ++IS      PP NR  +  E+  C+P ++ QI L++PKI+L  G  T       D + 
Sbjct: 121 HVYISNAIRCRPPENRTPTLKEVGACKPYLLEQIRLVNPKIILLTG-ATAVKALTGDKRG 179

Query: 209 TYQNLGKW----SNLCTPHSIIPTLATVHPQELIQYPLIKKNT-----WHALITLKKALK 259
             +  G+W      LC P          HP  L++ P  +        W  +  +K+ L+
Sbjct: 180 ITKIRGQWIEWEGRLCMP--------IFHPAYLLRNPSREPGKPKWLMWQDIQAVKQKLE 231

Query: 260 NL 261
            L
Sbjct: 232 EL 233


>gi|300710100|ref|YP_003735914.1| phage SPO1 DNA polymerase-related protein [Halalkalicoccus jeotgali
           B3]
 gi|299123783|gb|ADJ14122.1| phage SPO1 DNA polymerase-related protein [Halalkalicoccus jeotgali
           B3]
          Length = 200

 Score = 79.0 bits (193), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 46/172 (26%), Positives = 80/172 (46%), Gaps = 14/172 (8%)

Query: 89  DCHLCSTSLST----ICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIE 144
           +C  C   + +    +  T  E  DL+I+G  P + ++  G+PF G++G  LD+ L++  
Sbjct: 11  ECECCPALVESRSRIVNGTGPEDADLLIVGEGPGEQEDEEGEPFVGRSGTQLDEKLRAHG 70

Query: 145 IMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNN 204
           I R  + I+      PP NR+ +  E+E CR  + R+IEL+ P +++ +G          
Sbjct: 71  IAREDVRITNCVRCRPPENRDPTKEELENCRGYLEREIELVDPALIMTVGKVPTEHLLER 130

Query: 205 DAQKTYQNLGKWSNLCTPHSIIP----TLATVHPQELIQYPLIKKNTWHALI 252
           D   T     K +     H I       L +VHP  ++ Y   ++ T  A +
Sbjct: 131 DVAVT-----KEAGSVVEHRIGGESRRVLISVHPAAML-YDRSQEETLDATV 176


>gi|167040413|ref|YP_001663398.1| phage SPO1 DNA polymerase-like protein [Thermoanaerobacter sp.
           X514]
 gi|300913700|ref|ZP_07131017.1| phage SPO1 DNA polymerase-related protein [Thermoanaerobacter sp.
           X561]
 gi|307723285|ref|YP_003903036.1| phage SPO1 DNA polymerase-like protein [Thermoanaerobacter sp.
           X513]
 gi|166854653|gb|ABY93062.1| phage SPO1 DNA polymerase-related protein [Thermoanaerobacter sp.
           X514]
 gi|300890385|gb|EFK85530.1| phage SPO1 DNA polymerase-related protein [Thermoanaerobacter sp.
           X561]
 gi|307580346|gb|ADN53745.1| phage SPO1 DNA polymerase-related protein [Thermoanaerobacter sp.
           X513]
          Length = 186

 Score = 79.0 bits (193), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 74/152 (48%), Gaps = 5/152 (3%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C L  T    +         +M +G  P   +++ G+PF G+ G +L+KML+ + + R +
Sbjct: 19  CDLHKTKTHMVFGEGNLRAKVMFVGEGPGKDEDLQGRPFVGRAGQLLNKMLEDVGLKREE 78

Query: 150 IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKT 209
           ++I+ +    PP NR     E++ C P +  Q+ +I+PKI++ +G        + + + T
Sbjct: 79  VYIANVVKCRPPNNRVPLQSEVDACLPYLRNQVAIIAPKIIVCLGATAAKAIIDKNFKIT 138

Query: 210 YQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
               G+W         +  +AT HP  +++ P
Sbjct: 139 AMR-GQWFE----RKGVKIIATYHPAAILRDP 165


>gi|189485553|ref|YP_001956494.1| uracil-DNA glycosylase [uncultured Termite group 1 bacterium
           phylotype Rs-D17]
 gi|170287512|dbj|BAG14033.1| uracil-DNA glycosylase [uncultured Termite group 1 bacterium
           phylotype Rs-D17]
          Length = 253

 Score = 79.0 bits (193), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 54/226 (23%), Positives = 101/226 (44%), Gaps = 22/226 (9%)

Query: 36  TYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCST 95
            Y++     S   A+ P T  +  ++        I+     L EL+  +     C L   
Sbjct: 28  VYKASSANVSCGKAVFPKTGRQAFYA-------EISSSGEELGELREKVSFCKKCPLGEK 80

Query: 96  SLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHI--- 152
            L+ +    +   DL+ +G  P   ++  GKPF G+ G +L K+++++   R  ++I   
Sbjct: 81  RLNAVFGCGSPDADLVFVGEGPGYDEDHIGKPFVGRAGQLLTKIIEAMGQARESVYIANI 140

Query: 153 ----SMISPWHPP---GNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNND 205
               +MI P +P     +R  +  EMEICRP +  Q+E+I PKI++ +G  +     N  
Sbjct: 141 VKCHAMIDPSNPEKRSNDRPPTLEEMEICRPYLDMQLEIIKPKIIVTLGASSTKGLLN-- 198

Query: 206 AQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
              + +++ +       +  I  + T HP  L++   +KK  W  +
Sbjct: 199 ---SIESISRIRGSVREYKGIKLIPTFHPAALLRNQDLKKFVWEDM 241


>gi|254168341|ref|ZP_04875186.1| uracil-DNA glycosylase, family 4 [Aciduliprofundum boonei T469]
 gi|289595797|ref|YP_003482493.1| phage SPO1 DNA polymerase-related protein [Aciduliprofundum boonei
           T469]
 gi|197622622|gb|EDY35192.1| uracil-DNA glycosylase, family 4 [Aciduliprofundum boonei T469]
 gi|289533584|gb|ADD07931.1| phage SPO1 DNA polymerase-related protein [Aciduliprofundum boonei
           T469]
          Length = 191

 Score = 79.0 bits (193), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 88/185 (47%), Gaps = 6/185 (3%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           SL +++  ++    C L  T  + +       + +M +G  P   ++  G+PF G  G  
Sbjct: 11  SLEKIEKEIKECKKCPLYKTRKNAVPGEGGFQRRIMFVGEAPGRREDELGRPFVGAAGKF 70

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           LD++L SI + R  ++I+ I    PPGNR+ ++ E+++C P + RQI ++ P+I+  +G 
Sbjct: 71  LDELLASIGLSRKDVYITNIVKCRPPGNRDPTDEEIKLCSPYLDRQIAIMKPRIICPLGR 130

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTP--HSIIPTLATVHPQELIQYPLIKKNTWHALIT 253
            +  +      +K    +GK S +        I  L   HP   + +  +K   + +   
Sbjct: 131 FSAKYIL----EKFGFEMGKISKIQGKVFEGNILILPMYHPAAALYHQNLKSELYKSFEV 186

Query: 254 LKKAL 258
           LK  L
Sbjct: 187 LKSLL 191


>gi|124026991|ref|YP_001012311.1| Uracil-DNA glycosylase [Hyperthermus butylicus DSM 5456]
 gi|123977685|gb|ABM79966.1| predicted Uracil-DNA glycosylase [Hyperthermus butylicus DSM 5456]
          Length = 221

 Score = 79.0 bits (193), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 64/121 (52%), Gaps = 3/121 (2%)

Query: 78  HELKSLLRSFHDCHLCSTSLSTICATQTEG---QDLMIIGYTPSDSDNISGKPFSGKTGN 134
            E + L+    +C  C            EG     +M+IG  P  ++++ G+PF G  G 
Sbjct: 5   EEYRRLVEEIMNCTKCRLHQYRRNPVPGEGPLNAKVMVIGEAPGRNEDLQGRPFVGAAGQ 64

Query: 135 MLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           +L+K+L+   + R Q++I+ I    PPGNR+    E++ C P ++ QI L+ PK+++ +G
Sbjct: 65  LLNKLLELAGLKREQVYITNIVKCRPPGNRDPQEDEVKACLPYLLHQIRLVKPKLIIAVG 124

Query: 195 N 195
            
Sbjct: 125 R 125


>gi|38493049|pdb|1UI1|A Chain A, Crystal Structure Of Uracil-Dna Glycosylase From Thermus
           Thermophilus Hb8
          Length = 205

 Score = 79.0 bits (193), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 54/192 (28%), Positives = 91/192 (47%), Gaps = 11/192 (5%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L  L++  ++   C L       +         L I+G  P + ++ +G+PF GK G +
Sbjct: 2   TLELLQAQAQNCTACRLXEGRTRVVFGEGNPDAKLXIVGEGPGEEEDKTGRPFVGKAGQL 61

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICR-PIIMRQIELISPKILLFIG 194
           L+++L++  I R +++I+ I    PP NR     E +IC    +++QIELI+P+I++ +G
Sbjct: 62  LNRILEAAGIPREEVYITNIVKCRPPQNRAPLPDEAKICTDKWLLKQIELIAPQIIVPLG 121

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP-----LIKKNTWH 249
                FF       T +  GKW      H I       HP  L++ P       K  TW 
Sbjct: 122 AVAAEFFLGEKVSIT-KVRGKWYEW---HGIK-VFPXFHPAYLLRNPSRAPGSPKHLTWL 176

Query: 250 ALITLKKALKNL 261
            +  +K+AL  L
Sbjct: 177 DIQEVKRALDAL 188


>gi|227826496|ref|YP_002828275.1| phage SPO1 DNA polymerase-related protein [Sulfolobus islandicus
           M.14.25]
 gi|229583658|ref|YP_002842159.1| phage SPO1 DNA polymerase-related protein [Sulfolobus islandicus
           M.16.27]
 gi|227458291|gb|ACP36977.1| phage SPO1 DNA polymerase-related protein [Sulfolobus islandicus
           M.14.25]
 gi|228018707|gb|ACP54114.1| phage SPO1 DNA polymerase-related protein [Sulfolobus islandicus
           M.16.27]
          Length = 216

 Score = 79.0 bits (193), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 82/179 (45%), Gaps = 4/179 (2%)

Query: 84  LRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSI 143
           +R    C L     + +        ++M IG  P ++++I GKPF G  G +L +++  +
Sbjct: 11  VRKCQKCRLWKYRKNAVPGEGNNKAEIMFIGEAPGENEDIEGKPFVGAAGKLLTRLINEV 70

Query: 144 -EIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFF 202
             + R  + I+ +    PP NR+    E+  C P + RQIELI P+I++ +G  + ++ F
Sbjct: 71  LGLSRDDVFITNLVKCRPPNNRDPEEDEIIACSPYLHRQIELIRPRIIITLGRHSTSYLF 130

Query: 203 ---NNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
              N   +   +  GK+         I    T HP   +  P I+K        +K+AL
Sbjct: 131 QIMNIKMESIGKVRGKFYTWNEYGYKILVFPTYHPAAALYNPPIRKILEEDFRKVKEAL 189


>gi|163783925|ref|ZP_02178897.1| predicted repair protein [Hydrogenivirga sp. 128-5-R1-1]
 gi|159880810|gb|EDP74342.1| predicted repair protein [Hydrogenivirga sp. 128-5-R1-1]
          Length = 214

 Score = 79.0 bits (193), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 75/165 (45%), Gaps = 5/165 (3%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L EL   ++    C L       +         LM +G  P   ++  G+PF G+ G +L
Sbjct: 35  LEELNKEIQECKKCDLYKNRKQAVLGEGNPNAKLMFVGEAPGADEDRLGRPFVGRAGQLL 94

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
            +++++    R + +I+ ++   PPGNR  +  E E C P + +QIE+I PK+L  +G  
Sbjct: 95  TRLIEATGHKREEFYIANVNKCRPPGNRTPTPWEQEACFPFLEKQIEIIDPKVLCLLGAA 154

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
               F       T +  G+  N      I+    T+HP  +++ P
Sbjct: 155 AARAFLKRPVSITKER-GEVLNWEGRKLIL----TLHPAYILRNP 194


>gi|227829105|ref|YP_002830884.1| phage SPO1 DNA polymerase-related protein [Sulfolobus islandicus
           L.S.2.15]
 gi|229577905|ref|YP_002836303.1| phage SPO1 DNA polymerase-related protein [Sulfolobus islandicus
           Y.G.57.14]
 gi|229580806|ref|YP_002839205.1| phage SPO1 DNA polymerase-related protein [Sulfolobus islandicus
           Y.N.15.51]
 gi|238618564|ref|YP_002913389.1| phage SPO1 DNA polymerase-related protein [Sulfolobus islandicus
           M.16.4]
 gi|284996491|ref|YP_003418258.1| phage SPO1 DNA polymerase-related protein [Sulfolobus islandicus
           L.D.8.5]
 gi|227455552|gb|ACP34239.1| phage SPO1 DNA polymerase-related protein [Sulfolobus islandicus
           L.S.2.15]
 gi|228008619|gb|ACP44381.1| phage SPO1 DNA polymerase-related protein [Sulfolobus islandicus
           Y.G.57.14]
 gi|228011522|gb|ACP47283.1| phage SPO1 DNA polymerase-related protein [Sulfolobus islandicus
           Y.N.15.51]
 gi|238379633|gb|ACR40721.1| phage SPO1 DNA polymerase-related protein [Sulfolobus islandicus
           M.16.4]
 gi|284444386|gb|ADB85888.1| phage SPO1 DNA polymerase-related protein [Sulfolobus islandicus
           L.D.8.5]
 gi|323473573|gb|ADX84179.1| phage SPO1 DNA polymerase-related protein [Sulfolobus islandicus
           REY15A]
 gi|323476220|gb|ADX81458.1| phage SPO1 DNA polymerase-related protein [Sulfolobus islandicus
           HVE10/4]
          Length = 216

 Score = 79.0 bits (193), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 82/179 (45%), Gaps = 4/179 (2%)

Query: 84  LRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSI 143
           +R    C L     + +        ++M IG  P ++++I GKPF G  G +L +++  +
Sbjct: 11  VRKCQKCRLWKYRKNAVPGEGNNKAEIMFIGEAPGENEDIEGKPFVGAAGKLLTRLINEV 70

Query: 144 -EIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFF 202
             + R  + I+ +    PP NR+    E+  C P + RQIELI P+I++ +G  + ++ F
Sbjct: 71  LGLSRDDVFITNLVKCRPPNNRDPEEDEIIACSPYLHRQIELIRPRIIITLGRHSTSYLF 130

Query: 203 ---NNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
              N   +   +  GK+         I    T HP   +  P I+K        +K+AL
Sbjct: 131 QIMNIKMESIGKVRGKFYTWNEYGYKILVFPTYHPAAALYNPPIRKILEEDFRKVKEAL 189


>gi|116620515|ref|YP_822671.1| Fis family transcriptional regulator [Candidatus Solibacter
           usitatus Ellin6076]
 gi|116223677|gb|ABJ82386.1| transcriptional regulator, Fis family [Candidatus Solibacter
           usitatus Ellin6076]
          Length = 204

 Score = 79.0 bits (193), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 83/182 (45%), Gaps = 18/182 (9%)

Query: 74  ACSLHELKSLLRSFHD-------CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGK 126
           A +L  +K   +S HD       CHL   +  T+         LM++G  P + ++++G 
Sbjct: 3   ASALIPVKLSWQSLHDAAGGCKACHLWEHATQTVFGEGKSHAPLMLVGEQPGNEEDLAGH 62

Query: 127 PFSGKTGNMLDKMLQSIEIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRPIIM 179
           PF G  G +LD  L++  I R Q +++ +     W P G R +    +  E+  C P + 
Sbjct: 63  PFVGPAGRLLDDALEAAGIDRKQAYVTNVVKHFKWEPRGKRRIHAKPTTAEITACIPWLT 122

Query: 180 RQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ 239
            ++EL+ P+IL+ +G            + T Q      +   P+     +ATVHP  +++
Sbjct: 123 AELELVKPRILICLGATAAQALLGRTFRVTKQRGKLVESKLAPY----VMATVHPSSILR 178

Query: 240 YP 241
            P
Sbjct: 179 AP 180


>gi|95929443|ref|ZP_01312186.1| phage SPO1 DNA polymerase-related protein [Desulfuromonas
           acetoxidans DSM 684]
 gi|95134559|gb|EAT16215.1| phage SPO1 DNA polymerase-related protein [Desulfuromonas
           acetoxidans DSM 684]
          Length = 243

 Score = 78.6 bits (192), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 81/177 (45%), Gaps = 7/177 (3%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           SL E++  L     C L     S +  +     +L+ +G  P   ++  G PF G+ G +
Sbjct: 60  SLEEIRQELGDCQRCGLAQGRKSIVFGSGNPHAELVFVGEGPGRDEDEQGVPFVGEAGRL 119

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           L+++L ++ + R Q++I  +    PP NRN    E+  C P + +Q+  + P++++ +G 
Sbjct: 120 LERILFAMGLDREQVYICNVVKCRPPQNRNPQPDEIAACEPFLKQQLASLKPRVIVALGK 179

Query: 196 KTKNFFFNNDAQKTYQNL-GKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
                      Q     L G W+     +  I  + T HP  L++ P  K++ W  +
Sbjct: 180 FAAQTLLQQ--QTPISRLRGNWAA----YQGIALMPTYHPAYLLRNPAGKRDVWEDM 230


>gi|32473807|ref|NP_866801.1| DNA polymerase [Rhodopirellula baltica SH 1]
 gi|32444343|emb|CAD74341.1| DNA polymerase, bacteriophage-type [Rhodopirellula baltica SH 1]
          Length = 321

 Score = 78.6 bits (192), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 55/219 (25%), Positives = 96/219 (43%), Gaps = 16/219 (7%)

Query: 44  KSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICAT 103
           ++ +  +QP+ +      P    +  IA++   L  L S++     C L +      C T
Sbjct: 108 RAPEGRLQPVESFSACDDPYPGTSLPIAERENQLTNLASVVAGCTKCTLLAK-----CRT 162

Query: 104 QT---EGQD---LMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISP 157
           QT   EG         G  P   ++  G+PF GK G +LDKM+Q+ ++ R  I++     
Sbjct: 163 QTVFGEGNPAARFAFFGEAPGADEDRLGRPFIGKAGQLLDKMVQACKLQREDIYLLNTVK 222

Query: 158 WHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWS 217
             PP NRN    E+  CR    +Q++++ P+ ++ +G  + +        KT  ++G+  
Sbjct: 223 CRPPENRNPEPTELANCREYFEQQLQILRPEYIVCLGAVSAHSLL-----KTKLSIGRLR 277

Query: 218 NLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
                +     L   HP  L++ P  KK  W  L  L +
Sbjct: 278 QRFHQYHESKVLVIYHPAYLLRNPDAKKAAWADLQMLMR 316


>gi|150020065|ref|YP_001305419.1| phage SPO1 DNA polymerase-related protein [Thermosipho
           melanesiensis BI429]
 gi|149792586|gb|ABR30034.1| phage SPO1 DNA polymerase-related protein [Thermosipho
           melanesiensis BI429]
          Length = 200

 Score = 78.6 bits (192), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 82/187 (43%), Gaps = 16/187 (8%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEGQ---DLMIIGYTPSDSDNISGKPFSGKTGNML 136
           +K ++    +C  C    +       EG     ++ +G  P + +++ G+PF G+ G +L
Sbjct: 7   MKIIIERIKECKACPLHENRTNVVPGEGNLDSPIVFVGEGPGEEEDLQGRPFVGRAGQLL 66

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
            K+L+S+ I R  ++I+ I    PP NR  +  E  IC   +  Q+E+I+PK+++ +G  
Sbjct: 67  TKILESVNIKREDVYITNIVKCRPPNNRTPTKEEASICSHFLFAQLEIINPKMIVTLGKP 126

Query: 197 TKNFFFNNDAQ--KTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKN-----TWH 249
               F        K   N  KW         I      HP  L++ P   K      TW 
Sbjct: 127 ALELFLGRTVAITKVRGNEFKW------RGGIIVFPMFHPSYLLRNPSKAKGSPKDLTWQ 180

Query: 250 ALITLKK 256
            +  ++K
Sbjct: 181 DIKRVRK 187


>gi|294054594|ref|YP_003548252.1| phage SPO1 DNA polymerase-related protein [Coraliomargarita
           akajimensis DSM 45221]
 gi|293613927|gb|ADE54082.1| phage SPO1 DNA polymerase-related protein [Coraliomargarita
           akajimensis DSM 45221]
          Length = 349

 Score = 78.6 bits (192), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 85/188 (45%), Gaps = 16/188 (8%)

Query: 79  ELKSLLRSFHDCHLCSTSLS----TICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
           +L  L      C  C+++L+     +    +   D+   G  P   + I+G+PF GK G 
Sbjct: 146 QLAWLRERVEQCETCNSNLNLDGRIVFGEGSPNADIFFCGEAPGADEEIAGQPFVGKAGQ 205

Query: 135 MLDKMLQSIEIMRTQIHISMISPWHPP-----GNRNLSNIEMEICRPIIMRQIELISPKI 189
           +L K++ ++ + R  ++I  I  W P      GNR  +  EM  C P +  Q+E+I PK+
Sbjct: 206 LLTKIISAMGLSREDVYIGNILKWRPQHDKPYGNRPPTEDEMNFCLPYLKAQLEIIQPKV 265

Query: 190 LLFIGNKTKNFFFNNDA-QKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKN-- 246
           ++ +GN   +     D  ++  Q  G W +      +I    T HP  L++   +K    
Sbjct: 266 IVALGNTAVSGLLGQDPNRRLGQVRGNWHDFNGTDLMI----TFHPSYLLRNDTMKTKRL 321

Query: 247 TWHALITL 254
            W  ++ +
Sbjct: 322 VWEDMLKV 329


>gi|121533311|ref|ZP_01665139.1| phage SPO1 DNA polymerase-related protein [Thermosinus
           carboxydivorans Nor1]
 gi|121307870|gb|EAX48784.1| phage SPO1 DNA polymerase-related protein [Thermosinus
           carboxydivorans Nor1]
          Length = 231

 Score = 78.6 bits (192), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 51/187 (27%), Positives = 93/187 (49%), Gaps = 8/187 (4%)

Query: 79  ELKSLLRSFHDCHLC-STSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLD 137
           EL++ L + + C LC   +        T    LM++G  P   ++  G P  G +G +LD
Sbjct: 13  ELEAALLACNQCALCREGNRGPTSYNGTPDSPLMLVGEGPGGVEDEYGVPLVGPSGQLLD 72

Query: 138 KMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIM-RQIELISPKILLFIGNK 196
           + L S+ I R +I+ + +    P GNR  +  E ++C    +  +I L+ PKI++ +G+ 
Sbjct: 73  RALASVGITRDRIYTTNVVKCRPRGNRTPTVEEGQVCASRWLDAEITLVKPKIIIALGSV 132

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPL--IKKNTWHALITL 254
              + +  +A+ T ++ G+W    T +  IP +AT HP  L++     + +  W     L
Sbjct: 133 ALKYLYEPNARIT-KDRGRW--FMTKYG-IPAIATYHPAYLLRLTGQDLVRAKWEVYYDL 188

Query: 255 KKALKNL 261
           K A++ L
Sbjct: 189 KAAVERL 195


>gi|170290590|ref|YP_001737406.1| Uracil-DNA glycosylase [Candidatus Korarchaeum cryptofilum OPF8]
 gi|170174670|gb|ACB07723.1| Uracil-DNA glycosylase [Candidatus Korarchaeum cryptofilum OPF8]
          Length = 193

 Score = 78.6 bits (192), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 79/169 (46%), Gaps = 4/169 (2%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEGQ---DLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L+ L      C  C   L+   A   EG     +M +G  P  +++  G+PF G  G +L
Sbjct: 3   LEDLAEEILRCEKCPLHLNRKRAVPGEGNPNSRIMFVGEAPGRNEDEMGRPFVGAAGKLL 62

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
           +++L SI + R  + I+ +    PP NR+    E+E C P +  QIELI P+IL+ +G  
Sbjct: 63  EELLISIGLRRQDVFITNVVKCRPPNNRDPRPEEIEACLPYLKAQIELIDPEILVPLGRH 122

Query: 197 TKNFFFNNDAQKTYQNL-GKWSNLCTPHSIIPTLATVHPQELIQYPLIK 244
           +         + +   + GK   +    +I   L T+HP   +  P +K
Sbjct: 123 SVGVLLGRIGEISILRVRGKVYEVEVFGAIRKVLPTLHPAAALYNPRLK 171


>gi|261367056|ref|ZP_05979939.1| uracil-DNA glycosylase [Subdoligranulum variabile DSM 15176]
 gi|282571175|gb|EFB76710.1| uracil-DNA glycosylase [Subdoligranulum variabile DSM 15176]
          Length = 188

 Score = 78.6 bits (192), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 87/173 (50%), Gaps = 6/173 (3%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C LC +    +        +++ +G  P  +++  G+PF G++G +LD  L+++++ R +
Sbjct: 16  CGLCESRTHVVFGQGVPNAEVLFVGEGPGANEDAQGQPFVGRSGQLLDHYLEAVDLNREK 75

Query: 150 -IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQK 208
            ++I+ I    PP NR+    E   C P + +Q +L+ PKI++ +G              
Sbjct: 76  NVYIANIVKCRPPQNRDPLPEESAACLPWLRQQFQLLRPKIIVCLGRIAAQQLIEPGFSV 135

Query: 209 TYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
           T ++ GK+ +    H  +  +AT HP  L++YP+ K   +   + L++ +  +
Sbjct: 136 T-RDHGKFFD---KHGTL-FMATYHPAALLRYPVNKPAVFGDFVALREKIAQV 183


>gi|237748493|ref|ZP_04578973.1| DNA polymerase bacteriophage-type [Oxalobacter formigenes OXCC13]
 gi|229379855|gb|EEO29946.1| DNA polymerase bacteriophage-type [Oxalobacter formigenes OXCC13]
          Length = 304

 Score = 78.6 bits (192), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 49/183 (26%), Positives = 83/183 (45%), Gaps = 10/183 (5%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           LHE+    R    CHLC +    +     +    + +G  P   ++  G+PF G++G++L
Sbjct: 113 LHEINHCER----CHLCKSRNKVVPGVGDQHAGWLFVGEGPGFHEDQQGEPFVGRSGHLL 168

Query: 137 DKMLQSIEIMRTQ-IHISMISPWHP----PGNRNLSNIEMEICRPIIMRQIELISPKILL 191
           D M+ ++ + R + ++I+ +           +R  +  E   C P + RQI+LI PKI++
Sbjct: 169 DAMMAAMHMKRGENVYIANVVKCRATNEFAKDRQPTEEEAAFCMPYLERQIDLIKPKIMV 228

Query: 192 FIGNKTKNFFFNNDAQKTYQNL-GKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHA 250
            +G        N   + T  +L  K          IP + T HP  L++ P  KK  W  
Sbjct: 229 ALGKTAACALLNTGREVTLGSLRNKTHVFRVAGRRIPLIVTYHPSYLLRTPGGKKQAWQD 288

Query: 251 LIT 253
           L T
Sbjct: 289 LCT 291


>gi|254168263|ref|ZP_04875109.1| uracil-DNA glycosylase, family 4 [Aciduliprofundum boonei T469]
 gi|197622772|gb|EDY35341.1| uracil-DNA glycosylase, family 4 [Aciduliprofundum boonei T469]
          Length = 191

 Score = 78.6 bits (192), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 88/185 (47%), Gaps = 6/185 (3%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           SL +++  ++    C L  T  + +       + +M +G  P   ++  G+PF G  G  
Sbjct: 11  SLEKIEKEIKECKKCPLYKTRKNAVPGEGGFQRRIMFVGEAPGRREDELGRPFVGSAGKF 70

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           LD++L SI + R  ++I+ I    PPGNR+ ++ E+++C P + RQI ++ P+I+  +G 
Sbjct: 71  LDELLASIGLSRKDVYITNIVKCRPPGNRDPTDEEIKLCSPYLDRQIAIMKPRIICPLGR 130

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTP--HSIIPTLATVHPQELIQYPLIKKNTWHALIT 253
            +  +      +K    +GK S +        I  L   HP   + +  +K   + +   
Sbjct: 131 FSAKYIL----EKFGFEIGKISKIQGKVFEGNILILPMYHPAAALYHQNLKTELYKSFEV 186

Query: 254 LKKAL 258
           LK  L
Sbjct: 187 LKSLL 191


>gi|159042210|ref|YP_001541462.1| phage SPO1 DNA polymerase-related protein [Caldivirga
           maquilingensis IC-167]
 gi|157921045|gb|ABW02472.1| phage SPO1 DNA polymerase-related protein [Caldivirga
           maquilingensis IC-167]
          Length = 209

 Score = 78.6 bits (192), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 65/119 (54%), Gaps = 3/119 (2%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQ---DLMIIGYTPSDSDNISGKPFSGKTGNM 135
           EL  +     +C  C   LS   A   EG    ++M+IG  P   ++ +G+PF G  G +
Sbjct: 12  ELAEINSEVSNCRKCPLYLSRKKAVPGEGNPRAEVMLIGEAPGRVEDETGRPFVGAAGKL 71

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           LD++L  I + R  ++I+ +    PP NR+ +  E+  C+P ++RQI ++ P+ ++ +G
Sbjct: 72  LDELLHEIGVDRGNLYITNVVKCRPPNNRDPTEEEINACKPYLIRQIAVVRPRKIITLG 130


>gi|116754774|ref|YP_843892.1| phage SPO1 DNA polymerase-related protein [Methanosaeta thermophila
           PT]
 gi|116666225|gb|ABK15252.1| phage SPO1 DNA polymerase-related protein [Methanosaeta thermophila
           PT]
          Length = 184

 Score = 78.2 bits (191), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 62/120 (51%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
            L EL   +     C L  T  + +     E   +M+IG  P  +++++G+PF G+ G +
Sbjct: 5   DLRELACEIVRCERCGLSKTRRNAVPGEGPEDARIMMIGEAPGAAEDLAGRPFVGRAGAI 64

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           L++ L    + R +I I+ I    PPGNR  S  E+  C P + +QIE++ P  +  +GN
Sbjct: 65  LNRALNLAGLDRDEIFITNIVKCRPPGNRQPSADEIRACMPYLRKQIEMVRPSAICLLGN 124


>gi|229816615|ref|ZP_04446913.1| hypothetical protein COLINT_03672 [Collinsella intestinalis DSM
           13280]
 gi|229807821|gb|EEP43625.1| hypothetical protein COLINT_03672 [Collinsella intestinalis DSM
           13280]
          Length = 226

 Score = 78.2 bits (191), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 84/185 (45%), Gaps = 20/185 (10%)

Query: 73  KACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKT 132
           +  SL E++S++     C L  T  + +         +M +G  P  ++++ G+PF G+ 
Sbjct: 15  REVSLDEIRSVMGDCRACQLYQTRTNIVFGVGNPRARVMFVGEAPGKNEDLQGEPFVGRA 74

Query: 133 GNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLF 192
           G  L+++L    + R  I+I+ +    PP NRN    E+  C P +  QI  I P +++ 
Sbjct: 75  GENLNRILSLAGLEREDIYIANVLKCRPPQNRNPQADEVLACSPYLREQIRSIWPDVIVT 134

Query: 193 IGNKTKNFFFNNDAQKT-----YQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNT 247
           +GN   +F    +   T     +  +G +       +++PT    HP   ++ P      
Sbjct: 135 LGNPASHFVLKTEVGITKLRGRFHQMGHF-------TVMPTF---HPAAALRNP-----A 179

Query: 248 WHALI 252
           W AL+
Sbjct: 180 WQALL 184


>gi|87302163|ref|ZP_01084988.1| hypothetical protein WH5701_08179 [Synechococcus sp. WH 5701]
 gi|87283088|gb|EAQ75044.1| hypothetical protein WH5701_08179 [Synechococcus sp. WH 5701]
          Length = 218

 Score = 78.2 bits (191), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 58/209 (27%), Positives = 89/209 (42%), Gaps = 29/209 (13%)

Query: 69  SIAQKACSLHE--LKSLLRSFHDCHLCSTSLSTICATQTEGQD---LMIIGYTPSDSDNI 123
             A +A +L E  L+ L     +C  CS +        + G     LM+IG  P   ++ 
Sbjct: 6   GTAGQATALREGALQQLAGGCAECRRCSLADGRQQVVVSRGDPHAALMVIGEGPGAQEDA 65

Query: 124 SGKPFSGKTGNMLDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQI 182
           SG PF G+ G +LD+ML S+ I   +  +I  +    PP NR  +  EM  C P +++Q+
Sbjct: 66  SGSPFVGRAGQLLDRMLASVGIDSNRDAYICNVVKCRPPENRKPTPQEMAACLPWLLQQV 125

Query: 183 ELISPKILLFIGNKTKNFFFN--------NDAQKTYQNLGKWSNLCTPHSIIPTLATVHP 234
           EL+ P+++L  G                     +T+Q  G+W   C P          HP
Sbjct: 126 ELVQPQVVLLAGATAVEGVLGIKGGITRLRGQWRTWQ--GRW---CLP--------IFHP 172

Query: 235 QELIQYPLIKKNT--WHALITLKKALKNL 261
             L++ P  +  T  WH    LK     L
Sbjct: 173 SYLLRNPSREPETPKWHTWQDLKAVRSRL 201


>gi|330834083|ref|YP_004408811.1| phage SPO1 DNA polymerase-related protein [Metallosphaera cuprina
           Ar-4]
 gi|329566222|gb|AEB94327.1| phage SPO1 DNA polymerase-related protein [Metallosphaera cuprina
           Ar-4]
          Length = 206

 Score = 78.2 bits (191), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 62/115 (53%), Gaps = 1/115 (0%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQS-IEIMRT 148
           CHL  T    +        +++++G  P   ++ +G+PF G  G +LD+++Q  + I R 
Sbjct: 14  CHLHKTRTYAVPGEGNTNSEIVLVGEAPGAKEDRTGRPFVGAAGQLLDELIQRYLRIERD 73

Query: 149 QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFN 203
            + I+ +    PP NR+ S  E+  C P ++ QI LI PKI++ +G  +  FF N
Sbjct: 74  SVFITNLVKCRPPNNRDPSEDEIVTCSPYLLAQINLIKPKIIVTLGRHSTRFFQN 128


>gi|158337182|ref|YP_001518357.1| DNA polymerase bacteriophage-type [Acaryochloris marina MBIC11017]
 gi|158307423|gb|ABW29040.1| DNA polymerase bacteriophage-type, putative [Acaryochloris marina
           MBIC11017]
          Length = 232

 Score = 78.2 bits (191), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 82/171 (47%), Gaps = 14/171 (8%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L EL +  +    C L  +    + +       ++IIG  P   ++ +G PF G+ G +
Sbjct: 42  NLQELTTHCQQCQRCDLAPSRTHVVVSRGNPEAPILIIGEGPGQHEDETGLPFVGRAGQL 101

Query: 136 LDKMLQSIEI-MRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           LDK+L S+++  +  ++I  I    PPGNR  +  E   C+P ++ QI L++PKI+L  G
Sbjct: 102 LDKILASVKLDSQNDVYICNIVKCRPPGNRTPTPDESAACKPYLLEQIRLVNPKIILLTG 161

Query: 195 NKTKNFFFNNDAQKTYQNLGKW----SNLCTPHSIIPTLATVHPQELIQYP 241
             T       D +   +  G+W    + LC P         +HP  L++ P
Sbjct: 162 -ATAVRGLTGDKRGITKIRGQWLAWQNYLCMP--------ILHPAYLLRNP 203


>gi|327537178|gb|EGF23927.1| phage SPO1 DNA polymerase-related protein [Rhodopirellula baltica
           WH47]
          Length = 321

 Score = 77.8 bits (190), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 55/219 (25%), Positives = 96/219 (43%), Gaps = 16/219 (7%)

Query: 44  KSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICAT 103
           ++ +  +QP+ +      P    +  IA++   L  L S++     C L +      C T
Sbjct: 108 RAPEGRLQPVESFSASDDPYPGTSLPIAERENQLTNLASVVAGCTKCTLLAK-----CRT 162

Query: 104 QT---EGQD---LMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISP 157
           QT   EG         G  P   ++  G+PF GK G +LDKM+Q+ ++ R  I++     
Sbjct: 163 QTVFGEGNPAARFAFFGEAPGADEDRLGRPFIGKAGQLLDKMVQACKLQREDIYLLNTVK 222

Query: 158 WHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWS 217
             PP NRN    E+  CR    +Q++++ P+ ++ +G  + +        KT  ++G+  
Sbjct: 223 CRPPENRNPEPTELANCREYFEQQLQILRPEYIVCLGAVSAHSLL-----KTKLSIGRLR 277

Query: 218 NLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
                +     L   HP  L++ P  KK  W  L  L +
Sbjct: 278 QRFHQYHESKVLVIYHPAYLLRNPDAKKAAWADLQMLMR 316


>gi|17230510|ref|NP_487058.1| hypothetical protein alr3018 [Nostoc sp. PCC 7120]
 gi|17132112|dbj|BAB74717.1| alr3018 [Nostoc sp. PCC 7120]
          Length = 227

 Score = 77.8 bits (190), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 81/171 (47%), Gaps = 14/171 (8%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           ++ EL         C L ST    +         +M++G  P  +++ +G PF G++G +
Sbjct: 37  NMTELAQHCNQCQRCELGSTRTHAVVGRGNLKAPIMVVGEAPGQNEDETGLPFVGRSGQL 96

Query: 136 LDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           LDK+L S+++     ++I+ I+   PP NR  +  EM  C P ++ QI L++PKI+L  G
Sbjct: 97  LDKILASVDLTTEHDVYIANINKCRPPDNRVPTPNEMAACLPYLLEQIRLVNPKIILLTG 156

Query: 195 NKTKNFFFNNDAQKTYQNLGKW----SNLCTPHSIIPTLATVHPQELIQYP 241
             T       D +   +  G+W     +LC P          HP  L++ P
Sbjct: 157 -ATAVKGLTGDKRGITKIRGQWIEWAGHLCMP--------IFHPSYLLRNP 198


>gi|269986729|gb|EEZ93009.1| phage SPO1 DNA polymerase-related protein [Candidatus Parvarchaeum
           acidiphilum ARMAN-4]
          Length = 189

 Score = 77.8 bits (190), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 42/156 (26%), Positives = 75/156 (48%), Gaps = 1/156 (0%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C LC    + +     E  D+++IG  P  ++++ G+PF G +G  L K L+S+ I R  
Sbjct: 17  CELCLKRTNAVPGEGNEKADIVVIGEAPGKNEDLQGRPFIGMSGKFLTKNLESLNIKRDS 76

Query: 150 IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKT 209
           + I+      PP NR     E++ CR  ++RQ+  I+PK++L +G          + +  
Sbjct: 77  VFITNAVKCRPPNNRKPKKEELDKCRSYLVRQLSSINPKLILALGTSAAT-SLGIEFKHL 135

Query: 210 YQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKK 245
            +  GK  ++         L T HP   +++P  +K
Sbjct: 136 SEIKGKVIDISLNGKKFKCLVTFHPSFPMRFPSARK 171


>gi|75907116|ref|YP_321412.1| phage SPO1 DNA polymerase-like protein [Anabaena variabilis ATCC
           29413]
 gi|75700841|gb|ABA20517.1| Phage SPO1 DNA polymerase-related protein [Anabaena variabilis ATCC
           29413]
          Length = 227

 Score = 77.8 bits (190), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 81/171 (47%), Gaps = 14/171 (8%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           ++ EL         C L ST    +         +M++G  P  +++ +G PF G++G +
Sbjct: 37  NMTELAQHCNQCQRCELGSTRTHAVVGRGNLKAPIMVVGEAPGQNEDETGLPFVGRSGQL 96

Query: 136 LDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           LDK+L S+++     ++I+ I+   PP NR  +  EM  C P ++ QI L++PKI+L  G
Sbjct: 97  LDKILASVDLTTEHDVYIANINKCRPPDNRVPTPNEMAACLPYLLEQIRLVNPKIILLTG 156

Query: 195 NKTKNFFFNNDAQKTYQNLGKW----SNLCTPHSIIPTLATVHPQELIQYP 241
             T       D +   +  G+W     +LC P          HP  L++ P
Sbjct: 157 -ATAVKGLTGDKRGITKIRGQWIEWEGHLCMP--------IFHPSYLLRNP 198


>gi|237756256|ref|ZP_04584815.1| uracil-DNA glycosylase, family 4 [Sulfurihydrogenibium
           yellowstonense SS-5]
 gi|237691575|gb|EEP60624.1| uracil-DNA glycosylase, family 4 [Sulfurihydrogenibium
           yellowstonense SS-5]
          Length = 161

 Score = 77.8 bits (190), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 69/139 (49%), Gaps = 5/139 (3%)

Query: 59  IHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQ---DLMIIGY 115
           +  P++ Q  S   +   + EL  +      C  C    +       EG     +M IG 
Sbjct: 20  LDKPILNQKSS--NQIDKIEELNKIFEETKVCTKCDLHKNRTNPVLGEGNINAKIMFIGE 77

Query: 116 TPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICR 175
            P + ++  G+PF GK G +L K +++    R +++I+ I+   PP NR  +  E E C 
Sbjct: 78  APGEEEDKQGRPFVGKAGKLLTKCIENAGYRREEVYIANINKCRPPNNRTPTIEEQEACI 137

Query: 176 PIIMRQIELISPKILLFIG 194
           P ++RQIE+I+PK+L  +G
Sbjct: 138 PYLLRQIEIINPKVLCLLG 156


>gi|118431039|ref|NP_147220.2| uracil-DNA glycosylase [Aeropyrum pernix K1]
 gi|116062365|dbj|BAA79385.2| uracil-DNA glycosylase [Aeropyrum pernix K1]
          Length = 227

 Score = 77.8 bits (190), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 64/127 (50%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L +L+  +R    C L +T    +         +M++G  P   ++  G+PF G  G +L
Sbjct: 6   LRQLEEEVRRCTRCPLHATRTHAVPGEGPGEAGVMVVGEAPGRMEDRLGRPFVGPAGKLL 65

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
           D +L+   + R +++I+ +    PPGNR+    E+E C P ++ QI LI P++++ +G  
Sbjct: 66  DSLLELAGLSRGEVYITNVVKCRPPGNRDPREEEIEACLPYLVEQISLIRPRLVIAVGRH 125

Query: 197 TKNFFFN 203
                F 
Sbjct: 126 AGRTLFR 132


>gi|217076510|ref|YP_002334226.1| uracil-DNA glycosylase [Thermosipho africanus TCF52B]
 gi|217036363|gb|ACJ74885.1| uracil-DNA glycosylase [Thermosipho africanus TCF52B]
          Length = 199

 Score = 77.8 bits (190), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 82/184 (44%), Gaps = 16/184 (8%)

Query: 83  LLRSFHDCHLCSTSLSTICATQTEGQ---DLMIIGYTPSDSDNISGKPFSGKTGNMLDKM 139
           ++    +C  C    +       EG     +M +G  P + +++SG+PF G+ G +L K+
Sbjct: 10  IVERIKNCKACPLHENRTNVVPGEGNLDSPIMFVGEGPGEDEDLSGRPFVGRAGQLLTKI 69

Query: 140 LQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKN 199
           L+S+ I R  ++I+ I    PP NR  +  E  IC   +  QIE+I+P++++ +G     
Sbjct: 70  LESVNIKREDVYITNIVKCRPPNNRTPTKEEASICSHYLFAQIEVINPRMIVTLGKPALE 129

Query: 200 FFFNNDAQ--KTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKN-----TWHALI 252
            F        K   N  +W        II      HP  L++ P   K      TW  + 
Sbjct: 130 LFLGKSVAITKVRGNEFEWKG-----GII-IFPMFHPSYLLRNPSKAKGSPKDLTWQDIK 183

Query: 253 TLKK 256
            ++K
Sbjct: 184 RVRK 187


>gi|318041681|ref|ZP_07973637.1| hypothetical protein SCB01_08212 [Synechococcus sp. CB0101]
          Length = 214

 Score = 77.8 bits (190), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 53/197 (26%), Positives = 86/197 (43%), Gaps = 17/197 (8%)

Query: 78  HELKSLLRSFHDCHLCSTSLSTICATQTEGQD---LMIIGYTPSDSDNISGKPFSGKTGN 134
            EL  +  +   C  C    S      + G     LM+IG  P   ++  GKPF G++G 
Sbjct: 18  QELDQVAAACDGCRRCGLGHSRTQVVVSRGNPRAPLMVIGEGPGAQEDEQGKPFVGRSGQ 77

Query: 135 MLDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFI 193
           +LD+ML+S+ I   +  ++  I    PP NR  + +EM  CRP + +QI+L+ P ++L  
Sbjct: 78  LLDRMLESVGIDSNRDAYVCNIVKCRPPENRKPTGLEMAACRPWLDQQIQLVDPPVILLA 137

Query: 194 GNKTKNFFFNNDAQKTYQNLGKW----SNLCTPHSIIPTLATVHPQELIQYPLIKKN--- 246
           G              T    G+W            ++P L   HP  L++    ++    
Sbjct: 138 GATAVEGLLGIKGGITKLR-GQWRKGEGGSLEGRWLMPIL---HPSYLLRNASKERGSPK 193

Query: 247 --TWHALITLKKALKNL 261
             TWH L  +++ L  L
Sbjct: 194 WLTWHDLQDVQRRLAQL 210


>gi|196228387|ref|ZP_03127254.1| phage SPO1 DNA polymerase-related protein [Chthoniobacter flavus
           Ellin428]
 gi|196227790|gb|EDY22293.1| phage SPO1 DNA polymerase-related protein [Chthoniobacter flavus
           Ellin428]
          Length = 302

 Score = 77.8 bits (190), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 48/201 (23%), Positives = 94/201 (46%), Gaps = 16/201 (7%)

Query: 71  AQKACSLHELKSLLRSFHDC-HLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFS 129
             KA  L  ++  + +   C HL  +    +        +LM +G  P + ++  G+PF 
Sbjct: 96  GSKAERLAAMRGPVLACTKCPHLVKSRTQVVFGVGNPEAELMFVGEAPGEDEDRQGEPFV 155

Query: 130 GKTGNMLDKMLQSIEIMRTQIHISMISPWHP------PGNRNLSNIEMEICRPIIMRQIE 183
           GK G +L K+++++   R  ++I+ +    P      PGNR     EM+ C P +  QI+
Sbjct: 156 GKAGQLLTKIIETMGFARGDVYIANVLKCRPDMPPGMPGNRKPKVEEMQTCLPYLREQID 215

Query: 184 LISPKILLFIG-NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPL 242
           +I P++L+ +G    +    + D+    +  G+W +    H   P +AT HP  L++   
Sbjct: 216 IIRPRLLVALGATAMEGLTGSTDSMSRLR--GRWHDF---HG-TPLMATYHPAYLLRNQS 269

Query: 243 I--KKNTWHALITLKKALKNL 261
           +  K+  W  ++ + + L  +
Sbjct: 270 LSEKRKVWEDMLMVLERLGKM 290


>gi|297566593|ref|YP_003685565.1| phage SPO1 DNA polymerase-like protein [Meiothermus silvanus DSM
           9946]
 gi|296851042|gb|ADH64057.1| phage SPO1 DNA polymerase-related protein [Meiothermus silvanus DSM
           9946]
          Length = 205

 Score = 77.8 bits (190), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 51/178 (28%), Positives = 85/178 (47%), Gaps = 11/178 (6%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C L  T    +         + I+G  P + ++ +G+PF GK G +LD++L++  I R  
Sbjct: 16  CRLAKTRTKVVFGEGNPDAKVFIVGEGPGEEEDKTGRPFVGKAGQLLDRILEAAGIPRES 75

Query: 150 IHISMISPWHPPGNRNLSNIEMEICRPIIM-RQIELISPKILLFIGNKTKNFFFNNDAQK 208
           I+IS I    PP NR     E++ C  + + +Q+ELI P+I++ +G     FF       
Sbjct: 76  IYISNIVKCRPPQNRVPLPDEVKACTSLWLNKQLELIRPQIIVPLGATAAEFFLGEKVSI 135

Query: 209 TYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP-----LIKKNTWHALITLKKALKNL 261
           T +  G+W +    H I+      HP  L++ P       K  TW  +  LK+ + +L
Sbjct: 136 T-KIRGQWMDW---HGIL-LFPMFHPAYLLRNPSRAAGSPKHLTWLDIQALKQKMDSL 188


>gi|282895506|ref|ZP_06303643.1| Phage SPO1 DNA polymerase-related protein [Raphidiopsis brookii D9]
 gi|281199539|gb|EFA74402.1| Phage SPO1 DNA polymerase-related protein [Raphidiopsis brookii D9]
          Length = 225

 Score = 77.8 bits (190), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 48/152 (31%), Positives = 72/152 (47%), Gaps = 6/152 (3%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +++EL     + H C L  T    +         +MIIG  P   ++ +G PF GK+G +
Sbjct: 36  NINELTLHCENCHRCGLGKTRTHAVVGRGNPQAKIMIIGEAPGQHEDETGLPFVGKSGQL 95

Query: 136 LDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           LDK+L S+ +   Q ++I  I    PP NR  ++ E   CRP ++ QI L+ PKI+L  G
Sbjct: 96  LDKILASVNLTTEQDVYICNIVKCRPPENRVPTSEESNACRPYLLEQIRLVDPKIILLTG 155

Query: 195 NKTKNFFFNNDAQKTYQNLGKW----SNLCTP 222
                    N    T +  G+W      LC P
Sbjct: 156 ATAVKGVTGNKLPIT-KIRGQWLEWEGRLCMP 186


>gi|220929817|ref|YP_002506726.1| phage SPO1 DNA polymerase-related protein [Clostridium
           cellulolyticum H10]
 gi|220000145|gb|ACL76746.1| phage SPO1 DNA polymerase-related protein [Clostridium
           cellulolyticum H10]
          Length = 190

 Score = 77.8 bits (190), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 86/184 (46%), Gaps = 5/184 (2%)

Query: 78  HELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLD 137
            +L S   +  +C L  T  + +         +M IG  P + +++ G PF G  G +LD
Sbjct: 5   EQLNSTCNNCRNCDLAGTRTNIVIGRGNPNAPIMFIGEGPGEQEDLRGLPFVGPAGQLLD 64

Query: 138 KMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT 197
            +L++++    + +I+ +    PP NR  +  E E C P +  Q+ LI P+I++ +G+  
Sbjct: 65  TLLEALKFKPDEYYIANVVKCRPPNNRVPNEEEAEKCLPYLRNQVALIRPRIIVCLGSTA 124

Query: 198 KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKA 257
             +    DA+ T Q  G W        I+PT    HP  L++    K+  +  +  +KK 
Sbjct: 125 AKYIVARDAKIT-QIRGHWIQR-KKFWIMPTF---HPAALLRDQSKKELLFKDIKEVKKK 179

Query: 258 LKNL 261
           +  L
Sbjct: 180 INQL 183


>gi|300114529|ref|YP_003761104.1| phage SPO1 DNA polymerase-like protein [Nitrosococcus watsonii
           C-113]
 gi|299540466|gb|ADJ28783.1| phage SPO1 DNA polymerase-related protein [Nitrosococcus watsonii
           C-113]
          Length = 189

 Score = 77.8 bits (190), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 83/167 (49%), Gaps = 6/167 (3%)

Query: 68  DSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKP 127
           D + +KA +LHEL      +   ++       +         +MIIG  P   +  +G+P
Sbjct: 2   DDLLKKAATLHELAQYCNRYLGPNVVKGE-KLVFGEGPSSAKIMIIGEAPGVQEAKTGQP 60

Query: 128 FSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISP 187
           F G +G +L K+L  I + R QI+IS I   HPPGNR     E++   P ++RQIEL+ P
Sbjct: 61  FVGSSGQLLTKLLHQIGLKREQIYISNILKTHPPGNRKPHRSEIKRELPFLLRQIELLQP 120

Query: 188 KILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHP 234
           ++L+ +G        + +A+ T    G+W  +      +PT  T HP
Sbjct: 121 QLLVLLGATALQALLDPNAKITKLR-GQWLEIKN----LPTFVTYHP 162


>gi|18977757|ref|NP_579114.1| DNA polymerase [Pyrococcus furiosus DSM 3638]
 gi|18893498|gb|AAL81509.1| DNA polymerase, bacteriophage-type [Pyrococcus furiosus DSM 3638]
          Length = 196

 Score = 77.4 bits (189), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 86/188 (45%), Gaps = 3/188 (1%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           + +L+  + +   C L     + +         +M IG  P   ++  G PF GK G +L
Sbjct: 7   MKKLEEKILTCKKCPLWRLRTNPVPGYGNYDAKIMFIGEAPGYWEDQKGLPFVGKAGKVL 66

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
           D++L  I + R  ++I+ +    PP NR+ +  E++ C P + +QI++I PK+++ +G  
Sbjct: 67  DELLDGIGLTREDVYITNVVKCRPPNNRDPTEEEIKACSPYLDQQIDIIKPKVIVTLGRH 126

Query: 197 TKNFF---FNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALIT 253
           + N+    F  D +   +  GK     T    +    T HP   +  P +K+        
Sbjct: 127 STNYILKKFGFDLEPISKIHGKVFKAKTLFGTLYIFPTYHPAVALYRPQLKEELKQDFDI 186

Query: 254 LKKALKNL 261
           LK  L+ L
Sbjct: 187 LKSLLEKL 194


>gi|302389751|ref|YP_003825572.1| phage SPO1 DNA polymerase-related protein [Thermosediminibacter
           oceani DSM 16646]
 gi|302200379|gb|ADL07949.1| phage SPO1 DNA polymerase-related protein [Thermosediminibacter
           oceani DSM 16646]
          Length = 252

 Score = 77.4 bits (189), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 94/188 (50%), Gaps = 15/188 (7%)

Query: 82  SLLRSFHDCHLCSTSLSTICATQTEGQD------LMIIGYTPSDSDNISGKPFSGKTGNM 135
            +L+  ++C  C   L+  C TQ    D      LM+IG  P   ++  GKPF G+ G +
Sbjct: 63  EVLKLLYECGECPLHLAE-CHTQKVPGDGDWNSPLMLIGEGPGFEEDKQGKPFVGRAGQL 121

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           L  +L  + I R +++I+ +    PP NR   + E++ C+ I+  ++E I+PK+++ +G+
Sbjct: 122 LTAILNKLNIDRKKVYITNVVKCRPPMNRTPQSKEIKACKRILELELEFIAPKVIITLGS 181

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQY--PLIKKNTWHALIT 253
              N+F  N +    Q+ G+W        I+PT    HP  +++     +K+  W     
Sbjct: 182 VPLNYFKPNSS--IMQSRGQWI-YKRGFWIMPTF---HPAYILRQGGETLKRVKWQVWGD 235

Query: 254 LKKALKNL 261
             KA++ +
Sbjct: 236 FNKAIEKV 243


>gi|28210008|ref|NP_780952.1| DNA polymerase [Clostridium tetani E88]
 gi|28202443|gb|AAO34889.1| DNA polymerase, bacteriophage-type [Clostridium tetani E88]
          Length = 188

 Score = 77.4 bits (189), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 84/176 (47%), Gaps = 9/176 (5%)

Query: 90  CHLCSTSLSTICATQTEGQ---DLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIM 146
           C+ C  S +       EG    D+M IG  P   ++ +G+PF G+ G  L KML S++++
Sbjct: 14  CNKCDLSKNRTHMVFGEGNSKADIMFIGEAPGGDEDKTGRPFVGRAGQFLTKMLNSLDLI 73

Query: 147 RTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNND 205
           R +  +I  I    P  NRN    E++ C P +  Q  L+ P+I++ +G    N    +D
Sbjct: 74  RERDYYICNICKCRPENNRNPKEDEIKACIPYLRNQFALVQPRIIVCLGAIATNQII-SD 132

Query: 206 AQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
             +  ++ GKW             AT HP  +++    K+  +  L  +KKA ++L
Sbjct: 133 QWRITRDRGKW----IKRKGCFITATFHPAAVLRDEGKKQYIFRDLQEVKKAYESL 184


>gi|159900927|ref|YP_001547174.1| phage SPO1 DNA polymerase-related protein [Herpetosiphon
           aurantiacus ATCC 23779]
 gi|159893966|gb|ABX07046.1| phage SPO1 DNA polymerase-related protein [Herpetosiphon
           aurantiacus ATCC 23779]
          Length = 220

 Score = 77.4 bits (189), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 61/113 (53%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C LC T  + +        ++++IG  P   ++  G+PF G +G++L++ L  I + R Q
Sbjct: 21  CPLCRTRTNAVPGEGPANAEILLIGEGPGQREDALGRPFVGPSGDLLEQWLAEIGLTREQ 80

Query: 150 IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFF 202
           + I+ +    PPGNR+    E+  C   + RQI  ++PK++  +G  + N FF
Sbjct: 81  VFIANVVKCRPPGNRDPEPSEIAACAHFLDRQIAALAPKLIATLGRHSMNKFF 133


>gi|212224669|ref|YP_002307905.1| Uracil-DNA glycosylase [Thermococcus onnurineus NA1]
 gi|212009626|gb|ACJ17008.1| Uracil-DNA glycosylase [Thermococcus onnurineus NA1]
          Length = 195

 Score = 77.4 bits (189), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 85/173 (49%), Gaps = 3/173 (1%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           +++L+  ++S   C L     + +  + +    +M +G  P   ++  G PF G+ G +L
Sbjct: 7   MNKLEEKIKSCRKCPLGELRTNAVPGSGSYNAKVMFVGEAPGYWEDQKGLPFVGRAGKVL 66

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
           D++L  I + R +++I+ I    PP NR+ +  E++ C P + RQI++I PK+++ +G  
Sbjct: 67  DELLAEIGLDRDEVYITNIVKCRPPDNRDPTEDEIKACSPYLDRQIDIIRPKVIVPLGRH 126

Query: 197 TKNFF---FNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKN 246
           +  +    F  + +   +  GK     T    I  +   HP   +  P +K+ 
Sbjct: 127 SMRYILEKFGFEVEPISKIHGKAFEAHTLFGKIVIMPMYHPAVALYRPALKEE 179


>gi|282901222|ref|ZP_06309151.1| Phage SPO1 DNA polymerase-related protein [Cylindrospermopsis
           raciborskii CS-505]
 gi|281193922|gb|EFA68890.1| Phage SPO1 DNA polymerase-related protein [Cylindrospermopsis
           raciborskii CS-505]
          Length = 223

 Score = 77.0 bits (188), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 51/171 (29%), Positives = 78/171 (45%), Gaps = 14/171 (8%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +++EL     + H C L       +         +MIIG  P   ++ +G PF GK+G +
Sbjct: 34  NVNELALQCENCHRCGLGKNRTHAVVGRGNPQAKIMIIGEAPGQHEDETGLPFVGKSGQL 93

Query: 136 LDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           LDK+L S+ +   Q ++I  I    PP NR  ++ E+  CRP ++ QI LI PKI+L  G
Sbjct: 94  LDKILASVNLTTEQDVYICNIVKCRPPENRVPTSEEINACRPYLLEQIRLIDPKIILLTG 153

Query: 195 NKTKNFFFNNDAQKTYQNLGKW----SNLCTPHSIIPTLATVHPQELIQYP 241
                    +    T +  G+W      LC P          HP  L++ P
Sbjct: 154 ATAVKGVTGSKLPIT-KIRGQWLEWEGRLCMP--------IFHPSYLLRNP 195


>gi|295106610|emb|CBL04153.1| uracil-DNA glycosylase, family 4 [Gordonibacter pamelaeae 7-10-1-b]
          Length = 226

 Score = 77.0 bits (188), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 69/145 (47%), Gaps = 5/145 (3%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L ++++ + +   C L      T+         ++I+G  P  ++++ G+PF GK G  L
Sbjct: 8   LEDIRAQVEACRKCPLADGRTQTVFGVGNPSARVLIVGEAPGKNEDLQGEPFVGKAGQYL 67

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
           +++L    + R  + I+ +    PPGNR+    E+E+C P +  Q   I P+ ++ +GN 
Sbjct: 68  NELLAIAGLAREHVFIANVLKCRPPGNRDPRPEEIELCTPYLREQTRTIDPEFIVTLGNF 127

Query: 197 TKNFFFNND-----AQKTYQNLGKW 216
           +  F    +        T Q  GK+
Sbjct: 128 STKFILKTEIGITRLHGTLQRAGKF 152


>gi|258517054|ref|YP_003193276.1| phage SPO1 DNA polymerase-related protein [Desulfotomaculum
           acetoxidans DSM 771]
 gi|257780759|gb|ACV64653.1| phage SPO1 DNA polymerase-related protein [Desulfotomaculum
           acetoxidans DSM 771]
          Length = 191

 Score = 77.0 bits (188), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 50/191 (26%), Positives = 78/191 (40%), Gaps = 18/191 (9%)

Query: 78  HELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLD 137
           ++LK        C L     + +      G  +M IG  P   ++  G+PF G+ G +LD
Sbjct: 9   NDLKEKCLQCTGCALSEKRTNVVFGEGYIGAGIMFIGEGPGQQEDEQGRPFVGRAGVLLD 68

Query: 138 KMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
           KML +I + R T   I  +    PPGNR     E   C P +  Q+ +I P+I++ +G  
Sbjct: 69  KMLDAIGLSRHTNAMICNVVKCRPPGNRVPDRQEAAACLPFLRAQVAIIKPRIIVCLGAT 128

Query: 197 TKNFFFNNDAQKT------YQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHA 250
                 +  +  T      Y+  G W            +AT HP  L++ P  K   W  
Sbjct: 129 AVKHVLDTVSGITQIRGQWYEKKGYW-----------MIATFHPAALLRDPAKKVLVWED 177

Query: 251 LITLKKALKNL 261
           L  ++     L
Sbjct: 178 LKAIRAKYDEL 188


>gi|302877854|ref|YP_003846418.1| phage SPO1 DNA polymerase-related protein [Gallionella
           capsiferriformans ES-2]
 gi|302580643|gb|ADL54654.1| phage SPO1 DNA polymerase-related protein [Gallionella
           capsiferriformans ES-2]
          Length = 324

 Score = 77.0 bits (188), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 80/173 (46%), Gaps = 5/173 (2%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           EL+  ++   +C L +     +  T       + +G  P   ++   +PF G +G +LD 
Sbjct: 145 ELQQKVQGCTECKLRAECTQPVFGTGDPHARWLFVGEAPGAEEDELCEPFVGASGRLLDN 204

Query: 139 MLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTK 198
           ML +I + R++++++ +    P  +R+    E+  C P + RQI L+ P +++ +G    
Sbjct: 205 MLLAIGLQRSEVYLANVIKCRPLDDRHPHVGEIAACLPYLKRQIGLLQPAVIVALGKTAA 264

Query: 199 NFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
           +   + DA      +     +   +  IP + T HP  L++ PL K   W  L
Sbjct: 265 SALLDTDA-----TIASLRGIVHDYKGIPLVVTYHPAYLLRSPLEKARAWQDL 312


>gi|182415860|ref|YP_001820926.1| phage SPO1 DNA polymerase-related protein [Opitutus terrae PB90-1]
 gi|177843074|gb|ACB77326.1| phage SPO1 DNA polymerase-related protein [Opitutus terrae PB90-1]
          Length = 202

 Score = 77.0 bits (188), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/195 (23%), Positives = 91/195 (46%), Gaps = 13/195 (6%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L ++++  R    C L  T   T+      G  ++++G  P D ++I+G+PF G  G +
Sbjct: 8   TLEKVRAQARDCTRCPLYKTGTQTVFGEGRVGARMLMVGEQPGDQEDIAGRPFVGPAGQL 67

Query: 136 LDKMLQSIEIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELISPK 188
           L++ L+   I R ++ ++       W   G R L    +  E+  CRP +  ++EL+ P 
Sbjct: 68  LNRALEEAGIDRDEVFVTNAVKHFKWVRAGKRRLHKKPNAAEINACRPWLEAELELVQPD 127

Query: 189 ILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTW 248
           +++ +G            + T Q+    +  C        LAT+HP  +++ P   ++  
Sbjct: 128 LIVALGATAAQTLMGRQFRVTQQHGQVLAAPCAKG----FLATIHPSAVLRTPPPDRDAA 183

Query: 249 HALIT--LKKALKNL 261
           +A +   LK A++ L
Sbjct: 184 YAGLVSDLKAAVRFL 198


>gi|162450005|ref|YP_001612372.1| putative DNA polymerase related protein [Sorangium cellulosum 'So
           ce 56']
 gi|161160587|emb|CAN91892.1| putative DNA polymerase related protein [Sorangium cellulosum 'So
           ce 56']
          Length = 220

 Score = 77.0 bits (188), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 76/173 (43%), Gaps = 11/173 (6%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           SL  L+        C L      T+        D++++G  P D ++++GKPF G  G +
Sbjct: 28  SLPSLREAAARCRACPLWERGTQTVFGEGAARSDVLLVGEQPGDKEDLAGKPFVGPAGQL 87

Query: 136 LDKMLQSIEIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELISPK 188
           LD+ L++  I R + +++ +     W P G R +       E+  C P +  +I ++ P 
Sbjct: 88  LDRALEAAGIERRRAYVTNVVKHFKWEPRGKRRIHMKPDAREIRACLPWLAAEIAVVQPA 147

Query: 189 ILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
           I++ +G            + T +     ++   P      LATVHP  +++ P
Sbjct: 148 IVVCLGATAAQALLGGSFRVTRERGRIVASPLAPR----VLATVHPASILRAP 196


>gi|288931880|ref|YP_003435940.1| phage SPO1 DNA polymerase-related protein [Ferroglobus placidus DSM
           10642]
 gi|288894128|gb|ADC65665.1| phage SPO1 DNA polymerase-related protein [Ferroglobus placidus DSM
           10642]
          Length = 198

 Score = 77.0 bits (188), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 78/173 (45%), Gaps = 3/173 (1%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L E+   ++    C L  T  + +     E   ++ +G  P   +++ G+PF G  G  
Sbjct: 2   TLEEIHEEIKKCRKCELYKTKTNYVPGEGNEKAKIVFVGEAPGREEDLQGRPFVGAAGQY 61

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           L K L+   I R+++ I+ I    PP NR+    E+E C P +++Q+  I P +++ +G 
Sbjct: 62  LTKTLEKCGIKRSEVFITNILKCRPPNNRDPKPEEVEKCFPYLVKQLHEIKPDVIVCLGR 121

Query: 196 KTKNF---FFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKK 245
            +      FF    +    + GK          +  + T HP  ++  P +K+
Sbjct: 122 HSAREILNFFGKKFKGISADRGKIFEAELDGKKVKIIPTYHPAAVLYKPQLKE 174


>gi|298492683|ref|YP_003722860.1| phage SPO1 DNA polymerase-like protein ['Nostoc azollae' 0708]
 gi|298234601|gb|ADI65737.1| phage SPO1 DNA polymerase-related protein ['Nostoc azollae' 0708]
          Length = 226

 Score = 76.6 bits (187), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 51/176 (28%), Positives = 81/176 (46%), Gaps = 17/176 (9%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEGQ---DLMIIGYTPSDSDNISGKPFSGKTGNML 136
           +  L +  ++C  C    +   A    G     +MIIG  P  S++ +G PF GK+G +L
Sbjct: 37  MPELAQHCNNCRRCGLGDNRTHAVVGRGNLQAKIMIIGEAPGQSEDETGLPFVGKSGQLL 96

Query: 137 DKMLQSIEI-MRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           +K+L S+ +     ++I  I+   PP NR  +  EM  C+P ++ QI L+ PKI+L  G 
Sbjct: 97  EKILASVNLSTEEDVYIGNINKCRPPENRVPTAEEMAACKPYLLEQIRLVDPKIILLTG- 155

Query: 196 KTKNFFFNNDAQKTYQNLGKW----SNLCTPHSIIPTLATVHPQELIQYPLIKKNT 247
            T         Q   +  G+W      LC P          HP  L++ P  +K +
Sbjct: 156 ATAVKGITGSKQGITKIRGQWLESEGRLCMP--------IFHPSYLLRNPSREKGS 203


>gi|226939479|ref|YP_002794552.1| DNA-directed DNA polymerase, bacteriophage-type [Laribacter
           hongkongensis HLHK9]
 gi|226714405|gb|ACO73543.1| Probable DNA-directed DNA polymerase, bacteriophage-type
           [Laribacter hongkongensis HLHK9]
          Length = 259

 Score = 76.6 bits (187), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 72/165 (43%), Gaps = 6/165 (3%)

Query: 88  HDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR 147
             C LC T   T+         LM+IG  P + +++ G+PF G  G +LD ML +     
Sbjct: 82  RSCRLCETRTRTVLERGNRQAPLMLIGEGPGEQEDLQGRPFVGPAGKLLDAMLTATGWSP 141

Query: 148 TQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDA 206
            Q +++  +    PPGNRN    EM  C+  +  QI L+ P++++ +G            
Sbjct: 142 EQDMYVCNVVKCRPPGNRNPQPDEMAACQAYLQTQIRLVRPRLIVALGRVAAQSLL---- 197

Query: 207 QKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
             T  ++ +       ++  P + T HP  L++    K   W  L
Sbjct: 198 -ATELSVARLRGQTHQYAGYPLVVTYHPAYLLRNLPDKARAWQDL 241


>gi|108803352|ref|YP_643289.1| phage SPO1 DNA polymerase-like protein [Rubrobacter xylanophilus
           DSM 9941]
 gi|108764595|gb|ABG03477.1| phage SPO1 DNA polymerase-related protein [Rubrobacter xylanophilus
           DSM 9941]
          Length = 216

 Score = 76.6 bits (187), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 82/182 (45%), Gaps = 15/182 (8%)

Query: 68  DSIAQKACSLHELKSLLRSFHDCHLCSTSLS---TICATQTEGQDLMIIGYTPSDSDNIS 124
           D++         L  L R    C  C  S S   T+  T      LM++G  P ++++ +
Sbjct: 6   DAVEGGENREERLAELARQVSVCTRCDLSRSRTNTVFGTGDPYSPLMLVGEGPGENEDAT 65

Query: 125 GKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPP-------GNRNLSNIEMEICRPI 177
           G PF G+ G +LD +L ++ + R Q++I+ I              NR     E+  C P 
Sbjct: 66  GLPFVGRAGKLLDNILAAVNLSREQVYITNIVKCRAAVEENGRLRNRQPRAAEINACNPY 125

Query: 178 IMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQEL 237
           +  QIE + P+I+L +G        + D + T ++ G+W  +      I  +AT HP  +
Sbjct: 126 LQAQIEAVRPEIILCLGGPAAKTIIDRDFRIT-RDRGRWYEV----GGIRAMATFHPAYI 180

Query: 238 IQ 239
           ++
Sbjct: 181 LR 182


>gi|313903540|ref|ZP_07836930.1| phage SPO1 DNA polymerase-related protein [Thermaerobacter
           subterraneus DSM 13965]
 gi|313466093|gb|EFR61617.1| phage SPO1 DNA polymerase-related protein [Thermaerobacter
           subterraneus DSM 13965]
          Length = 307

 Score = 76.6 bits (187), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 82/177 (46%), Gaps = 9/177 (5%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQD---LMIIGYTPSDSDNISGKPFSGKTG 133
           +H++ +L +    C  C            +G     LM+IG  P   ++  G+PF G+ G
Sbjct: 11  IHDMATLEQVVKGCTACGLRAGCRGVVFGDGNPSARLMLIGEGPGADEDRLGRPFVGRAG 70

Query: 134 NMLDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLF 192
            +LD++L +    R + ++I+ I    PPGNR  +  E   C P +  Q+ L+ P I++ 
Sbjct: 71  QLLDRILAACGFDRQRHVYIANIVKCRPPGNRTPTPEERAACLPNLRAQMWLVQPVIVVL 130

Query: 193 IGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWH 249
           +G+        + A +  +  G+W         +  + T HP  L++ P +K+  WH
Sbjct: 131 LGSTALQALV-DPAARISRARGQW----IVRDGVWYMPTYHPAALLRNPALKRECWH 182


>gi|139439476|ref|ZP_01772908.1| Hypothetical protein COLAER_01933 [Collinsella aerofaciens ATCC
           25986]
 gi|133775029|gb|EBA38849.1| Hypothetical protein COLAER_01933 [Collinsella aerofaciens ATCC
           25986]
          Length = 206

 Score = 76.6 bits (187), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 47/176 (26%), Positives = 83/176 (47%), Gaps = 10/176 (5%)

Query: 71  AQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSG 130
           A +  +L E++++L   H C L  +  + +         +M IG  P  ++++ G+PF G
Sbjct: 13  APREVALEEIEAVLGDCHLCQLYQSRHNIVFGVGNPRARVMFIGEAPGRNEDLQGEPFVG 72

Query: 131 KTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKIL 190
             G  L+ +L    + R  ++I+ +    PPGNRN    E+  C P +  QI  I P I+
Sbjct: 73  AAGEDLNGILSLAGLKREDVYIANVLKCRPPGNRNPRPEEVLACSPFLREQIRSIWPDII 132

Query: 191 LFIGNKTKNFFFNNDAQKT-----YQNLGKWSNLCTPHSIIPTLATVHP--QELIQ 239
           + +GN   +F    +   T     +  +G +  + T H   P  A  +P  QEL++
Sbjct: 133 VTLGNPATHFVLKTEIGITKLRGRFHQMGHFVVMPTFH---PAAALRNPAWQELLE 185


>gi|37521977|ref|NP_925354.1| DNA polymerase related protein [Gloeobacter violaceus PCC 7421]
 gi|35212976|dbj|BAC90349.1| glr2408 [Gloeobacter violaceus PCC 7421]
          Length = 229

 Score = 76.3 bits (186), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 70/142 (49%), Gaps = 2/142 (1%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
              ++++   +   C L  T    +         LM+IG  P ++++++G PF GK G +
Sbjct: 39  DFEQIRTHCNACFRCELGKTRTHAVVGRGNPQALLMVIGEGPGENEDLTGIPFVGKAGQL 98

Query: 136 LDKMLQSIEI-MRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           LDK+L++++      ++++ I    PPGNR  +  EM+ C   +  QI +I PKILL  G
Sbjct: 99  LDKILEAVQFDTEKDVYVANIVKCRPPGNRKPAPEEMKACLGYLNEQIRMIDPKILLLAG 158

Query: 195 NKTKNFFFNNDAQKTYQNLGKW 216
             T       D +   +  G+W
Sbjct: 159 G-TAVEGLTGDKRGITKLRGQW 179


>gi|240103871|ref|YP_002960180.1| Uracil-DNA glycosylase [Thermococcus gammatolerans EJ3]
 gi|239911425|gb|ACS34316.1| Uracil-DNA glycosylase [Thermococcus gammatolerans EJ3]
          Length = 196

 Score = 76.3 bits (186), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 87/188 (46%), Gaps = 3/188 (1%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           + +L+  +R+   C L     + +  + +    +M +G  P   ++  G PF G+ G +L
Sbjct: 9   MRKLEEKIRNCRKCPLGQLRTNAVPGSGSYDAKVMFVGEAPGYWEDQKGLPFVGRAGKVL 68

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
           D++L+ I + R  ++I+ I    PP NR+ +  E+  C P +  QI++I PK+++ +G  
Sbjct: 69  DELLEGIGLSRDDVYITNIVKCRPPENRDPTEEEIRACSPYLDMQIDIIRPKVIVPLGRH 128

Query: 197 TKNFF---FNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALIT 253
           +  +    F  + +   +  GK     T    I  +   HP   +  P +++        
Sbjct: 129 SMGYLLRKFGFEPEPISKIHGKVFRANTLFGRIIIMPMYHPAAALYKPPLREELRKDFEK 188

Query: 254 LKKALKNL 261
           L+K L  L
Sbjct: 189 LRKILNEL 196


>gi|257386782|ref|YP_003176555.1| phage SPO1 DNA polymerase-related protein [Halomicrobium mukohataei
           DSM 12286]
 gi|257169089|gb|ACV46848.1| phage SPO1 DNA polymerase-related protein [Halomicrobium mukohataei
           DSM 12286]
          Length = 195

 Score = 76.3 bits (186), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 61/127 (48%), Gaps = 4/127 (3%)

Query: 89  DCHLCSTSLST----ICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIE 144
           DC  C   + +    +  T     DL+ +G  P   ++  G+PF G++G++LD  L+   
Sbjct: 11  DCERCGDLVDSRSRIVDGTGPPEADLLFVGEAPGAQEDADGEPFVGRSGDVLDDALREAG 70

Query: 145 IMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNN 204
           + R  + I+      PP NR+    E+  CRP + R+IEL+ P++++ +G          
Sbjct: 71  LDRGDVRITNCVRCRPPDNRDPRQAELANCRPYLEREIELVDPELIVTLGKVPAEHLLER 130

Query: 205 DAQKTYQ 211
           D   T +
Sbjct: 131 DVAVTSE 137


>gi|270307805|ref|YP_003329863.1| uracil DNA glycosylase superfamily, DNA polymerase
           bacteriophage-type [Dehalococcoides sp. VS]
 gi|270153697|gb|ACZ61535.1| uracil DNA glycosylase superfamily, DNA polymerase
           bacteriophage-type [Dehalococcoides sp. VS]
          Length = 206

 Score = 76.3 bits (186), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 68/135 (50%), Gaps = 7/135 (5%)

Query: 77  LHELKSLLRSFHD-------CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFS 129
           +H+ + LL+  +        C L +T   ++         +M IG  P  +++  G+PF 
Sbjct: 1   MHDKEELLKGVYSEITRCVRCKLHTTRTRSVPGEGNADAKIMFIGEAPGFNEDQQGRPFV 60

Query: 130 GKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKI 189
           G  G  L +++ SI + R  ++I+ +    PPGNR+    E+  CR  + RQIE+I PKI
Sbjct: 61  GAAGKFLTELIHSIGLTREDVYITNVVKDRPPGNRDPLPDEISACRNFLDRQIEIIKPKI 120

Query: 190 LLFIGNKTKNFFFNN 204
           ++ +G  +   +F  
Sbjct: 121 IVTLGRYSMARYFTG 135


>gi|119486055|ref|ZP_01620117.1| Phage SPO1 DNA polymerase-related protein [Lyngbya sp. PCC 8106]
 gi|119456830|gb|EAW37958.1| Phage SPO1 DNA polymerase-related protein [Lyngbya sp. PCC 8106]
          Length = 243

 Score = 76.3 bits (186), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 85/188 (45%), Gaps = 16/188 (8%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L E+       H C L +     +         +MIIG  P  +++  G PF G++G +
Sbjct: 44  NLDEIADHCNQCHRCVLGNNRTHAVIGRGNLQAAIMIIGEAPGKNEDEQGLPFVGRSGQL 103

Query: 136 LDKMLQSIEI-MRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           LDK+L+S+ +    +++IS      PP NR  +  E+E C+P ++ QI L+ P+I+L  G
Sbjct: 104 LDKILESVGLSTEREVYISNAIRCRPPENRTPTAAEIEACKPYLLEQIRLVDPQIILLTG 163

Query: 195 NKTKNFFFNNDAQKTYQNLGKW----SNLCTPHSIIPTLATVHPQELIQYPLIK--KNTW 248
                     + Q   +  G+W      LC P          HP  L++ P ++  K  W
Sbjct: 164 ATAVKSLL-AEKQGITKIRGEWRQWEGRLCMP--------IFHPAYLLRNPSLEPGKPKW 214

Query: 249 HALITLKK 256
                +KK
Sbjct: 215 LMWEDIKK 222


>gi|15606784|ref|NP_214164.1| N-terminus of phage SPO1 DNA polymerase [Aquifex aeolicus VF5]
 gi|2984015|gb|AAC07559.1| N-terminus of phage SPO1 DNA polymerase [Aquifex aeolicus VF5]
          Length = 195

 Score = 76.3 bits (186), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 64/119 (53%), Gaps = 4/119 (3%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEGQD---LMIIGYTPSDSDNISGKPFSGKTGNML 136
           LK+L   + DC  C    S       +G     L+ +G  P + ++  GKPF G+ G +L
Sbjct: 12  LKNLYEEWKDCTRCDLHKSRTRVVPGDGNPYSLLVFVGEAPGEEEDRQGKPFVGRAGQLL 71

Query: 137 DKMLQSIEIM-RTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           +++++ +  M R  ++I+ +    PP NR  + IEM  C P + ++IE+I PK++  +G
Sbjct: 72  NRLIEEVLGMKREDVYITNVCKCRPPQNRKPTPIEMRACFPYLKKEIEIIQPKVICCLG 130


>gi|148927323|ref|ZP_01810888.1| phage SPO1 DNA polymerase-related protein [candidate division TM7
           genomosp. GTL1]
 gi|147887279|gb|EDK72738.1| phage SPO1 DNA polymerase-related protein [candidate division TM7
           genomosp. GTL1]
          Length = 207

 Score = 76.3 bits (186), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 70/135 (51%), Gaps = 1/135 (0%)

Query: 69  SIAQKACSLHELKSLLRSFHDC-HLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKP 127
           S++ K   L ++++ + + + C HL  T+ + +         ++ IG  P   ++  G P
Sbjct: 11  SLSDKRALLDQIRTDILAANVCPHLAKTATNLVMGDGNLDAKIVFIGEAPGKKEDEQGLP 70

Query: 128 FSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISP 187
           F G  G  LD+ML S  + R  ++I+ I  + PP NR+ S  E     P + RQ+++I P
Sbjct: 71  FVGAAGRFLDEMLASANLKREDVYITNIVKYRPPNNRDPSPEEKRAFWPYVARQLKVIGP 130

Query: 188 KILLFIGNKTKNFFF 202
           ++++ +G  +  FF 
Sbjct: 131 EVIVTLGRHSMEFFL 145


>gi|302036861|ref|YP_003797183.1| uracil-DNA glycosylase [Candidatus Nitrospira defluvii]
 gi|190343276|gb|ACE75664.1| uracil-DNA glycosylase family 4 [Candidatus Nitrospira defluvii]
 gi|300604925|emb|CBK41258.1| Uracil-DNA glycosylase [Candidatus Nitrospira defluvii]
          Length = 223

 Score = 76.3 bits (186), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 62/120 (51%), Gaps = 4/120 (3%)

Query: 80  LKSLLRSFHDCHLCSTSL----STICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           L+ L  S H+C  C  +       +         +M +G  P   ++  G+PF G  G +
Sbjct: 8   LQELAESLHNCQRCPLAKLGRHQVVFGVGNPHASVMFVGEAPGFHEDQKGEPFVGAAGQL 67

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           L+ +L+S  + R  I+I+ +    PP NR+    E+E C+P +++QI +I PK++  +GN
Sbjct: 68  LNDLLESAGLSRADIYIANVIKCRPPNNRDPEPQEVETCKPFLLQQIAMIRPKLVCSLGN 127


>gi|269216098|ref|ZP_06159952.1| uracil-DNA glycosylase, family 4 [Slackia exigua ATCC 700122]
 gi|269130357|gb|EEZ61435.1| uracil-DNA glycosylase, family 4 [Slackia exigua ATCC 700122]
          Length = 211

 Score = 76.3 bits (186), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 80/185 (43%), Gaps = 7/185 (3%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L E+   + +   C L     + +         +M++G  P  ++++ GKPF G  G  L
Sbjct: 23  LEEISDAVWACRRCELAEGRTNAVPGFGNASARIMLVGEAPGRNEDLQGKPFVGAAGKYL 82

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
            ++L    + R ++ I+ +    PP NRN    E+E+C P +  Q+  I P+ L+ +GN 
Sbjct: 83  TELLGYAGLTREEVFIANVLKCRPPSNRNPRPEEIEVCTPFLRDQVRTIEPEYLVTMGNF 142

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHA-LITLK 255
           +  F      ++    L    ++  P  + P     HP   I Y   K++   A    L 
Sbjct: 143 STKFVLRT--ERGITGLRGSVHVTGPFKVFPVF---HPAAAI-YDRSKRDVLEADFRALG 196

Query: 256 KALKN 260
           + L N
Sbjct: 197 RLLGN 201


>gi|116621468|ref|YP_823624.1| phage SPO1 DNA polymerase-like protein [Candidatus Solibacter
           usitatus Ellin6076]
 gi|116224630|gb|ABJ83339.1| phage SPO1 DNA polymerase-related protein [Candidatus Solibacter
           usitatus Ellin6076]
          Length = 244

 Score = 75.9 bits (185), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 79/188 (42%), Gaps = 15/188 (7%)

Query: 80  LKSLLRSFHDCHLCSTSLST---ICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L  +++   DCH C    +    +     E   L+ +G  P   ++  G PF G+ G +L
Sbjct: 58  LLKIIQDIGDCHRCKLGDARNKIVFGVGDEKAQLVFVGEGPGADEDEQGIPFVGRAGQLL 117

Query: 137 DKMLQ------SIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKIL 190
            +M++       I + R  ++I  +    PPGNR     EMEIC   + RQ+  I PK +
Sbjct: 118 TQMIENTSKKEGIPLKRGDVYICNVVKCRPPGNRTPEPEEMEICGEFLYRQLSTIRPKAI 177

Query: 191 LFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHA 250
             +G  T         +   +  GKW         IP + T HP  L++ P  +     A
Sbjct: 178 CALGG-TAARAVTGHKEGVTKMRGKWFKW----QDIPVMVTYHPSYLLR-PFNENAKREA 231

Query: 251 LITLKKAL 258
              LKK L
Sbjct: 232 WEDLKKVL 239


>gi|284047489|ref|YP_003397828.1| phage SPO1 DNA polymerase-related protein [Acidaminococcus
           fermentans DSM 20731]
 gi|283951710|gb|ADB46513.1| phage SPO1 DNA polymerase-related protein [Acidaminococcus
           fermentans DSM 20731]
          Length = 215

 Score = 75.9 bits (185), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 80/169 (47%), Gaps = 5/169 (2%)

Query: 72  QKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGK 131
           + A +  ELK  L     C L     + +         LMI+G  P   ++  G P  G 
Sbjct: 2   EPAKTFDELKKQLEDCAACPLRKDCQAPVGWFGNLESPLMIVGEGPGGVEDDYGCPLIGP 61

Query: 132 TGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQ-IELISPKIL 190
           +G +LDK L S+ I R +I+ + +    P GNR  +  E   C  + + Q I L+ PK++
Sbjct: 62  SGQLLDKALWSVRITRDRIYTTNVIKCRPRGNRTPTVEEGSFCARLWLEQEIRLLRPKVI 121

Query: 191 LFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ 239
           L +G+    +F   +A+ T +  G+W    T    IP LAT HP  L++
Sbjct: 122 LALGSVALRYFKGPEARITRER-GQWF---TTGEGIPCLATFHPSYLLR 166


>gi|225575388|ref|ZP_03783998.1| hypothetical protein RUMHYD_03478 [Blautia hydrogenotrophica DSM
           10507]
 gi|225037333|gb|EEG47579.1| hypothetical protein RUMHYD_03478 [Blautia hydrogenotrophica DSM
           10507]
          Length = 158

 Score = 75.9 bits (185), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 75/152 (49%), Gaps = 5/152 (3%)

Query: 110 LMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNI 169
           +M+I   P   ++  G PF G++G +LD++L+S+ + R +I+I+ I+  HPPGNR+    
Sbjct: 10  IMLIAEAPGRMEDEKGIPFVGRSGEILDELLKSVSLSRDEIYITNINKCHPPGNRDPEEA 69

Query: 170 EMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTL 229
           E + C P +  +  LI PKI++ +G            + + ++ G W             
Sbjct: 70  EQQACMPFLKYETALIRPKIMVCLGRIAARKVIATGFRISREH-GTW----IERKGFFLT 124

Query: 230 ATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
           A  HP  L++ P   + T      +K+ L+ L
Sbjct: 125 AVYHPSALLRDPSKVEETRRDFQEIKRKLEEL 156


>gi|308751050|gb|ADO44533.1| phage SPO1 DNA polymerase-related protein [Hydrogenobacter
           thermophilus TK-6]
          Length = 219

 Score = 75.9 bits (185), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 64/131 (48%)

Query: 65  QQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNIS 124
           ++  S   K   LHEL   L     C L   S   +         ++ +G  P + ++  
Sbjct: 24  KEQKSKPDKRRMLHELYETLSKEKKCILYEGSSGYVFGDGNPDSAVVFVGEAPGEEEDKQ 83

Query: 125 GKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIEL 184
            KPF GK G  L+  LQ + + R  ++I+ +    PPGNR  +  EM  C P + ++IE+
Sbjct: 84  KKPFVGKAGKYLNAKLQEVGMRREDVYITNVVKSRPPGNRKPTKEEMLSCLPYLRKEIEI 143

Query: 185 ISPKILLFIGN 195
           I PK+++ +G+
Sbjct: 144 IKPKLIVCLGS 154


>gi|305662671|ref|YP_003858959.1| phage SPO1 DNA polymerase-related protein [Ignisphaera aggregans
           DSM 17230]
 gi|304377240|gb|ADM27079.1| phage SPO1 DNA polymerase-related protein [Ignisphaera aggregans
           DSM 17230]
          Length = 214

 Score = 75.5 bits (184), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 46/172 (26%), Positives = 83/172 (48%), Gaps = 3/172 (1%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           S  EL++ +R+   C L     + +     +   +M IG  P  +++  G+PF G  G +
Sbjct: 6   SWQELENAIRNCTRCQLYRNRKNAVPGEGPKDAFVMFIGEAPGATEDEMGRPFVGAAGKL 65

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           L  +++++ I R  ++I+ +    PP NR  S+ E+E C   +  QI LI PKI++ +GN
Sbjct: 66  LTMIMENLGISRDSVYITNVVKCRPPNNREPSDEEIEKCGIYLETQIRLIKPKIIVTLGN 125

Query: 196 ---KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIK 244
              KT  F      +   +  G+  N+      +  + T+HP   +  P +K
Sbjct: 126 IAGKTIFFMGKERWEGIMKMRGRVYNMKIFDLTVYVIPTIHPAAGLYNPNLK 177


>gi|292492113|ref|YP_003527552.1| phage SPO1 DNA polymerase-related protein [Nitrosococcus halophilus
           Nc4]
 gi|291580708|gb|ADE15165.1| phage SPO1 DNA polymerase-related protein [Nitrosococcus halophilus
           Nc4]
          Length = 194

 Score = 75.5 bits (184), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 59/200 (29%), Positives = 98/200 (49%), Gaps = 10/200 (5%)

Query: 59  IHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPS 118
           + +PL +Q + +A    +L+ELK L   +    + S     +    +   ++MIIG  P 
Sbjct: 1   MQTPLDEQLEKVA----TLNELKQLCEHYLGSEV-SKGEKFVFGEGSPQAEVMIIGEAPG 55

Query: 119 DSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPII 178
             +  +G+PF G  G +L+ +L  I + R QI+IS I   HP GNR     E++   P +
Sbjct: 56  VQEAKTGRPFVGNAGKLLNTLLNQIGLEREQIYISNILKTHPSGNRKPYRGEIKKELPFL 115

Query: 179 MRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELI 238
           +RQIEL+ PK+L+ +G       ++  A+ T +  G W  +      +PT  T HP   +
Sbjct: 116 LRQIELLRPKLLVLLGATALQALYDPKAKIT-ELRGNWIEVKN----LPTFVTYHPAAAL 170

Query: 239 QYPLIKKNTWHALITLKKAL 258
           +    KK   H    L++ L
Sbjct: 171 RDETKKKTLEHDFSKLQERL 190


>gi|329902871|ref|ZP_08273281.1| putative DNA polymerase-like protein, bacteriophage-type protein
           [Oxalobacteraceae bacterium IMCC9480]
 gi|327548581|gb|EGF33241.1| putative DNA polymerase-like protein, bacteriophage-type protein
           [Oxalobacteraceae bacterium IMCC9480]
          Length = 289

 Score = 75.5 bits (184), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 82/187 (43%), Gaps = 8/187 (4%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           S  EL+  + S   C LC      +     +    + +G  P   ++  G+PF G  G +
Sbjct: 97  SWQELELAVASCTRCALCKNRKQAVLGAGDQKPGWLFVGEGPGHVEDQQGEPFVGPAGKL 156

Query: 136 LDKMLQSIEIMRTQ-IHISMISPWHPPG----NRNLSNIEMEICRPIIMRQIELISPKIL 190
           LD ML ++++ R +  +++      P G    +R  S  E   CRP + RQI L+ P ++
Sbjct: 157 LDNMLLALDLPRGENNYLANAVKCRPVGADGKDRPPSADESAACRPYLERQIALLQPAVI 216

Query: 191 LFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHA 250
           + +G          D +     L + ++    +  IP + T HP  L++ PL K  +W  
Sbjct: 217 VALGKVAALSLLGGDPKIAVAALREHTHR---YGSIPVVVTYHPAYLLRKPLDKAKSWRD 273

Query: 251 LITLKKA 257
           L    +A
Sbjct: 274 LCLAAQA 280


>gi|160945470|ref|ZP_02092696.1| hypothetical protein FAEPRAM212_02996 [Faecalibacterium prausnitzii
           M21/2]
 gi|158443201|gb|EDP20206.1| hypothetical protein FAEPRAM212_02996 [Faecalibacterium prausnitzii
           M21/2]
          Length = 193

 Score = 75.5 bits (184), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 82/180 (45%), Gaps = 6/180 (3%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKM 139
           LK+   +   C LC+T  + +        +++ +G  P  S++  G PF G++G +LDK 
Sbjct: 9   LKAECLACTRCELCATRTNVVFGQGVPDAEVLFVGEGPGQSEDEQGLPFVGRSGQLLDKY 68

Query: 140 LQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTK 198
           L +I++ R +  +I+ I    PP NR+    E E C P +  Q  L+ PKI++ +G    
Sbjct: 69  LFAIDLDRKKNCYIANIVKCRPPQNRDPLPAESEACMPWLREQFRLLHPKIVVCLGRVAA 128

Query: 199 NFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
                 D   T ++      +     I+  + T HP  L++ P  K   +     L+  +
Sbjct: 129 QRMIRQDFSVTREH----GQIIEKGGIL-FMGTFHPAALLRQPQNKPEAFADFTVLRDTI 183


>gi|288817443|ref|YP_003431790.1| phage SPO1 DNA polymerase-related protein [Hydrogenobacter
           thermophilus TK-6]
 gi|288786842|dbj|BAI68589.1| phage SPO1 DNA polymerase-related protein [Hydrogenobacter
           thermophilus TK-6]
          Length = 185

 Score = 75.5 bits (184), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 60/119 (50%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           LHEL   L     C L   S   +         ++ +G  P + ++   KPF GK G  L
Sbjct: 2   LHELYETLSKEKKCILYEGSSGYVFGDGNPDSAVVFVGEAPGEEEDKQKKPFVGKAGKYL 61

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           +  LQ + + R  ++I+ +    PPGNR  +  EM  C P + ++IE+I PK+++ +G+
Sbjct: 62  NAKLQEVGMRREDVYITNVVKSRPPGNRKPTKEEMLSCLPYLRKEIEIIKPKLIVCLGS 120


>gi|295105370|emb|CBL02914.1| uracil-DNA glycosylase, family 4 [Faecalibacterium prausnitzii
           SL3/3]
          Length = 190

 Score = 75.5 bits (184), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 82/180 (45%), Gaps = 6/180 (3%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKM 139
           LK+   +   C LC+T  + +        +++ +G  P  S++  G PF G++G +LDK 
Sbjct: 6   LKAECLACTRCELCATRTNVVFGQGVPDAEVLFVGEGPGQSEDEQGLPFVGRSGQLLDKY 65

Query: 140 LQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTK 198
           L +I++ R +  +I+ I    PP NR+    E E C P +  Q  L+ PKI++ +G    
Sbjct: 66  LFAIDLDRKKNCYIANIVKCRPPQNRDPLPAESEACMPWLREQFRLLHPKIVVCLGRVAA 125

Query: 199 NFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
                 D   T ++      +     I+  + T HP  L++ P  K   +     L+  +
Sbjct: 126 QRMIRQDFSVTREH----GQIIEKGGIL-FMGTFHPAALLRQPQNKPEAFADFTVLRDTI 180


>gi|253680837|ref|ZP_04861640.1| uracil-DNA glycosylase [Clostridium botulinum D str. 1873]
 gi|253562686|gb|EES92132.1| uracil-DNA glycosylase [Clostridium botulinum D str. 1873]
          Length = 185

 Score = 75.5 bits (184), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 52/182 (28%), Positives = 82/182 (45%), Gaps = 9/182 (4%)

Query: 81  KSLLRSFHDCHLCSTSLSTICATQTEGQ---DLMIIGYTPSDSDNISGKPFSGKTGNMLD 137
           K L +   DC  C+ S   I     EG     LM IG  P   ++ +G+PF G+ G +L 
Sbjct: 5   KDLYKKCKDCSKCNLSNGKINMVFGEGNPKAKLMFIGEAPGADEDKTGRPFVGRAGQLLT 64

Query: 138 KMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
           K L ++ + R Q  +I+ I    P  NRN    E   C P +  Q+ LI PKI++ +G  
Sbjct: 65  KGLLALNLHREQDYYITNICKCRPENNRNPMEHEACACIPYLRNQVALIKPKIIICLGAI 124

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
              +  N++ + T ++ GKW         I  +   HP  +++    K   W  L  +K+
Sbjct: 125 AGKYIINSNLRIT-RDRGKW----IEKKGIYIMPIFHPAAILRDNSKKSLFWRDLKEIKR 179

Query: 257 AL 258
             
Sbjct: 180 KF 181


>gi|198284582|ref|YP_002220903.1| phage SPO1 DNA polymerase-like protein [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218667172|ref|YP_002427251.1| uracil-DNA glycosylase family 4 protein [Acidithiobacillus
           ferrooxidans ATCC 23270]
 gi|198249103|gb|ACH84696.1| phage SPO1 DNA polymerase-related protein [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218519385|gb|ACK79971.1| uracil-DNA glycosylase family 4 protein [Acidithiobacillus
           ferrooxidans ATCC 23270]
          Length = 308

 Score = 75.5 bits (184), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 82/182 (45%), Gaps = 9/182 (4%)

Query: 78  HELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLD 137
            +L +++ +   C L  T    +          + +G  P   ++  G+ F G+ G +LD
Sbjct: 127 RDLSNMVSTCQACPLGQTRKHAVFGAGNPHGSWLFVGEAPGAEEDRRGEAFVGRAGQLLD 186

Query: 138 KMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
            MLQ++ + R +  +I+ I    PP NR+    E+  C P + RQI L+ P++++ +G  
Sbjct: 187 NMLQAMGLSRDKDAYIANILKCRPPNNRDPLGPEVHACTPYLQRQIALLQPRVIVALGR- 245

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
               F      +    L +          IP + T HP  L++ P+ K+  W     LK+
Sbjct: 246 ----FAAQGLLQVNTPLSQLRGTTQHFQGIPLIVTYHPAYLLRNPIDKRKVWE---DLKR 298

Query: 257 AL 258
           AL
Sbjct: 299 AL 300


>gi|289523071|ref|ZP_06439925.1| uracil-DNA glycosylase [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
 gi|289503614|gb|EFD24778.1| uracil-DNA glycosylase [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
          Length = 211

 Score = 75.5 bits (184), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 73/160 (45%), Gaps = 4/160 (2%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKM 139
           L+  ++    C L      ++    +   +LM +G  P   +++ G PF GK G +L+++
Sbjct: 24  LEEKVKECRKCPLSENRTQSVFGEGSRKTELMFVGEGPGADEDLQGLPFVGKAGQLLNQI 83

Query: 140 LQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKN 199
             +  I R++++I+ +    PP NR  +  E   C   +  QI L+ PKIL+ +GN    
Sbjct: 84  FAAAGIDRSEVYITNVVKCRPPQNRVPTVEECSACNDYLFAQISLVQPKILITLGNTPTK 143

Query: 200 FFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ 239
           +      +   Q  GKW +       I  +   HP  L++
Sbjct: 144 WLLKTTHEGITQLRGKWFDWYG----IKLMPMFHPSYLLR 179


>gi|153005432|ref|YP_001379757.1| phage SPO1 DNA polymerase-like protein [Anaeromyxobacter sp.
           Fw109-5]
 gi|152029005|gb|ABS26773.1| phage SPO1 DNA polymerase-related protein [Anaeromyxobacter sp.
           Fw109-5]
          Length = 260

 Score = 75.5 bits (184), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 80/174 (45%), Gaps = 11/174 (6%)

Query: 75  CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
            SL  L+   R    C L   +  T+        +++++G  P + ++++G PF G  G 
Sbjct: 57  ASLASLREAARGCRACPLWERATQTVFGEGPSRAEVVLVGEQPGNEEDLAGLPFVGPAGR 116

Query: 135 MLDKMLQSIEIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELISP 187
           +LDK L +  I R +++++       W P G R +    +  E+  CRP +  ++ L+ P
Sbjct: 117 LLDKALAAAGIDRRRVYVTNAVKHFKWEPRGKRRIHQKPNAGEVRACRPWLDAELRLVRP 176

Query: 188 KILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
           + ++ +G            + T     +   L +P + I  LATVHP  +++ P
Sbjct: 177 RAVVCLGATAAQALLGKGFRVTRS---RGEPLASPLAPI-VLATVHPSAILRAP 226


>gi|330507398|ref|YP_004383826.1| uracil DNA glycosylase [Methanosaeta concilii GP-6]
 gi|328928206|gb|AEB68008.1| uracil DNA glycosylase [Methanosaeta concilii GP-6]
          Length = 192

 Score = 75.1 bits (183), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 59/109 (54%), Gaps = 3/109 (2%)

Query: 90  CHLCSTSLS---TICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIM 146
           C LC  SLS   T+  +     ++M++G  P   +++ G PF G+ G +LD+ L    + 
Sbjct: 20  CDLCPLSLSRNLTVPGSGPSKAEIMLVGEAPGREEDLKGLPFVGRAGRLLDEALNEAGLK 79

Query: 147 RTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           R  + I+ +    PP NR  +  E+E+C P +  Q++ I P+I+  +GN
Sbjct: 80  REDVFITSVIKCRPPQNRKPNKKEIELCLPYLEDQMDAIRPRIICLMGN 128


>gi|15899042|ref|NP_343647.1| DNA polymerase phage SPO1 N-terminal domain-containing protein
           [Sulfolobus solfataricus P2]
 gi|284175291|ref|ZP_06389260.1| DNA polymerase phage SPO1 N-terminal domain-containing protein
           [Sulfolobus solfataricus 98/2]
 gi|13815575|gb|AAK42437.1| DNA polymerase phage SPO1 N-terminal domain homolog [Sulfolobus
           solfataricus P2]
 gi|261600789|gb|ACX90392.1| phage SPO1 DNA polymerase-related protein [Sulfolobus solfataricus
           98/2]
          Length = 216

 Score = 75.1 bits (183), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 80/179 (44%), Gaps = 4/179 (2%)

Query: 84  LRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSI 143
           +R    C L     + +        ++M IG  P ++++I GKPF G  G +L +++  I
Sbjct: 11  VRKCQKCKLWKFRKNAVPGEGNSKAEIMFIGEAPGENEDIEGKPFVGVAGKLLTRLINEI 70

Query: 144 -EIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFF 202
             + R  + I+ +    PP NR+    E+  C P + RQIE I P I++ +G  + ++ F
Sbjct: 71  LGLSREDVFITNLVKCRPPNNRDPEEDEILACSPYLTRQIESIRPHIIITLGRHSTSYLF 130

Query: 203 ---NNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
              N   +   +  GK+         I    T HP   +  P I+K        +K+AL
Sbjct: 131 KKMNMKMESIGKVRGKFYTWNIYGYKILVFPTYHPAAALYNPPIRKVLEEDFRKVKEAL 189


>gi|15922569|ref|NP_378238.1| DNA-directed DNA polymerase [Sulfolobus tokodaii str. 7]
 gi|15623359|dbj|BAB67347.1| 220aa long hypothetical DNA-directed DNA polymerase,
           bacteriophage-type [Sulfolobus tokodaii str. 7]
          Length = 220

 Score = 75.1 bits (183), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 68/129 (52%), Gaps = 1/129 (0%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           SL ++K  + S   C L     + +        ++M +G  P ++++  G+PF G  G +
Sbjct: 3   SLEKIKEEVISCKKCKLWQFRTNAVPGEGYPKAEIMFVGEAPGENEDKEGRPFVGAAGKL 62

Query: 136 LDKMLQSI-EIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           L +M++ I  + R Q+ I+ +    PP NR+    E+  C P + RQI++I PKI++ +G
Sbjct: 63  LTQMIKEILGLERDQVFITNVVKCRPPNNRDPEEDEITACSPYLDRQIDIIMPKIIVTLG 122

Query: 195 NKTKNFFFN 203
             +  + F+
Sbjct: 123 RHSTKYIFS 131


>gi|312897619|ref|ZP_07757036.1| uracil-DNA glycosylase, family 4 [Megasphaera micronuciformis
           F0359]
 gi|310621252|gb|EFQ04795.1| uracil-DNA glycosylase, family 4 [Megasphaera micronuciformis
           F0359]
          Length = 216

 Score = 75.1 bits (183), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 84/177 (47%), Gaps = 13/177 (7%)

Query: 90  CHLCSTSLSTICATQTEGQD---LMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIM 146
           CHLC         TQ  G +   LM +G  P   ++  G P  G +G +LDK L S+ + 
Sbjct: 16  CHLCREG--NRGPTQWSGPEDSPLMFVGEGPGGVEDEYGVPLVGPSGKLLDKALWSVGLT 73

Query: 147 RTQIHISMISPWHPPGNRNLSNIEMEICRPIIMR-QIELISPKILLFIGNKTKNFFFNND 205
           R +I+++ I    P  NR  +  E   C  + +R +IE + P +++ +G     +F+ + 
Sbjct: 74  RDRIYVTNIVKCRPHNNRTPTLDEGRFCADLHLRAEIEAVKPAVIVCLGKVAFQYFYGS- 132

Query: 206 AQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQY--PLIKKNTWHALITLKKALKN 260
           A    +N GKW +    +  IP + T HP  L++     + ++ W     LK A++ 
Sbjct: 133 AGSIMRNRGKWLD----YEKIPVMPTYHPAFLLRQTGKELVESKWQVYYDLKSAVEK 185


>gi|298246517|ref|ZP_06970323.1| phage SPO1 DNA polymerase-related protein [Ktedonobacter racemifer
           DSM 44963]
 gi|297553998|gb|EFH87863.1| phage SPO1 DNA polymerase-related protein [Ktedonobacter racemifer
           DSM 44963]
          Length = 213

 Score = 75.1 bits (183), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 64/129 (49%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L E+   + +   C+LC      +    +    ++ IG  P   ++  G+PF G  G  L
Sbjct: 7   LREVAVEVSTCSKCNLCKGRTRAVPGEGSTSAKILFIGEGPGYHEDQQGRPFVGPAGQFL 66

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
           D++L SI + R+ + I+ +    PP NR+    E+  C   + RQIE + P++++ +G  
Sbjct: 67  DELLASINLKRSDVFITNVVKCRPPQNRDPQPDEIAACNNYLDRQIEALKPRVIVTLGRF 126

Query: 197 TKNFFFNND 205
           +   FF N+
Sbjct: 127 SMAKFFGNE 135


>gi|186682234|ref|YP_001865430.1| phage SPO1 DNA polymerase-related protein [Nostoc punctiforme PCC
           73102]
 gi|186464686|gb|ACC80487.1| phage SPO1 DNA polymerase-related protein [Nostoc punctiforme PCC
           73102]
          Length = 227

 Score = 75.1 bits (183), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 78/171 (45%), Gaps = 14/171 (8%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           ++ EL       H C L  T    +         +M+IG  P  +++ +G PF G++G +
Sbjct: 37  TITELAQHCDRCHRCPLGDTRTHAVVGRGNLKAPIMVIGEAPGQNEDETGLPFVGRSGQL 96

Query: 136 LDKMLQSIEIMRT-QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           L+K+L S+ +     ++I+ I+   PP NR  +  E+  C P ++ QI L+ PKI+L  G
Sbjct: 97  LEKILASVNLTTEHDVYIANINKCRPPDNRVPTPTEVAACLPYLLEQIRLVDPKIILLTG 156

Query: 195 NKTKNFFFNNDAQKTYQNLGKW----SNLCTPHSIIPTLATVHPQELIQYP 241
             T       D +   +  G+W      LC P          HP  L++ P
Sbjct: 157 -ATAVKGITGDKRGITKIRGQWLEWEGRLCMP--------IFHPSYLLRNP 198


>gi|156937095|ref|YP_001434891.1| phage SPO1 DNA polymerase-related protein [Ignicoccus hospitalis
           KIN4/I]
 gi|156566079|gb|ABU81484.1| phage SPO1 DNA polymerase-related protein [Ignicoccus hospitalis
           KIN4/I]
          Length = 191

 Score = 75.1 bits (183), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 82/183 (44%), Gaps = 8/183 (4%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L E+   ++    C LC    + +     EG +++ +G  P   ++  G+PF G+ G +L
Sbjct: 3   LREVAEKVKGCCKCDLCKVRKNPVPGEGDEGAEVVFVGEAPGKEEDEEGRPFVGRAGRLL 62

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
              +  I     + +I+ +    PPGNR  +  E+E C+P ++ ++  I PK+++ +G  
Sbjct: 63  RSTISQIGF--KKYYITNVVKCRPPGNRTPTEEEVEACKPYLIEELNCIRPKLVVALGRT 120

Query: 197 TKNFFFN-NDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
                       K  +  GK        + +  L T HP  +++ P +K+     +  LK
Sbjct: 121 AAEALLGLKGPLKGVR--GKVLVASAGGARVKVLVTYHPAAVLRNPKLKE---QFVSDLK 175

Query: 256 KAL 258
           KA 
Sbjct: 176 KAF 178


>gi|294102554|ref|YP_003554412.1| phage SPO1 DNA polymerase-related protein [Aminobacterium
           colombiense DSM 12261]
 gi|293617534|gb|ADE57688.1| phage SPO1 DNA polymerase-related protein [Aminobacterium
           colombiense DSM 12261]
          Length = 189

 Score = 74.7 bits (182), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 63/124 (50%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKM 139
           L+  +     C LC      +         +M++G  P  +++ +G+PF G++GN+L ++
Sbjct: 6   LRQRIEVCEKCELCGMRQQPVIGEGLAECRVMLVGEAPGATEDETGRPFVGRSGNLLCQL 65

Query: 140 LQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKN 199
           ++   + R    I+ +    PP NR  +  E++ CRP +  QI L+SP +++  GN    
Sbjct: 66  IEEAGLSREFFFITNMVKCRPPENRKPTKDELDACRPFLEEQIRLLSPLLIVTAGNTPTQ 125

Query: 200 FFFN 203
           +F N
Sbjct: 126 WFLN 129


>gi|146297378|ref|YP_001181149.1| phage SPO1 DNA polymerase-related protein [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|145410954|gb|ABP67958.1| phage SPO1 DNA polymerase-related protein [Caldicellulosiruptor
           saccharolyticus DSM 8903]
          Length = 187

 Score = 74.7 bits (182), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 51/185 (27%), Positives = 89/185 (48%), Gaps = 6/185 (3%)

Query: 78  HELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLD 137
            EL+    S   C +     + +     +   LM IG  P + ++  GKPF G+ G +LD
Sbjct: 5   EELERSCLSCTKCPISKDRTNVVIGDGNKNAKLMFIGEAPGEEEDKQGKPFVGRAGKLLD 64

Query: 138 KMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
             L ++E+ R    +I  I    PP NR  +  E + C P +  Q++L+ PKI++ +G  
Sbjct: 65  LALDALELSRENDFYICNILKCRPPNNRVPTEYEAQNCLPYLRAQVKLVQPKIIVCLGAT 124

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
              +    + + T Q+ GKW      H     +AT HP  L++ P  +++ +  L ++K+
Sbjct: 125 AMKYILGRNLKIT-QDRGKWFQKGEFH----IMATYHPAALLRDPSKREDFYRDLKSVKE 179

Query: 257 ALKNL 261
            LK +
Sbjct: 180 KLKEM 184


>gi|91774250|ref|YP_566942.1| phage SPO1 DNA polymerase-related protein [Methanococcoides
           burtonii DSM 6242]
 gi|91713265|gb|ABE53192.1| Uracil DNA glycosylase [Methanococcoides burtonii DSM 6242]
          Length = 184

 Score = 74.7 bits (182), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 67/125 (53%), Gaps = 3/125 (2%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEGQD---LMIIGYTPSDSDNISGKPFSGKTGNML 136
           L+ + +   DC  C  S + I     +G D   ++ IG  P   ++ +G PF G+ G +L
Sbjct: 8   LEGVEKDILDCTACPLSETVINKVVRKGSDEPKVLFIGEAPGKKEDETGVPFCGRAGKIL 67

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
           D++++ + +  +   +       PP NRN +  E++ C+P ++RQI+L+ P +++ +GN 
Sbjct: 68  DELIEYMGLESSDWAVINTIKCRPPNNRNPNKKELDCCKPFLIRQIQLLDPNLIVLLGNT 127

Query: 197 TKNFF 201
            +  +
Sbjct: 128 AEKAY 132


>gi|312880146|ref|ZP_07739946.1| phage SPO1 DNA polymerase-related protein [Aminomonas paucivorans
           DSM 12260]
 gi|310783437|gb|EFQ23835.1| phage SPO1 DNA polymerase-related protein [Aminomonas paucivorans
           DSM 12260]
          Length = 228

 Score = 74.7 bits (182), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 81/190 (42%), Gaps = 7/190 (3%)

Query: 54  TNIRHIHSPLVQQADSIA--QKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLM 111
           +  R    PL Q + S    Q+A  L E +  +     C L  T   ++         L+
Sbjct: 5   SETRSGEEPLFQLSPSERRHQEAILLEEARHRVERCLRCPLGKTRNKSVFGEGNLWGKLL 64

Query: 112 IIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEM 171
            +G  P   ++  G PF G+ G +L ++LQ+  I R  ++I+ +    PPGNR  +  EM
Sbjct: 65  FVGEGPGADEDEQGMPFVGRAGQLLTQILQAAGIRREDVYITNVVKCRPPGNRVPTFEEM 124

Query: 172 EICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLAT 231
             C   +  QI L  P +L+ +GN    +       KT + + K          +  L  
Sbjct: 125 MACDEYLQTQIALGRPSLLVLLGNTPTKWIL-----KTTEGISKLRGRWFSWKGMSVLPM 179

Query: 232 VHPQELIQYP 241
            HP  L++YP
Sbjct: 180 FHPSYLLRYP 189


>gi|295695673|ref|YP_003588911.1| phage SPO1 DNA polymerase-related protein [Bacillus tusciae DSM
           2912]
 gi|295411275|gb|ADG05767.1| phage SPO1 DNA polymerase-related protein [Bacillus tusciae DSM
           2912]
          Length = 193

 Score = 74.7 bits (182), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 64/119 (53%), Gaps = 1/119 (0%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L++L+S  +S   C L       + +  T G  ++++G  P   ++  G PF G+ G +
Sbjct: 6   NLNQLESAFKSCRRCGLRGGCSQVVVSRGTPG-PVVLVGEAPGADEDAQGFPFVGRAGQL 64

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           LD+ML+       +++I+      PPGNR  +  EM  CRP +M Q  ++ P+I++ +G
Sbjct: 65  LDRMLKEAGFDPARLYITNAVKCRPPGNRKPAPEEMVACRPYLMAQFAVLQPEIVVTMG 123


>gi|294496120|ref|YP_003542613.1| phage SPO1 DNA polymerase-related protein [Methanohalophilus mahii
           DSM 5219]
 gi|292667119|gb|ADE36968.1| phage SPO1 DNA polymerase-related protein [Methanohalophilus mahii
           DSM 5219]
          Length = 178

 Score = 74.7 bits (182), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 63/129 (48%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           S  +L+  + S   C L  +++  +     +   ++ IG  P   ++ SG PF G+ G +
Sbjct: 4   SFEDLEEEINSCTACQLHDSAIHKVIMKGGQNPKVLFIGEAPGKKEDASGIPFCGRAGKI 63

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           LD M++ +++ ++   +       PP NR     E+  CR    +QIE++ P +++ +GN
Sbjct: 64  LDGMIEDMDLQQSDWAVINTVKCRPPNNRRPRKEELAACRAFFEQQIEMLEPDVIILLGN 123

Query: 196 KTKNFFFNN 204
             +  F  N
Sbjct: 124 TAEEAFLGN 132


>gi|332284994|ref|YP_004416905.1| uracil-DNA glycosylase [Pusillimonas sp. T7-7]
 gi|330428947|gb|AEC20281.1| uracil-DNA glycosylase [Pusillimonas sp. T7-7]
          Length = 286

 Score = 74.7 bits (182), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 77/178 (43%), Gaps = 9/178 (5%)

Query: 81  KSLLRSFHDCHLCSTSLSTICATQTEGQDLM----IIGYTPSDSDNISGKPFSGKTGNML 136
           ++L+     C  C   +    A    G + M    ++G  P   D+ +G PF GK G +L
Sbjct: 97  EALISHIAGCQACGLHVGRSHAVSGAGAEHMPEWLVVGEAPGSVDDRTGLPFQGKAGQLL 156

Query: 137 DKMLQSIEIM-RTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
             ML SI++  +T +  + +    P GNR  +  E+E C P + RQI L+ P  +L +G+
Sbjct: 157 QAMLASIQVTEQTPVFFTNVIKCRPLGNRTPTQDEIEACMPYLQRQIALLKPHRILALGS 216

Query: 196 KTKN--FFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
                     ND +     +    +       IP + T HP  L+  P  K + W  L
Sbjct: 217 LAAQAVLGLQNDLEALRGKVHAMRSEAD--QDIPVVVTYHPTALLLRPQHKPDAWRDL 272


>gi|193084356|gb|ACF10013.1| phage SPO1 DNA polymerase-related protein [uncultured marine
           crenarchaeote SAT1000-49-D2]
          Length = 180

 Score = 74.7 bits (182), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 63/119 (52%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L  ++  +++   C LC T  + +     +  D++ IG  P  ++++ G+PF G  G  L
Sbjct: 7   LEIIQEKVKTCEKCDLCITRKNAVPGKGNQNADIIFIGEAPGKNEDLHGEPFIGTAGKKL 66

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           D  L++  + R  ++I+ I    PP NR  +++E   C   +  +I +I+PKI+  +GN
Sbjct: 67  DDALKNAGLTRNSVYITNIVKCRPPKNRIPNDVEKSTCNEYLKAEIAIINPKIICLLGN 125


>gi|225849400|ref|YP_002729564.1| uracil-DNA glycosylase [Sulfurihydrogenibium azorense Az-Fu1]
 gi|225644302|gb|ACN99352.1| uracil-DNA glycosylase family 4 protein [Sulfurihydrogenibium
           azorense Az-Fu1]
          Length = 211

 Score = 74.7 bits (182), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 66/132 (50%)

Query: 63  LVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDN 122
           +V     + +K   L+++   +++   C L       +         +M IG  P + ++
Sbjct: 19  IVDNNSPLNEKIKLLNQINQEIQNCTKCDLHKNRKQAVLGEGNPNSPIMFIGEAPGEEED 78

Query: 123 ISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQI 182
             G+PF G+ G +L K +++    R+ ++I+ I+   PP NR  +  E E C P + RQI
Sbjct: 79  KQGRPFVGRAGQLLTKAIETAGYKRSDVYIANINKCRPPNNRTPTIEEQEACFPYLKRQI 138

Query: 183 ELISPKILLFIG 194
           E+I+P +L  +G
Sbjct: 139 EIINPSVLCLLG 150


>gi|119872232|ref|YP_930239.1| phage SPO1 DNA polymerase-related protein [Pyrobaculum islandicum
           DSM 4184]
 gi|119673640|gb|ABL87896.1| phage SPO1 DNA polymerase-related protein [Pyrobaculum islandicum
           DSM 4184]
          Length = 193

 Score = 74.3 bits (181), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 81/182 (44%), Gaps = 6/182 (3%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQ---DLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L+ L      C  C   L    A   EG     +MI+G  P  S++  G+PF G  G +
Sbjct: 2   DLEDLNEKIKRCTRCPLHLYRKNAVPGEGSLKLGIMIVGEAPGASEDEEGRPFVGVAGQL 61

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG- 194
           L K L  + I R  ++I+ +    PPGNR  +  E+E C P +++QI ++ PK ++ +G 
Sbjct: 62  LTKTLAKLGISRDDVYITNVVKCRPPGNRTPTREEIEACLPYLLQQIVILKPKRIVALGL 121

Query: 195 --NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALI 252
              KT       +  K     GK          +    T HP  +++ P +++   + L 
Sbjct: 122 ISGKTLLKLVGREVDKIGNVRGKCFRGQVAGVNLEICLTYHPAAVLRNPHLREVFENDLA 181

Query: 253 TL 254
           T 
Sbjct: 182 TF 183


>gi|332796184|ref|YP_004457684.1| phage SPO1 DNA polymerase-like protein [Acidianus hospitalis W1]
 gi|332693919|gb|AEE93386.1| phage SPO1 DNA polymerase-related protein [Acidianus hospitalis W1]
          Length = 207

 Score = 74.3 bits (181), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/172 (25%), Positives = 76/172 (44%), Gaps = 3/172 (1%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           SL E+   +R    C L  T  + +        ++M+IG  P  +++  G+PF G  G +
Sbjct: 2   SLEEIAKQVRECTKCKLHLTRKNAVPGEGNPSAEIMLIGEAPGANEDEEGRPFVGAAGKL 61

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           L ++L SI + R  + I+ +    PP NR+    E+  C P +  QI +I PKI++ +G 
Sbjct: 62  LTELLSSIGLNRKDVFITNLVKCRPPNNRDPEEDEIIACSPYLDEQIRIIKPKIIVTLGK 121

Query: 196 KTKNFFFNNDAQKTYQ---NLGKWSNLCTPHSIIPTLATVHPQELIQYPLIK 244
            +  +       K        GK+      +  I    T HP   +  P ++
Sbjct: 122 HSTTYILGKIGIKVKSISAVRGKFFTWNYGNVTISVFPTYHPAAALYNPSLR 173


>gi|74317499|ref|YP_315239.1| putative phage DNA polymerase [Thiobacillus denitrificans ATCC
           25259]
 gi|74056994|gb|AAZ97434.1| putative phage DNA polymerase [Thiobacillus denitrificans ATCC
           25259]
          Length = 235

 Score = 74.3 bits (181), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 40/174 (22%), Positives = 79/174 (45%), Gaps = 11/174 (6%)

Query: 73  KACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKT 132
           K  S+  L+   R    C L   +  T+         ++++G  P + +++ G+PF G  
Sbjct: 37  KTRSIDALRRAARGCRGCALYRNATQTVFGEGASHARVLLVGEQPGNDEDLEGRPFVGSA 96

Query: 133 GNMLDKMLQSIEIMRTQIHISMIS---PWHPPGNRNLSN----IEMEICRPIIMRQIELI 185
           G +LD+ L +  I R   +++ +     W P G R + +     E++ C P + R+I L+
Sbjct: 97  GRVLDEGLAAAGIDRAATYVTNVVKHFKWEPSGKRRMHSKPNLREIDACFPWLEREIALL 156

Query: 186 SPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ 239
            P +++ +G          D + T Q     ++   PH +    AT+HP  +++
Sbjct: 157 RPHLIVCLGATAAQALLGRDFRVTRQRGQLVASPLAPHVV----ATIHPSAILR 206


>gi|148239810|ref|YP_001225197.1| Uracil-DNA glycosylase [Synechococcus sp. WH 7803]
 gi|147848349|emb|CAK23900.1| Uracil-DNA glycosylase [Synechococcus sp. WH 7803]
          Length = 191

 Score = 74.3 bits (181), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 63/120 (52%), Gaps = 1/120 (0%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L  LKS   +   C L       +      G DLM+IG  P   ++  G PF G++G +
Sbjct: 3   ALDALKSQCAACQCCDLAYHRNQVVVGRGNPGADLMLIGEAPGADEDSQGLPFVGRSGRL 62

Query: 136 LDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           L ++L++ E+   Q +HI  +    PP NR  ++ E++ CRP +  QI L++P ++L  G
Sbjct: 63  LSELLEAAELDEEQDLHICNVIKCRPPNNRKPTSNEIKQCRPWLEEQIALVNPSLVLLAG 122


>gi|86606890|ref|YP_475653.1| uracil-DNA glycosylase [Synechococcus sp. JA-3-3Ab]
 gi|86555432|gb|ABD00390.1| uracil-DNA glycosylase, family 4 [Synechococcus sp. JA-3-3Ab]
          Length = 206

 Score = 74.3 bits (181), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/171 (26%), Positives = 75/171 (43%), Gaps = 14/171 (8%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
            L +L+   R    C L +     +         ++IIG  P + +++ G PF GK+G +
Sbjct: 10  ELEQLEQHCRVCQRCELAANRTHVVVHRGNPKARILIIGEGPGEQEDLQGLPFVGKSGQL 69

Query: 136 LDKMLQSIEI-MRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           LDK+L S+ +      +I  +    PP NR  +  EM+ CRP ++ QI L+ P I+L  G
Sbjct: 70  LDKILASVGLDSERDTYICNVVKCRPPNNRVPTQEEMDACRPYLLEQIRLVDPWIILLTG 129

Query: 195 NKTKNFFFNNDAQKTYQNLGKW----SNLCTPHSIIPTLATVHPQELIQYP 241
             +       D +   +  G+W       C P          HP  L++ P
Sbjct: 130 ATSVRSLL-GDKRGITKIRGEWIQWQGRWCMP--------IFHPAYLLRNP 171


>gi|332703223|ref|ZP_08423311.1| phage SPO1 DNA polymerase-related protein [Desulfovibrio africanus
           str. Walvis Bay]
 gi|332553372|gb|EGJ50416.1| phage SPO1 DNA polymerase-related protein [Desulfovibrio africanus
           str. Walvis Bay]
          Length = 189

 Score = 74.3 bits (181), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 50/187 (26%), Positives = 81/187 (43%), Gaps = 16/187 (8%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQ---DLMIIGYTPSDSDNISGKPFSGKTGNM 135
            L  L      C  C   L    A   EG      +++G  P   ++  G+PF G+TG  
Sbjct: 9   RLDELAEGIRICERCPLHLGRRHAVPGEGGFRLHCLLVGEAPGQREDEVGRPFIGRTGAF 68

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPI-IMRQIELISPKILLFIG 194
           LD+ L    + R    I+      PPGNR    +EM+ICR   ++ QI+ + P++++ +G
Sbjct: 69  LDRFLVPFGLSRDDFFITSSVKCRPPGNRAPKPLEMDICREAWLLPQIQALKPRLVVLMG 128

Query: 195 NKTKNFFFNNDAQKTYQNL--GKWSNLCTPHSIIPTLATVHPQELIQYPLIKK---NTWH 249
           N            +T  N   GK       HS +  L T HP   +++P +++     W 
Sbjct: 129 NAPIRSLLG---VRTPMNELHGKLRQ----HSGLSMLPTYHPTAAMRFPAVRRLAEADWE 181

Query: 250 ALITLKK 256
            + TL +
Sbjct: 182 TIRTLLR 188


>gi|254172784|ref|ZP_04879458.1| uracil-DNA glycosylase [Thermococcus sp. AM4]
 gi|214032940|gb|EEB73768.1| uracil-DNA glycosylase [Thermococcus sp. AM4]
          Length = 194

 Score = 74.3 bits (181), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 85/188 (45%), Gaps = 3/188 (1%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           + +L+  +R+   C L     + +  + +    +M +G  P   ++  G PF G+ G +L
Sbjct: 7   MKKLEERIRNCRKCPLGQLRTNAVPGSGSYDAKVMFVGEAPGYWEDQKGLPFVGRAGKVL 66

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
           D++L  I + R  ++I+ I    PP NRN +  E+  C P +  QI++I P++++ +G  
Sbjct: 67  DELLAGIGLSRDDVYITNIVKCRPPENRNPTEEEIRACSPYLDMQIDIIRPRVIVPLGRH 126

Query: 197 TKNFF---FNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALIT 253
           +  +    F  + +   +  GK     T    I  +   HP   +  P +++        
Sbjct: 127 SMGYILRKFGFEPEPISKIHGKVFRANTLFGRILIMPMYHPAAALYKPPLREELRKDFEK 186

Query: 254 LKKALKNL 261
           L K L  L
Sbjct: 187 LGKILNEL 194


>gi|195953859|ref|YP_002122149.1| phage SPO1 DNA polymerase-related protein [Hydrogenobaculum sp.
           Y04AAS1]
 gi|195933471|gb|ACG58171.1| phage SPO1 DNA polymerase-related protein [Hydrogenobaculum sp.
           Y04AAS1]
          Length = 245

 Score = 74.3 bits (181), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 53/194 (27%), Positives = 93/194 (47%), Gaps = 10/194 (5%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQ---DLMIIGYTPSDSDNISGKPFSGKTG 133
           L +LK+   +  DC  C  S         +G     +M +G  P   +++ GKPF GK G
Sbjct: 52  LRQLKAFYETCKDCKKCKLSEQRTQVVFGDGNPDTGIMFVGEGPGADEDVEGKPFVGKAG 111

Query: 134 NMLDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLF 192
            +L + L+ + ++R +  +I+ +    PPGNR     EM  C  I+  +++LI PK+++ 
Sbjct: 112 KLLTQELERVGLLRQRDYYITNVVKCRPPGNRTPEEQEMITCSYILKEEMKLIKPKLVIA 171

Query: 193 IGNKTKNFFFNNDAQKTYQNL-GKW--SNLCTPHSIIPT--LATVHPQELIQYPLIKKNT 247
           +G +T     +   Q +   + G +  +NL +P     T    T HP  L++ P   KN 
Sbjct: 172 LG-RTAAVGLSGIKQISPTKVRGSFISANLKSPVLAPGTKIFVTYHPSYLLRNPNELKNF 230

Query: 248 WHALITLKKALKNL 261
              +I +K  + +L
Sbjct: 231 REDIIKIKSLVDSL 244


>gi|254443722|ref|ZP_05057198.1| uracil-DNA glycosylase, family 4, putative [Verrucomicrobiae
           bacterium DG1235]
 gi|198258030|gb|EDY82338.1| uracil-DNA glycosylase, family 4, putative [Verrucomicrobiae
           bacterium DG1235]
          Length = 305

 Score = 74.3 bits (181), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 49/192 (25%), Positives = 83/192 (43%), Gaps = 23/192 (11%)

Query: 60  HSPLVQ--QADSIAQKACSLHELKSLLRSFHDCHLCSTSLST----ICATQTEGQDLMII 113
            +PLV   + D  AQ        ++L      C +C   L      +  +     D+   
Sbjct: 91  RAPLVNLVKGDKQAQ-------WEALREQVMGCVVCKGRLKEGKKLVFGSGNLDADIFFC 143

Query: 114 GYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPP-----GNRNLSN 168
           G  P   D  +G PFSG  G++L KM+ ++ + R  ++I+ I  W P      G R  + 
Sbjct: 144 GEAPGIEDEDTGVPFSGPAGDLLGKMIGAMGLKRGDVYIADIMNWRPEASTERGKRPPTV 203

Query: 169 IEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNL-GKWSNLCTPHSIIP 227
            EM  C P +  Q+E++ PK+++ +G             K  +++ G+W+        +P
Sbjct: 204 EEMNFCMPYLKGQLEIVQPKLIVALGATAVKGLLGAANVKNLRDVKGQWTEFAG----VP 259

Query: 228 TLATVHPQELIQ 239
            L T HP  LI+
Sbjct: 260 MLPTYHPSYLIR 271


>gi|71483038|gb|AAZ32472.1| uracyl DNA glycosylase [uncultured euryarchaeote Alv-FOS1]
          Length = 196

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/117 (29%), Positives = 60/117 (51%)

Query: 84  LRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSI 143
           +R    C L  T  + +       + +M +G  P   ++I G+PF G  G  LD++L SI
Sbjct: 19  IRKCQKCELWKTRKNAVPGEGGFRKKVMFVGEAPGKWEDIKGRPFVGAAGKYLDELLSSI 78

Query: 144 EIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNF 200
            + R  + I+ I    PP NR+ ++ E+  C P +  QIE ++P+I+  +G  +  F
Sbjct: 79  GLSRDDVFITNIVKCRPPNNRDPTSEEISACAPYLEWQIETMAPRIICPLGRFSAKF 135


>gi|14591260|ref|NP_143337.1| hypothetical protein PH1472 [Pyrococcus horikoshii OT3]
 gi|3257896|dbj|BAA30579.1| 197aa long hypothetical protein [Pyrococcus horikoshii OT3]
          Length = 197

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 48/196 (24%), Positives = 92/196 (46%), Gaps = 9/196 (4%)

Query: 69  SIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPF 128
           S+  K   + +L+  +R    C L     + +    +    +M +G  P   ++  G PF
Sbjct: 3   SVPSKEELMKKLEEKIRKCKKCPLWEVRTNPVPGDGSYDTKIMFVGEAPGYWEDQMGLPF 62

Query: 129 SGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPK 188
            GK G +LD++L+ I + R++++I+ I    PP NR+ +  E++ C P +  QI++I PK
Sbjct: 63  VGKAGKVLDELLKLIGLKRSEVYITNIVKCRPPNNRDPTEEEIKACAPYLDAQIDIIKPK 122

Query: 189 ILLFIGNKT-----KNFFFNNDA-QKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPL 242
           +++ +G  +     K + FN +   K +  + +   L     I+P     HP   +  P 
Sbjct: 123 VIVTLGRFSTAYIMKKYGFNVEPISKIHGRVFEARTLFGKIYIVPMY---HPAVALYRPQ 179

Query: 243 IKKNTWHALITLKKAL 258
           +++        LK  L
Sbjct: 180 LRRELEEDFKKLKSLL 195


>gi|300871218|ref|YP_003786091.1| uracil DNA glycosylase [Brachyspira pilosicoli 95/1000]
 gi|300688919|gb|ADK31590.1| uracil DNA glycosylase [Brachyspira pilosicoli 95/1000]
          Length = 236

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 81/166 (48%), Gaps = 9/166 (5%)

Query: 78  HELKSLLRSFHDC----HLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTG 133
            ELK L ++   C     LCST  + +     E  D++ +G  P   ++  G PF G+ G
Sbjct: 53  EELKKLYQTITKCMKCEALCSTRKNVVFGRGDEKPDIVFVGEAPGADEDKLGFPFVGRAG 112

Query: 134 NMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFI 193
            +LDK ++ + I  +  +I       PP NR+    E + CR    +Q+E+++PKI+  +
Sbjct: 113 KLLDKWIEKLNI--SNYYIMNALKCRPPENRDPLLEEKDNCREFFTKQLEILNPKIICAL 170

Query: 194 GNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ 239
           G    +   + D +  +   GK  N    ++ IP +AT HP  +++
Sbjct: 171 GRHGFSNLVDFDLKTPF---GKVRNNIHYYNNIPVIATYHPAYILR 213


>gi|332157701|ref|YP_004422980.1| hypothetical protein PNA2_0058 [Pyrococcus sp. NA2]
 gi|331033164|gb|AEC50976.1| hypothetical protein PNA2_0058 [Pyrococcus sp. NA2]
          Length = 197

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 89/191 (46%), Gaps = 9/191 (4%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           + +L+  +++   C L     + +    +    +M +G  P   ++  G PF GK G +L
Sbjct: 8   MKKLEERIKNCKKCPLWELRTNPVPGDGSYNAKVMFVGEAPGYWEDQMGLPFVGKAGKVL 67

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
           D++L+SI + R +++I+ I    PP NR+ +  E++ C P +  QI++I PK+++ +G  
Sbjct: 68  DELLKSIGLSRNEVYITNIVKCRPPNNRDPTEEEIKACSPYLDAQIDIIRPKVIVTLGRF 127

Query: 197 TKNF------FFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHA 250
           +  +      F      K +  + +   L     IIP     HP   +  P ++K     
Sbjct: 128 SMGYILRKYGFAVEPISKVHGKVFEARTLFGKLYIIPMY---HPAVALYRPQLRKELEED 184

Query: 251 LITLKKALKNL 261
              LK  L +L
Sbjct: 185 FKKLKALLASL 195


>gi|189499343|ref|YP_001958813.1| phage SPO1 DNA polymerase-related protein [Chlorobium
           phaeobacteroides BS1]
 gi|189494784|gb|ACE03332.1| phage SPO1 DNA polymerase-related protein [Chlorobium
           phaeobacteroides BS1]
          Length = 208

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 87/190 (45%), Gaps = 5/190 (2%)

Query: 66  QADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISG 125
           Q +S A    +L++L    ++   C L  T  + +         +++IG  P   ++  G
Sbjct: 15  QKESAAGAFRNLNDLYEQSKNCRKCRLADTRTNFVFGEGNPEAKIVVIGEAPGAEEDAQG 74

Query: 126 KPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELI 185
           +PF G++G +LDK+L++I   R  + I  I    PP NRN    E+  C P +  Q+ L+
Sbjct: 75  RPFVGRSGKLLDKILEAIGFSRDDVFICNIIKCRPPANRNPLADEITCCMPWLNAQLALL 134

Query: 186 SPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKK 245
            P +LL +G    N   +N      Q++G         +    + T HP  L++ P  K+
Sbjct: 135 DPAVLLLLGKVAANTLLDNK-----QSMGNLRGKIIRWNGYDVIVTYHPAALLRNPNWKR 189

Query: 246 NTWHALITLK 255
             W  +  L+
Sbjct: 190 QCWDDVRMLR 199


>gi|45656446|ref|YP_000532.1| uracil-DNA glycosylase [Leptospira interrogans serovar Copenhageni
           str. Fiocruz L1-130]
 gi|294828371|ref|NP_713848.2| uracil-DNA glycosylase [Leptospira interrogans serovar Lai str.
           56601]
 gi|45599681|gb|AAS69169.1| uracil-DNA glycosylase [Leptospira interrogans serovar Copenhageni
           str. Fiocruz L1-130]
 gi|293386223|gb|AAN50866.2| uracil-DNA glycosylase [Leptospira interrogans serovar Lai str.
           56601]
          Length = 218

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 50/195 (25%), Positives = 90/195 (46%), Gaps = 18/195 (9%)

Query: 69  SIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPF 128
           S  +K   L  ++S + +   C L +T   T+        +L+ IG  P   ++++G+PF
Sbjct: 17  SKEEKLKRLGLMQSEVSACKLCKLETTRTQTVFGEGNPDAELVFIGEGPGKQEDLTGRPF 76

Query: 129 SGKTGNMLDKMLQ-SIEIMRTQIHISMISPWHP------PGNRNLSNIEMEICRPIIMRQ 181
            GK G +L ++++  + + R  ++I+ I    P        +R     E   C P ++RQ
Sbjct: 77  VGKAGELLTRIIEKGMGVPRESVYIANIVKCRPTVDMKFEKDRPPEEEETRACAPYLLRQ 136

Query: 182 IELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ-- 239
           +E+I PK ++ +GN +  F  N     T    G W +       IP + T HP  +I+  
Sbjct: 137 LEIIQPKAIVTLGNPSTRFILNTKEGITKLR-GTWGSFFG----IPVMPTYHPSFVIRNG 191

Query: 240 ---YPLIKKNTWHAL 251
               PL K++ W  +
Sbjct: 192 GENSPL-KRDVWEDI 205


>gi|21226588|ref|NP_632510.1| DNA polymerase [Methanosarcina mazei Go1]
 gi|20904864|gb|AAM30182.1| DNA polymerase [Methanosarcina mazei Go1]
          Length = 197

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 60/112 (53%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C L  +++  +    +    +  IG  P +S+N SG PF G+ G  LD+M++ + +    
Sbjct: 36  CPLHESAIKRVIGKGSCNPKVFFIGEAPGESENKSGIPFYGRAGKKLDQMVEYMGLSEED 95

Query: 150 IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFF 201
             ++      PPGNR     E+E C+P ++ QI L++PK+++ +GN  +  F
Sbjct: 96  WFVTNTVKCRPPGNRKPRVQEIECCKPFLIAQITLLNPKLIILLGNTAEKSF 147


>gi|94985656|ref|YP_605020.1| phage SPO1 DNA polymerase-related protein [Deinococcus geothermalis
           DSM 11300]
 gi|94555937|gb|ABF45851.1| uracil-DNA glycosylase [Deinococcus geothermalis DSM 11300]
          Length = 230

 Score = 73.6 bits (179), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/153 (27%), Positives = 70/153 (45%), Gaps = 7/153 (4%)

Query: 65  QQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNIS 124
           Q AD IA     L  L+   +S   C L       + +       L+IIG  P   ++  
Sbjct: 8   QAADVIA-----LEALEQQAKSCAACKLRPGCTQVVVSDGDPAAPLVIIGEGPGGDEDRL 62

Query: 125 GKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMR-QIE 183
           G+PF G+ G +LD++L ++ + R   + + I    PPGNR     E  IC  + +  Q+ 
Sbjct: 63  GRPFVGRAGQLLDRILAAVNLTRQDAYFTNIVKCRPPGNRAPEPDETAICTELWLEPQLA 122

Query: 184 LISPKILLFIGNKTKNFFFNNDAQKTYQNLGKW 216
           L+ P+++L +GN    +      Q   +  G+W
Sbjct: 123 LLRPRVILSLGNTPTQYLLGTR-QGITRTRGQW 154


>gi|282857034|ref|ZP_06266285.1| uracil-DNA glycosylase [Pyramidobacter piscolens W5455]
 gi|282585195|gb|EFB90512.1| uracil-DNA glycosylase [Pyramidobacter piscolens W5455]
          Length = 201

 Score = 73.6 bits (179), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/90 (36%), Positives = 52/90 (57%)

Query: 106 EGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRN 165
           E   LMI+G  P   +  +G+PF G++G +L ++L + E+ R +I I+ I    PP NRN
Sbjct: 41  ENASLMIVGEAPGAEEERTGRPFVGRSGRLLTEILAAAELKREEIFITSICKCRPPKNRN 100

Query: 166 LSNIEMEICRPIIMRQIELISPKILLFIGN 195
               E+  C P +  Q E I P+++L +GN
Sbjct: 101 PLKTEIAACLPWLTDQFEAIRPRLVLAVGN 130


>gi|331270600|ref|YP_004397092.1| uracil-DNA glycosylase [Clostridium botulinum BKT015925]
 gi|329127150|gb|AEB77095.1| uracil-DNA glycosylase [Clostridium botulinum BKT015925]
          Length = 185

 Score = 73.6 bits (179), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 81/181 (44%), Gaps = 6/181 (3%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           +L    R+   C+L    ++ +         LM IG  P   ++ +G+PF G+ G +L K
Sbjct: 6   DLYKECRACSKCNLGEVKINMVFGEGNPKAKLMFIGEAPGADEDRTGRPFVGRAGQLLTK 65

Query: 139 MLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT 197
            L ++ + R +  +I+ I    P  NRN    E   C P +  Q+ LI PKI++ +G   
Sbjct: 66  GLLALNLHRDKDYYITNICKCRPENNRNPMEDEAYACIPYLRNQVGLIKPKIIVCLGAIA 125

Query: 198 KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKA 257
             +  N+  + T ++ GKW N       I  +   HP  +++    K   W  L  +KK 
Sbjct: 126 GKYIINSGLKIT-RDRGKWIN----KKGIYIMPIFHPAAILRDDSKKALFWRDLKEIKKK 180

Query: 258 L 258
            
Sbjct: 181 F 181


>gi|257438681|ref|ZP_05614436.1| uracil-DNA glycosylase [Faecalibacterium prausnitzii A2-165]
 gi|257198865|gb|EEU97149.1| uracil-DNA glycosylase [Faecalibacterium prausnitzii A2-165]
          Length = 188

 Score = 73.6 bits (179), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 83/189 (43%), Gaps = 18/189 (9%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKM 139
           LK+   +   C LC+     +     +  +++ +G  P  S++  G PF G++G +LDK 
Sbjct: 6   LKAECLACRRCELCTDRTHVVFGQGVQTAEVLFVGEGPGQSEDEQGLPFVGRSGQLLDKY 65

Query: 140 LQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTK 198
           L +I++ R++  +I+ I    PP NR+    E E C P +  Q +L+ PKI++ +G    
Sbjct: 66  LFAIDLDRSKNCYIANIVKCRPPQNRDPLPTESEACMPWLREQFKLLQPKIVVCLGRIAS 125

Query: 199 NFFFNNDAQKT------YQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALI 252
                 D   T       Q  G W            + T HP  L++    K   +   +
Sbjct: 126 QRMIRTDFSVTKEHGTFVQKNGVW-----------FMGTFHPAALLRQAQNKPAAFADFV 174

Query: 253 TLKKALKNL 261
            L++ +  +
Sbjct: 175 ALREKIHEV 183


>gi|325107250|ref|YP_004268318.1| phage SPO1 DNA polymerase-related protein [Planctomyces
           brasiliensis DSM 5305]
 gi|324967518|gb|ADY58296.1| phage SPO1 DNA polymerase-related protein [Planctomyces
           brasiliensis DSM 5305]
          Length = 329

 Score = 73.6 bits (179), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 92/199 (46%), Gaps = 18/199 (9%)

Query: 48  SAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLC----STSLSTICAT 103
           SA  P +  R +++P++ +++   +++C    L SL      C  C     T   T+   
Sbjct: 116 SAEGPDSVTRFMNAPVLSRSE---RESC----LASLAERVAGCKRCPELARTRTQTVFGV 168

Query: 104 QTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGN 163
                ++M IG  P   ++  G+PF G+ G +L++++++    R +++I  I    PPGN
Sbjct: 169 GNPMAEVMFIGEAPGADEDKQGEPFVGRAGKLLNRIIEACGWEREELYICNILRCRPPGN 228

Query: 164 RNLSNIEMEICRPIIMRQIELISPKILLFIGN-KTKNFFFNNDAQKTYQNLGKWSNLCTP 222
           RN + IE   CR  +  QIE ++P+ ++  G    +N    N        +G+       
Sbjct: 229 RNPTPIEASHCREYLDGQIETVNPRFIVCWGTVAAQNLLGVNTP------IGRMRGKLYE 282

Query: 223 HSIIPTLATVHPQELIQYP 241
           +     L T HP  L++ P
Sbjct: 283 YGRSQVLCTYHPSYLLRNP 301


>gi|167045662|gb|ABZ10310.1| putative Uracil DNA glycosylase superfamily protein [uncultured
           marine crenarchaeote HF4000_APKG10L15]
          Length = 191

 Score = 73.6 bits (179), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 65/120 (54%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           SL  ++  ++    C+LC T  + +     +  D++ IG  P  +++  G+PF G  G  
Sbjct: 6   SLKIIQEKVKICKKCNLCFTRKNAVPGKGNQNADIVFIGEAPGKNEDQHGEPFIGTAGKK 65

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           L+  L+++ + R  ++I+ I    PP NR  ++IE  +C   +  +I +I+PKI+  +GN
Sbjct: 66  LNDALENVGLTRNSVYITNIVKCRPPNNRVPNDIEKAMCSNYLEDEIAIINPKIICLLGN 125


>gi|86609842|ref|YP_478604.1| uracil-DNA glycosylase [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86558384|gb|ABD03341.1| uracil-DNA glycosylase, family 4 [Synechococcus sp.
           JA-2-3B'a(2-13)]
          Length = 206

 Score = 73.6 bits (179), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 39/120 (32%), Positives = 62/120 (51%), Gaps = 1/120 (0%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
            L +LK        C L ++    +         ++IIG  P +S+++ G PF GK+G +
Sbjct: 10  DLEQLKQHCLVCQRCDLAASRTHVVVHRGNPKARILIIGEGPGESEDLQGLPFVGKSGQL 69

Query: 136 LDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           LDK+L S+ +   Q  +I  +    PP NR  +  EM+ CRP ++ QI L+ P I+L  G
Sbjct: 70  LDKILASVGLDPEQDTYICNVVKCRPPNNRVPTQEEMDACRPYLLEQIRLVDPWIILLTG 129


>gi|296125284|ref|YP_003632536.1| phage SPO1 DNA polymerase-related protein [Brachyspira murdochii
           DSM 12563]
 gi|296017100|gb|ADG70337.1| phage SPO1 DNA polymerase-related protein [Brachyspira murdochii
           DSM 12563]
          Length = 252

 Score = 73.6 bits (179), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 47/201 (23%), Positives = 90/201 (44%), Gaps = 17/201 (8%)

Query: 53  ITNIRHIHSPLVQQADSIAQKACSL------HELKSLLRSFHDC----HLCSTSLSTICA 102
           + N +     + ++  +I  K   L       +LK +      C     LC++ L+ +  
Sbjct: 30  LRNPKKAQQAVKKEEKNITNKGIELMKEIKNEDLKKIYNEVEKCMKCEALCNSRLNVVFG 89

Query: 103 TQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPG 162
              E  D++ +G  P   ++  G PF G+ G +LDK ++ + I + + +I       PP 
Sbjct: 90  RGDEEPDIVFVGEAPGADEDKQGLPFVGRGGKLLDKWIEKMNINKEKYYIMNALKCRPPE 149

Query: 163 NRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTP 222
           NR+    E   CR   +RQ+++++PKI+  +G        + D +  +   GK  N    
Sbjct: 150 NRDPLPEEKANCRDFFVRQLQILNPKIICALGRHGFGNLIDFDLKTPF---GKARNKVHY 206

Query: 223 HS----IIPTLATVHPQELIQ 239
           +S     +P +AT HP  +++
Sbjct: 207 YSNNGKDVPVIATYHPAYILR 227


>gi|221632240|ref|YP_002521461.1| phage DNA polymerase-like protein [Thermomicrobium roseum DSM 5159]
 gi|221155463|gb|ACM04590.1| phage DNA polymerase-related protein [Thermomicrobium roseum DSM
           5159]
          Length = 230

 Score = 73.6 bits (179), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 71/144 (49%), Gaps = 3/144 (2%)

Query: 65  QQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQ---DLMIIGYTPSDSD 121
           ++  +++++  +   L+S+      C  C    +   A   EG    ++M IG  P   +
Sbjct: 14  REEQTVSEERSARELLESIAERVRHCTRCDLWRTRTQAVPGEGDPHAEVMFIGEAPGYHE 73

Query: 122 NISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQ 181
           +  G+PF G  G  L+++L    + R Q++I+ +    PPGNR+    E+  C P +  Q
Sbjct: 74  DRQGRPFVGAAGQFLNELLGRAGLRREQVYITNVVKCRPPGNRDPLPDEIAACAPYLDEQ 133

Query: 182 IELISPKILLFIGNKTKNFFFNND 205
           I +I P +++ +G  +   +F N+
Sbjct: 134 IAVIRPSVIVTLGRYSMARWFPNE 157


>gi|222099134|ref|YP_002533702.1| Phage SPO1 DNA polymerase-related protein [Thermotoga neapolitana
           DSM 4359]
 gi|221571524|gb|ACM22336.1| Phage SPO1 DNA polymerase-related protein [Thermotoga neapolitana
           DSM 4359]
          Length = 192

 Score = 73.6 bits (179), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 39/163 (23%), Positives = 76/163 (46%), Gaps = 6/163 (3%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEGQ---DLMIIGYTPSDSDNISGKPFSGKTGNML 136
           ++++      C  C   L+       EG     ++ +G  P + ++ +G+PF G+ G +L
Sbjct: 9   METVKERVERCTACPLHLTRTNVVVGEGNLDTKIVFVGEGPGEEEDKTGRPFVGRAGMLL 68

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
            ++L  + I R  ++I  +    PP NR  +  EM  C   ++ QIE+I+P +++ +G  
Sbjct: 69  TELLNEVGIKREDVYICNVVKCRPPNNRTPTTEEMFACGHFLLAQIEIINPSVVVALGAT 128

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ 239
             +FF +       +  G   +      I+PT    HP  L++
Sbjct: 129 ALSFFMDGKKVSITKVRGNPMDWLGGKKIVPTF---HPSYLLR 168


>gi|326204226|ref|ZP_08194086.1| phage SPO1 DNA polymerase-related protein [Clostridium
           papyrosolvens DSM 2782]
 gi|325985737|gb|EGD46573.1| phage SPO1 DNA polymerase-related protein [Clostridium
           papyrosolvens DSM 2782]
          Length = 190

 Score = 73.6 bits (179), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 46/183 (25%), Positives = 86/183 (46%), Gaps = 5/183 (2%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           +L S   +  +C L  T  + +         +M IG  P + ++I G PF G  G +L+ 
Sbjct: 6   QLNSTCSNCRNCDLAGTRTNIVIGRGNPSAPIMFIGEGPGEQEDIQGLPFVGPAGQLLET 65

Query: 139 MLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTK 198
           +L++++    + +I+ +    PP NR  +  E E C P +  Q+ LI P+I++ +G+   
Sbjct: 66  LLEALKFKPDEYYIANVVKCRPPNNRVPNEEEAEKCLPYLRNQVSLIRPRIIVCLGSTAA 125

Query: 199 NFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
            +    D + T +  G+W        I+PT    HP  L++    K+  +  +  +KK +
Sbjct: 126 KYVVARDIKIT-KIRGQWIER-KKFWIMPTF---HPAALLRDQSKKELLFKDIKEVKKKI 180

Query: 259 KNL 261
             L
Sbjct: 181 NQL 183


>gi|254415738|ref|ZP_05029496.1| uracil-DNA glycosylase, family 4 [Microcoleus chthonoplastes PCC
           7420]
 gi|196177444|gb|EDX72450.1| uracil-DNA glycosylase, family 4 [Microcoleus chthonoplastes PCC
           7420]
          Length = 237

 Score = 73.6 bits (179), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 76/171 (44%), Gaps = 14/171 (8%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           S+  L         C L +T    +         +MIIG  P  +++  G PF G+ G +
Sbjct: 45  SMESLADHCNGCQRCELAATRTHAVVGRGNVHAPIMIIGEAPGQNEDEQGLPFVGRAGQL 104

Query: 136 LDKMLQSIEI-MRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           L+K+L ++++     ++I  ++   PPGNR  +  E+  C+P ++ QI L+ PKI+L  G
Sbjct: 105 LEKILAAVKLDSERDVYICNMNKCRPPGNRVPTPDEVAACKPYLLEQIRLVDPKIILLTG 164

Query: 195 NKTKNFFFNNDAQKTYQNLGKW----SNLCTPHSIIPTLATVHPQELIQYP 241
             T       + +   +  G W      LC P          HP  L++ P
Sbjct: 165 -ATAVKGLTGEKRGITKIRGTWMEWEGRLCMP--------IFHPAYLLRNP 206


>gi|295100441|emb|CBK97986.1| uracil-DNA glycosylase, family 4 [Faecalibacterium prausnitzii
           L2-6]
          Length = 188

 Score = 73.6 bits (179), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 46/183 (25%), Positives = 84/183 (45%), Gaps = 6/183 (3%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKM 139
           LK+   +   C L +T  + +     E  +++ +G  P  S++  G PF G++G +LDK 
Sbjct: 6   LKTDCLACQRCPLHTTRHNVVFGQGVENAEVLFVGEGPGQSEDEQGLPFVGRSGQLLDKY 65

Query: 140 LQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTK 198
           L +I++ R +  +I+ I    PP NR+    E E C P +  Q  L+ PKI++ +G    
Sbjct: 66  LFAIDLDRASNCYIANIVKCRPPQNRDPLPAESEACMPWLREQFRLLRPKIVVCLGRIAA 125

Query: 199 NFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
                 D   T ++          + I+  + T HP  L++ P  K   +   + L+  +
Sbjct: 126 QRMIRADFSVTKEH----GTFIEKNGIL-FMGTFHPAALLRQPQNKPEAFGDFVALRDKI 180

Query: 259 KNL 261
             +
Sbjct: 181 HEV 183


>gi|254455581|ref|ZP_05069010.1| uracil-DNA glycosylase, C-terminal domain protein [Candidatus
           Pelagibacter sp. HTCC7211]
 gi|207082583|gb|EDZ60009.1| uracil-DNA glycosylase, C-terminal domain protein [Candidatus
           Pelagibacter sp. HTCC7211]
          Length = 239

 Score = 73.2 bits (178), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 52/192 (27%), Positives = 94/192 (48%), Gaps = 1/192 (0%)

Query: 70  IAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFS 129
           +  KA  L +L+S + S  +C L   S + +         +M+IG  P   ++ SG  F 
Sbjct: 45  LGNKADLLKDLQSEINSIENCSLKDNSKNIVLGDGNINSPIMLIGEAPGIEEDKSGSTFK 104

Query: 130 GKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKI 189
           G+ G +L+KML +I I R  I+ S    + PP +R  + +E++     +   I +I+PKI
Sbjct: 105 GEIGELLNKMLLAIGIKRQNIYCSYAINFRPPEDRKPTTLEIKRYSVFLKEHISIINPKI 164

Query: 190 LLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWH 249
           ++ +G+         + + + +  GKW      +   P + + +P  LI++P  KK +W 
Sbjct: 165 IILMGSSAMEAVTGINTKISSER-GKWKETILKNKTYPVMISFNPSYLIRFPENKKYSWE 223

Query: 250 ALITLKKALKNL 261
            L  +KK +  L
Sbjct: 224 DLKKIKKKIAEL 235


>gi|206901596|ref|YP_002251107.1| DNA polymerase, bacteriophage-type [Dictyoglomus thermophilum
           H-6-12]
 gi|206740699|gb|ACI19757.1| DNA polymerase, bacteriophage-type [Dictyoglomus thermophilum
           H-6-12]
          Length = 210

 Score = 73.2 bits (178), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 65/126 (51%), Gaps = 3/126 (2%)

Query: 72  QKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQ---DLMIIGYTPSDSDNISGKPF 128
           ++   + EL+ L R   +C  CS           EG     +M IG  P   ++  G+PF
Sbjct: 2   ERLTKIDELEILRREAENCKNCSLWQQRTNLVFGEGNPNSSIMFIGEAPGFHEDQQGRPF 61

Query: 129 SGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPK 188
            G  G +L ++++S+ + R  I+I+ +    PP NR     E++ C P + RQIE+I+PK
Sbjct: 62  VGAAGRLLTELIESMGLKREDIYIANVLKCRPPNNREPLPEEIKACFPFLRRQIEIINPK 121

Query: 189 ILLFIG 194
           ++  +G
Sbjct: 122 VICTLG 127


>gi|147669059|ref|YP_001213877.1| phage SPO1 DNA polymerase-related protein [Dehalococcoides sp.
           BAV1]
 gi|146270007|gb|ABQ16999.1| phage SPO1 DNA polymerase-related protein [Dehalococcoides sp.
           BAV1]
          Length = 206

 Score = 73.2 bits (178), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 69/135 (51%), Gaps = 7/135 (5%)

Query: 77  LHELKSLLRSFH----DCHLCSTSLSTICATQTEGQ---DLMIIGYTPSDSDNISGKPFS 129
           +H+ + LL+  +     C  C+   +  C+   EG     +M IG  P  +++  G+PF 
Sbjct: 1   MHDKEELLKGIYIEIARCVRCNLHTTRTCSVPGEGNADAKIMFIGEAPGFNEDQQGRPFV 60

Query: 130 GKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKI 189
           G  G  L +++ SI + R  ++I+ +    PPGNR+    E+  C   + RQIE+I PKI
Sbjct: 61  GAAGKFLTELICSIGLTREDVYITNVVKDRPPGNRDPLPDEISACCNFLDRQIEIIKPKI 120

Query: 190 LLFIGNKTKNFFFNN 204
           ++ +G  +   +F  
Sbjct: 121 IVTLGRFSMARYFTG 135


>gi|256826607|ref|YP_003150566.1| uracil-DNA glycosylase, family 4 [Cryptobacterium curtum DSM 15641]
 gi|256582750|gb|ACU93884.1| uracil-DNA glycosylase, family 4 [Cryptobacterium curtum DSM 15641]
          Length = 195

 Score = 73.2 bits (178), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 60/124 (48%), Gaps = 3/124 (2%)

Query: 80  LKSLLRSFHDCHLC---STSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L+SL R    CH C       + +         ++IIG  P  ++++ G+PF G  G  L
Sbjct: 8   LESLRRQVEACHACPLWQGRTNVVFGAGNPQARILIIGEAPGKNEDLQGEPFVGAAGKKL 67

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
           D +L+  ++ R  + I+ +    PP NRN    E+  C P +  Q   I+P+ ++ +GN 
Sbjct: 68  DALLEIADLARDDVFIANVLKCRPPSNRNPLPEEITACAPFLREQTRTINPEFIVTLGNF 127

Query: 197 TKNF 200
           +  F
Sbjct: 128 STKF 131


>gi|55379408|ref|YP_137258.1| uracil DNA glycosylase superfamily protein [Haloarcula marismortui
           ATCC 43049]
 gi|55232133|gb|AAV47552.1| uracil DNA glycosylase superfamily protein [Haloarcula marismortui
           ATCC 43049]
          Length = 195

 Score = 73.2 bits (178), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 39/163 (23%), Positives = 74/163 (45%), Gaps = 2/163 (1%)

Query: 91  HLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQI 150
            LC +    +        DL+ +G  P  +++  G+PF G++G++LD  L+   + R  +
Sbjct: 17  DLCGSRSRIVNGVGPADADLLFVGEAPGANEDEQGEPFVGRSGDVLDAGLRDAGLDRGDV 76

Query: 151 HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTY 210
            I+      PP NR+  N E+  CR  +  +I+ + P++++ +G          D   T 
Sbjct: 77  RITNCVRCRPPDNRDPRNGELANCRDYLETEIDRVDPEVVVTLGKVPAEHLLERDVAVTG 136

Query: 211 QNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALIT 253
           +  G   ++         L +VHP   +  P  +K T+ A +T
Sbjct: 137 E-AGDVFDVAIAGQPRRVLVSVHPAATLYDP-SQKETFEAALT 177


>gi|73748279|ref|YP_307518.1| putative uracil-DNA glycosylase [Dehalococcoides sp. CBDB1]
 gi|73659995|emb|CAI82602.1| putative uracil-DNA glycosylase [Dehalococcoides sp. CBDB1]
          Length = 206

 Score = 72.8 bits (177), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 69/135 (51%), Gaps = 7/135 (5%)

Query: 77  LHELKSLLRSFH----DCHLCSTSLSTICATQTEGQ---DLMIIGYTPSDSDNISGKPFS 129
           +H+ + LL+  +     C  C+   +  C+   EG     +M IG  P  +++  G+PF 
Sbjct: 1   MHDKEELLKGIYIEIARCVRCNLHTTRTCSVPGEGNADAKIMFIGEAPGFNEDQQGRPFV 60

Query: 130 GKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKI 189
           G  G  L +++ SI + R  ++I+ +    PPGNR+    E+  C   + RQIE+I PKI
Sbjct: 61  GAAGKFLTELICSIGLTREDVYITNVVKDRPPGNRDPLPDEISACCNFLDRQIEIIKPKI 120

Query: 190 LLFIGNKTKNFFFNN 204
           ++ +G  +   +F  
Sbjct: 121 IVTLGRFSMARYFTG 135


>gi|87306738|ref|ZP_01088885.1| DNA polymerase, bacteriophage-type [Blastopirellula marina DSM
           3645]
 gi|87290917|gb|EAQ82804.1| DNA polymerase, bacteriophage-type [Blastopirellula marina DSM
           3645]
          Length = 282

 Score = 72.8 bits (177), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 73/178 (41%), Gaps = 9/178 (5%)

Query: 78  HELKSLLRSFHDCHLCS----TSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTG 133
            +L  L      C LC     T   T+         +   G  P   ++  G+PF G+ G
Sbjct: 95  QQLDVLAAEVAKCVLCEELACTRTQTVFGVGNPNARICFFGEAPGADEDKQGEPFVGRAG 154

Query: 134 NMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFI 193
            +L +++++    R  ++I       PPGNRN +  E   C P   +Q+ +I P  ++ +
Sbjct: 155 KLLTQIIEACTFQREDVYILNTLKCRPPGNRNPTPEENANCMPYFEQQLAIIQPDYIVCL 214

Query: 194 GNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
           G      F   +  KT   +GK       +     +AT HP  L++ P  K+  W  +
Sbjct: 215 GK-----FAAQNLLKTETAIGKLRGQFHDYGGAKVIATYHPAYLLRNPAAKREVWEDM 267


>gi|14520900|ref|NP_126375.1| hypothetical protein PAB0474 [Pyrococcus abyssi GE5]
 gi|5458117|emb|CAB49606.1| Thermostable uracil-DNA glycosylase [Pyrococcus abyssi GE5]
          Length = 196

 Score = 72.8 bits (177), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 70/135 (51%)

Query: 70  IAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFS 129
           +A K   + +L+  +R+   C L     + +    +    +M +G  P   ++  G PF 
Sbjct: 1   MASKEELMKKLEEKIRNCKKCPLWQLRTNPVPGDGSYDAKVMFVGEAPGYWEDQQGLPFV 60

Query: 130 GKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKI 189
           GK G +LD++L+ I + R +++I+ I    PP NR+ +  E++ C P +  QI++I P+I
Sbjct: 61  GKAGKVLDELLKGIGLNRREVYITNIVKCRPPNNRDPTEEEIKACAPYLDAQIDIIRPRI 120

Query: 190 LLFIGNKTKNFFFNN 204
           ++ +G  +  +    
Sbjct: 121 IVTLGRFSMGYILRK 135


>gi|289432328|ref|YP_003462201.1| phage SPO1 DNA polymerase-related protein [Dehalococcoides sp. GT]
 gi|288946048|gb|ADC73745.1| phage SPO1 DNA polymerase-related protein [Dehalococcoides sp. GT]
          Length = 206

 Score = 72.8 bits (177), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 69/135 (51%), Gaps = 7/135 (5%)

Query: 77  LHELKSLLRSFH----DCHLCSTSLSTICATQTEGQ---DLMIIGYTPSDSDNISGKPFS 129
           +H+ + LL+  +     C  C+   +  C+   EG     +M IG  P  +++  G+PF 
Sbjct: 1   MHDKEELLKGIYIEIARCVRCNLHTTRTCSVPGEGNADAKIMFIGEAPGFNEDQQGRPFV 60

Query: 130 GKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKI 189
           G  G  L +++ SI + R  ++I+ +    PPGNR+    E+  C   + RQIE+I PKI
Sbjct: 61  GAAGKFLTELICSIGLTREDVYITNVVKDRPPGNRDPLPDEISACCNFLDRQIEIIKPKI 120

Query: 190 LLFIGNKTKNFFFNN 204
           ++ +G  +   +F  
Sbjct: 121 IVTLGRFSMARYFTG 135


>gi|260654952|ref|ZP_05860440.1| uracil-DNA glycosylase [Jonquetella anthropi E3_33 E1]
 gi|260630267|gb|EEX48461.1| uracil-DNA glycosylase [Jonquetella anthropi E3_33 E1]
          Length = 208

 Score = 72.8 bits (177), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 70/136 (51%)

Query: 69  SIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPF 128
           S+ ++   L +L   +     C LC T  ST+    +    LMI+G  P   ++  G+PF
Sbjct: 12  SLERRMDLLRQLNQEVGGCSRCGLCETRHSTVPGEGSGENGLMIVGEGPGADEDEQGRPF 71

Query: 129 SGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPK 188
            G+ G +L ++LQ+  I R++  I+ +    PP NR     E+  C+  +  Q+ L+ PK
Sbjct: 72  VGRAGQLLSQILQAAGIDRSRSWITNVVKCRPPKNRTPQIEEVLACQDWLEAQLILLQPK 131

Query: 189 ILLFIGNKTKNFFFNN 204
           +++ +GN    +F ++
Sbjct: 132 VIVSMGNTPTKWFLHS 147


>gi|113955244|ref|YP_730877.1| uracil-DNA glycosylase [Synechococcus sp. CC9311]
 gi|113882595|gb|ABI47553.1| Uracil-DNA glycosylase [Synechococcus sp. CC9311]
          Length = 201

 Score = 72.8 bits (177), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 79/180 (43%), Gaps = 10/180 (5%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           SL +LK+       C L       + +       LM+IG  P   ++  G+PF G++G +
Sbjct: 4   SLEDLKASCLQCQRCDLAKERKHVVVSRGHPSARLMVIGEAPGADEDAQGRPFVGRSGRL 63

Query: 136 LDKMLQSIEIMRT-QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           LD  L  + + +    +I  +    PPGNR  +  E++ CRP + RQI  ++P+IL  +G
Sbjct: 64  LDACLTEVGLDQADDTYICNLIKCRPPGNRRPTPAELKACRPWLDRQILEVNPEILFILG 123

Query: 195 NKTKNFFF--NNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALI 252
                          +   +  +W   C    ++P+    HP  L++ P  +    H+L 
Sbjct: 124 ATATATLLECRTPISRLRGHWTEWKGRC----VMPSF---HPSYLLRNPSREPGKPHSLF 176


>gi|71483068|gb|AAZ32501.1| uracil DNA glycosylase [uncultured euryarchaeote Alv-FOS4]
          Length = 196

 Score = 72.4 bits (176), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 46/183 (25%), Positives = 78/183 (42%), Gaps = 5/183 (2%)

Query: 82  SLLRSFHDCHLCSTSLSTICATQTEG---QDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           SL     +C  C    +   A   EG   + +M +G  P   ++I G+PF G  G  LD+
Sbjct: 14  SLDDKIRECKKCGLWKTRTHAVPGEGGFRKKVMFVGEAPGKWEDIKGRPFVGAAGKYLDE 73

Query: 139 MLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTK 198
           +L +I + R  ++I+ I    PP NR+ ++ E+  C P +  QIE + P+++  +G  + 
Sbjct: 74  LLATIGLSRDDVYITNIVKCRPPNNRDPTDEEIRACAPYLEWQIEHMRPRVICPLGRFSA 133

Query: 199 NFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
            F                  +     II  +   HP   + +   K     A  TLK  L
Sbjct: 134 KFILEKFGFTMKSITAAQGKIYRGDIII--IPMFHPAAALYHGKWKPELEKAFATLKSVL 191

Query: 259 KNL 261
            ++
Sbjct: 192 DDM 194


>gi|147918737|ref|YP_687540.1| uracil-DNA glycosylase superfamily protein [uncultured methanogenic
           archaeon RC-I]
 gi|110622936|emb|CAJ38214.1| predicted uracil-DNA glycosylase superfamily protein [uncultured
           methanogenic archaeon RC-I]
          Length = 185

 Score = 72.4 bits (176), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 75/171 (43%), Gaps = 8/171 (4%)

Query: 90  CHLCSTSLSTICATQTEG---QDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIM 146
           C  C  SLS        G     +M+IG  P  +++  GKPF G  G +L+ +L+S  I 
Sbjct: 17  CPRCDLSLSRTNVVIGSGPLDARIMLIGEAPGRNEDKQGKPFVGAAGKVLNLVLESAGIR 76

Query: 147 RTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDA 206
           R  ++I+ +    PP NR     E+E C   + +Q+E+ISPK+++ +G      +     
Sbjct: 77  RDDVYIANVVKCRPPENRVPKKDEIEACSVYLKKQLEVISPKVVVLLGKTAAESYLGRKV 136

Query: 207 QKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKA 257
                 +G+       H     + T HP  +I    +K         ++KA
Sbjct: 137 V-----MGEEHGKPFKHEDRTVVITYHPAAIIYNRKLKDALESDFKVIRKA 182


>gi|146339650|ref|YP_001204698.1| putative Uracil-DNA glycosylase [Bradyrhizobium sp. ORS278]
 gi|146192456|emb|CAL76461.1| Putative Uracil-DNA glycosylase [Bradyrhizobium sp. ORS278]
          Length = 493

 Score = 72.4 bits (176), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 48/189 (25%), Positives = 86/189 (45%), Gaps = 13/189 (6%)

Query: 60  HSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSD 119
           H+P  + +  +  +A  L  L+    +   C L   +  T+     E   LM++G  P D
Sbjct: 282 HAPAAETSRDV--EAVDLQTLREEAAACRACPLWKDATQTVFGEGPEHAPLMLVGEQPGD 339

Query: 120 SDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMIS---PWHPPGNRNL----SNIEME 172
            ++++G PF G  G MLD+ L    I R++++++       + P G   L    +  E++
Sbjct: 340 KEDLAGHPFVGPAGQMLDRALAEAGIDRSKVYVTNAVKHFKFVPRGKIRLHQKPATPEIK 399

Query: 173 ICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATV 232
            CRP   R++  + P +++ +G       F    Q T +N G   +L  P      + TV
Sbjct: 400 ACRPWYERELAAVQPALVVAMGASAAQAVFGKITQVT-KNRGHIVDL--PEG-AQAMITV 455

Query: 233 HPQELIQYP 241
           HP  L++ P
Sbjct: 456 HPSYLLRLP 464


>gi|116327183|ref|YP_796903.1| Uracil-DNA glycosylase [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116332165|ref|YP_801883.1| Uracil-DNA glycosylase [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
 gi|116119927|gb|ABJ77970.1| Uracil-DNA glycosylase [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116125854|gb|ABJ77125.1| Uracil-DNA glycosylase [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
          Length = 202

 Score = 72.0 bits (175), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 48/194 (24%), Positives = 86/194 (44%), Gaps = 21/194 (10%)

Query: 73  KACSLHELKSLLRSFHDCHLC---STSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFS 129
           K   L  L  +      C LC   +T   T+         ++ IG  P   ++++G+PF 
Sbjct: 3   KEEKLRRLDLIQSEVFACKLCKLHTTRTRTVFGEGNPDSKVVFIGEGPGKQEDLTGRPFV 62

Query: 130 GKTGNMLDKMLQ-SIEIMRTQIHISMISPWHP------PGNRNLSNIEMEICRPIIMRQI 182
           G+ G +L ++++  +++ R  ++I+ I    P        +R   + E   C P ++RQ+
Sbjct: 63  GRAGELLTRIIEKGMKVPRESVYIANIVKCRPTVDMKFEKDRPPEDEETRACAPYLLRQL 122

Query: 183 ELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ--- 239
           E+I PK+++ +GN +  F  N     T    G W         IP + T HP  +I+   
Sbjct: 123 EIIQPKVIVTLGNPSTRFILNTKEGITKLR-GTWGTFFG----IPVMPTYHPSFVIRNGG 177

Query: 240 --YPLIKKNTWHAL 251
              PL K+  W  +
Sbjct: 178 ENSPL-KREVWEDI 190


>gi|118445103|ref|YP_879168.1| phage SPO1 DNA polymerase-related protein [Clostridium novyi NT]
 gi|118135559|gb|ABK62603.1| phage SPO1 DNA polymerase-related protein [Clostridium novyi NT]
          Length = 190

 Score = 72.0 bits (175), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 78/170 (45%), Gaps = 6/170 (3%)

Query: 88  HDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR 147
           H+C L       +        +LM IG  P   ++ +GKPF GK G +L K L ++++ R
Sbjct: 20  HNCELGDKRTHMVFGEGNPKANLMFIGEAPGADEDRTGKPFVGKAGQLLTKGLMALDLYR 79

Query: 148 TQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDA 206
            +  +I+ I    P  NRN  + E   C   +  Q+ LI PKI++ +G  +  +  + D 
Sbjct: 80  DRDYYITNICKCRPENNRNPMDHEAYACIQYLRNQVALIKPKIIVCLGAVSGKYIIDKDL 139

Query: 207 QKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
           + T ++ GKW         +  +   HP  +++    K   W  L  +K+
Sbjct: 140 RIT-RDRGKW----IEKKGVYIMPIFHPAAILRDDNKKPLFWGDLKEIKR 184


>gi|313127470|ref|YP_004037740.1| uracil-DNA glycosylase, family 4 [Halogeometricum borinquense DSM
           11551]
 gi|312293835|gb|ADQ68295.1| uracil-DNA glycosylase, family 4 [Halogeometricum borinquense DSM
           11551]
          Length = 200

 Score = 72.0 bits (175), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 37/153 (24%), Positives = 74/153 (48%), Gaps = 2/153 (1%)

Query: 109 DLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSN 168
           DL+ +G  P  +++  G+PF G++G++LD  L+ + + R+ + I+      PP NR+ + 
Sbjct: 37  DLVFLGEAPGANEDEQGEPFVGRSGSVLDDALRDVGLARSDVRITNCVRCRPPENRDPTK 96

Query: 169 IEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPT 228
            E+  CR  + R++EL+ P +++ +G        +     T +  G   ++     +   
Sbjct: 97  TELGNCRGYLERELELLDPDLVVTLGKVPSEHLLDRSVAVTKE-AGDVVDVRLGERLQRV 155

Query: 229 LATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
           L  VHP   + Y   +++T+   I     L  L
Sbjct: 156 LICVHPAATL-YDRSQRDTFSDTIARAADLSGL 187


>gi|282163588|ref|YP_003355973.1| uracil-DNA glycosylase [Methanocella paludicola SANAE]
 gi|282155902|dbj|BAI60990.1| uracil-DNA glycosylase [Methanocella paludicola SANAE]
          Length = 182

 Score = 72.0 bits (175), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 66/152 (43%), Gaps = 8/152 (5%)

Query: 90  CHLCSTSLSTICATQTEG---QDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIM 146
           C  C   LS        G     +M+IG  P  +++  G+PF G  G  L+++L+   I 
Sbjct: 14  CPRCDLKLSRTNVVVGSGPINAKIMLIGEAPGKNEDKQGQPFVGAAGRNLNELLEEAGID 73

Query: 147 RTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDA 206
           R  ++I+ I    PP NR   + E+E C P + +QIE+I PK ++ +G            
Sbjct: 74  RKDVYITNIVKCRPPENRPPFDYEVEACHPYLQKQIEVIGPKGIVLLGKTAAETMLGRKV 133

Query: 207 QKTYQNLGKWSNLCTPHSIIPTLATVHPQELI 238
           +     +GK             L T HP  +I
Sbjct: 134 E-----MGKEHGTVVEKDGHRYLITYHPAAMI 160


>gi|157363942|ref|YP_001470709.1| phage SPO1 DNA polymerase-related protein [Thermotoga lettingae
           TMO]
 gi|157314546|gb|ABV33645.1| phage SPO1 DNA polymerase-related protein [Thermotoga lettingae
           TMO]
          Length = 194

 Score = 72.0 bits (175), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 44/172 (25%), Positives = 80/172 (46%), Gaps = 9/172 (5%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C L +T  + +         +M +G  P + ++ +G+PF G+ G +L K+L+S+ I R  
Sbjct: 20  CPLFNTRTNVVVGEGNLYAPIMFVGEGPGEEEDKTGRPFVGRAGQLLTKILESVNIDRED 79

Query: 150 IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKT 209
           ++I  I    PP NR     E + C   +M QI ++ P I++ +G+   +FF   +   T
Sbjct: 80  VYICNIVKCRPPENRVPKAEEQKACGHYLMAQIMIVDPAIIVPLGSTALSFFLGQNVSIT 139

Query: 210 YQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKN-----TWHALITLKK 256
            +  GK  +      + P     HP  L++ P   K      TW  +  +++
Sbjct: 140 -EFRGKELDWKAGKKLFPMF---HPSYLLRNPSKAKGSPKDLTWQDIKKVRE 187


>gi|187251249|ref|YP_001875731.1| Uracil-DNA glycosylase [Elusimicrobium minutum Pei191]
 gi|186971409|gb|ACC98394.1| Uracil-DNA glycosylase [Elusimicrobium minutum Pei191]
          Length = 297

 Score = 72.0 bits (175), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 54/208 (25%), Positives = 88/208 (42%), Gaps = 27/208 (12%)

Query: 71  AQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSG 130
           + K   L+ L   + +   C L  T L+ +         LM IG  P   ++  G+PF G
Sbjct: 88  SNKEAELNALAEQILTCKKCPLGETRLNAVPGEGNADAKLMFIGEGPGFDEDHQGRPFIG 147

Query: 131 KTGNMLDKMLQSIEIMRTQIHISMISPWHP---PGN-------RNLSNIEMEICRPIIMR 180
           + G +L KM++++ + R ++ I+ +   HP   P N       R  S  E+  CR  I  
Sbjct: 148 RAGTLLTKMIEAMGLKREEVFIANMVKCHPMTDPSNPEKHGNDRAPSKEEIAYCRKYIEA 207

Query: 181 QIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSI----------IPTLA 230
           QI LI P+ ++ +G             K   +LG   N    H++             +A
Sbjct: 208 QIALIQPEFIVALGGVAAKSLI-----KDADSLGALRNKV--HTLELDNFDLEGKTKIVA 260

Query: 231 TVHPQELIQYPLIKKNTWHALITLKKAL 258
           T HP  L++ P  KK+ W  L  + K +
Sbjct: 261 TYHPAALLRNPNWKKDAWADLQMVMKEM 288


>gi|182415672|ref|YP_001820738.1| phage SPO1 DNA polymerase-related protein [Opitutus terrae PB90-1]
 gi|177842886|gb|ACB77138.1| phage SPO1 DNA polymerase-related protein [Opitutus terrae PB90-1]
          Length = 327

 Score = 72.0 bits (175), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 72/158 (45%), Gaps = 17/158 (10%)

Query: 110 LMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPP-------- 161
           +M +G  P   + I G+PF G  G +L KM+ ++ + R +++I  I  W P         
Sbjct: 155 IMFVGEAPGAEEEIQGEPFVGPAGQLLTKMIGAMGLRRDEVYIGNIMNWRPEMPVSASGV 214

Query: 162 --GNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNL-GKWSN 218
             GNR  +  EM  C P +  QIE+++P++L+ +G+          + K    + G+W  
Sbjct: 215 QYGNRPPNGEEMNYCLPYLRAQIEIVNPEVLVALGSTAAQGLLGIGSFKALGEVRGRWHT 274

Query: 219 LCTPHSIIPTLATVHPQELI--QYPLIKKNTWHALITL 254
                   P + T HP  ++  Q    K+  W  L+ +
Sbjct: 275 FAD----KPLMVTYHPSYILRNQSNRSKRMIWEDLLKV 308


>gi|73669315|ref|YP_305330.1| DNA polymerase [Methanosarcina barkeri str. Fusaro]
 gi|72396477|gb|AAZ70750.1| DNA polymerase [Methanosarcina barkeri str. Fusaro]
          Length = 181

 Score = 71.6 bits (174), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 59/112 (52%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C L  +++  +    +    +  IG  P   +N +G PF G+ G  LDKM++ + +    
Sbjct: 20  CPLHKSAIKRVIGKGSCNPKVFFIGEAPGKRENETGIPFYGRAGKKLDKMIEYMGLSEED 79

Query: 150 IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFF 201
             ++     HPP NR  S  E+E C+P ++ QI L++PKI++ +GN  +  F
Sbjct: 80  WMVTNTVKCHPPENRRPSINEIECCKPFLLSQIILLNPKIIILLGNTAEKSF 131


>gi|217967775|ref|YP_002353281.1| phage SPO1 DNA polymerase-related protein [Dictyoglomus turgidum
           DSM 6724]
 gi|217336874|gb|ACK42667.1| phage SPO1 DNA polymerase-related protein [Dictyoglomus turgidum
           DSM 6724]
          Length = 210

 Score = 71.6 bits (174), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 43/149 (28%), Positives = 68/149 (45%), Gaps = 14/149 (9%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQD---LMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L+ L R    C  CS           EG     +M +G  P   ++  GKPF G  G +
Sbjct: 9   KLEILRREAEGCRNCSLWQERTNLVFGEGNPDAFIMFVGEAPGFHEDQQGKPFVGAAGKL 68

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           L ++++SI + R  ++I+ +    PP NR     E+ +C P + +QIE+I+PKI+  +G 
Sbjct: 69  LTELIESIGLKREDVYIANVLKCRPPNNREPLPEEIRVCFPFLRQQIEIINPKIICTLGR 128

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHS 224
                         Y  LG   N+ T H 
Sbjct: 129 YA-----------AYAILGHSVNISTSHG 146


>gi|57234761|ref|YP_181181.1| uracil-DNA glycosylase, putative [Dehalococcoides ethenogenes 195]
 gi|57225209|gb|AAW40266.1| uracil-DNA glycosylase, putative [Dehalococcoides ethenogenes 195]
          Length = 189

 Score = 71.6 bits (174), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/118 (30%), Positives = 62/118 (52%), Gaps = 5/118 (4%)

Query: 92  LCSTSLSTICATQTEGQD-----LMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIM 146
           +C+ +L T       G+      +M IG  P  +++  G+PF G  G  L +++ SI + 
Sbjct: 1   MCTFNLHTTRTHAVPGEGNADAKIMFIGEAPGFNEDQQGRPFVGAAGKFLTELIHSIGLR 60

Query: 147 RTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNN 204
           R  ++I+ +    PPGNR+    E+  CR  + RQIE+I PKI++ +G  +   +F  
Sbjct: 61  REDVYITNVVKDRPPGNRDPLPDEISACRNFLDRQIEIIKPKIIVTLGRYSMARYFTG 118


>gi|87125791|ref|ZP_01081634.1| Uracil-DNA glycosylase [Synechococcus sp. RS9917]
 gi|86166600|gb|EAQ67864.1| Uracil-DNA glycosylase [Synechococcus sp. RS9917]
          Length = 341

 Score = 71.6 bits (174), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 59/117 (50%), Gaps = 1/117 (0%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKM 139
           L +  R    C L  +    + +  +    LM+IG  P  S++  G+PF G++G +LD++
Sbjct: 150 LATACRQCQACDLAGSRRQVVISRGSAAAPLMLIGEAPGASEDAEGRPFVGRSGRLLDQL 209

Query: 140 LQSIEIMRT-QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           L+         ++I       PPGNR     E+  CRP + +QI L++P ++  +G+
Sbjct: 210 LRETGFNPDHDLYICNAVKCRPPGNRKPKRQELAACRPWLEQQIALVNPAVVALLGS 266


>gi|118578530|ref|YP_899780.1| phage SPO1 DNA polymerase-like protein [Pelobacter propionicus DSM
           2379]
 gi|118501240|gb|ABK97722.1| phage SPO1 DNA polymerase-related protein [Pelobacter propionicus
           DSM 2379]
          Length = 264

 Score = 71.6 bits (174), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 39/164 (23%), Positives = 77/164 (46%), Gaps = 5/164 (3%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           SL  ++S L     C L +T    +  T      L+  G  P   +++ G+PF G+ G +
Sbjct: 73  SLEIIRSDLGECQRCKLGATRTHLVFGTGNPRARLVFAGEGPGRDEDLQGEPFVGEAGQV 132

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           L++++ ++ + R  ++I  +    PPGNR+    E+  C   ++RQ+  I+P++++ +G 
Sbjct: 133 LNRIITAMGLKREDVYICNLVKCRPPGNRDPEADEIAACSTFLLRQLRSINPEVIVALGK 192

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ 239
                F       T + + +          IP + T HP  L++
Sbjct: 193 -----FAAQTLLATKEPISRLRGTFGEFHGIPLMPTFHPSYLLR 231


>gi|282856757|ref|ZP_06266018.1| uracil-DNA glycosylase family 4 protein [Pyramidobacter piscolens
           W5455]
 gi|282585380|gb|EFB90687.1| uracil-DNA glycosylase family 4 protein [Pyramidobacter piscolens
           W5455]
          Length = 205

 Score = 71.6 bits (174), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 76/155 (49%), Gaps = 2/155 (1%)

Query: 63  LVQQADSIAQKACSLHEL-KSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSD 121
           ++ QA    Q+  +L++L +        C LC +  + +    +    +M +G  P + +
Sbjct: 4   MISQAQRSPQERTALYQLLRDAANRCEQCGLCRSRKNVVVGEGSLTSRIMFVGEGPGEVE 63

Query: 122 NISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQ 181
           + SG+PF G  G +L ++L++ +  R  ++I+ I    PP NR     E+  C+  +  Q
Sbjct: 64  DNSGRPFVGPAGQLLTRILEAAKFSRDDVYITNIVKCRPPNNRVPEIEEVLSCQRWLEAQ 123

Query: 182 IELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKW 216
           I L+ P+I++ +GN    +F +     T    G+W
Sbjct: 124 IALLQPQIIVCLGNTPLKWFLHGTEGITKMR-GRW 157


>gi|254432687|ref|ZP_05046390.1| bacteriophage-type DNA polymerase N-terminal domain protein
           [Cyanobium sp. PCC 7001]
 gi|197627140|gb|EDY39699.1| bacteriophage-type DNA polymerase N-terminal domain protein
           [Cyanobium sp. PCC 7001]
          Length = 243

 Score = 71.6 bits (174), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 77/177 (43%), Gaps = 14/177 (7%)

Query: 92  LCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ-I 150
           L +T    + +       LM+IG  P   ++ SG+PF G+ G +LD+ML S+ I   +  
Sbjct: 59  LAATRQHVVVSRGDPAARLMVIGEGPGAQEDASGQPFVGRAGQLLDQMLASVGIDSNRDA 118

Query: 151 HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTY 210
           +I  +    PP NR  +  EM  CRP + RQI+L  P ++L  G              T 
Sbjct: 119 YICNVVKCRPPENRKPTPAEMAACRPWLDRQIQLNDPAVILLAGATAMEGVLGVKGGITR 178

Query: 211 QNLGKWSNLCTP----HSIIPTLATVHPQELIQYPLIKKN-----TWHALITLKKAL 258
              G+W     P      ++P     HP  L++ P  +       TW  L  +++ L
Sbjct: 179 LR-GQWRQGSGPVLAGRWLMPIF---HPSYLLRNPSRQSGSPKWLTWQDLQDVRRRL 231


>gi|77164595|ref|YP_343120.1| Phage SPO1 DNA polymerase-related protein [Nitrosococcus oceani
           ATCC 19707]
 gi|254433152|ref|ZP_05046660.1| uracil-DNA glycosylase, family 4 [Nitrosococcus oceani AFC27]
 gi|76882909|gb|ABA57590.1| Phage SPO1 DNA polymerase-related protein [Nitrosococcus oceani
           ATCC 19707]
 gi|207089485|gb|EDZ66756.1| uracil-DNA glycosylase, family 4 [Nitrosococcus oceani AFC27]
          Length = 189

 Score = 71.2 bits (173), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 83/175 (47%), Gaps = 22/175 (12%)

Query: 68  DSIAQKACSLHELKSLLRSFHDCHLCSTSLST--------ICATQTEGQDLMIIGYTPSD 119
           D   +KA +L ELK     +H    C  SL          +        ++MIIG  P  
Sbjct: 2   DDFLEKAVTLQELK-----WH----CERSLGPEVPKGEKLVFGEGPSPAEIMIIGEAPGV 52

Query: 120 SDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIM 179
            +  +G+PF G +G +L ++L  I + R  ++IS I   HPPGNR     E++   P ++
Sbjct: 53  QEAKTGRPFVGSSGKLLTQLLHQIGLKREHVYISNILKTHPPGNRKPYRSEIKRELPFLL 112

Query: 180 RQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHP 234
           RQIEL+ P++L+ +G        +  A+ T    G+W  +      +PT  T HP
Sbjct: 113 RQIELLQPQLLILLGATALQALLDPKAKITALR-GQWVEVKK----LPTFVTYHP 162


>gi|300311462|ref|YP_003775554.1| uracil-DNA glycosylase [Herbaspirillum seropedicae SmR1]
 gi|300074247|gb|ADJ63646.1| uracil-DNA glycosylase protein [Herbaspirillum seropedicae SmR1]
          Length = 340

 Score = 71.2 bits (173), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 74/178 (41%), Gaps = 8/178 (4%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           +LK  +     C LC     T+     E    + IG  P  +++I G+PF G  G +LD 
Sbjct: 154 QLKEQVADCRRCGLCQGRKKTVFGVGDEKAKWLFIGEGPGRNEDIQGEPFVGPAGKLLDN 213

Query: 139 MLQSIEIMRTQ-IHISMISPWHPPG----NRNLSNIEMEICRPIIMRQIELISPKILLFI 193
           ML S+ + R    +I+ I    P      +R  S  E+  C P + RQIELI P +L+ +
Sbjct: 214 MLVSMGVKRGDNAYIANIVKCRPTDENGRDRPPSPQEVASCLPYLQRQIELIQPTVLVAL 273

Query: 194 GNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
           G          D       L         +  +P + T HP  L++    K  TW  L
Sbjct: 274 GKTAAISLLGLDPTTPVARL---RGTVHRYQELPLVVTYHPAYLLRSLQDKSKTWADL 328


>gi|209524410|ref|ZP_03272959.1| phage SPO1 DNA polymerase-related protein [Arthrospira maxima
           CS-328]
 gi|209495201|gb|EDZ95507.1| phage SPO1 DNA polymerase-related protein [Arthrospira maxima
           CS-328]
          Length = 234

 Score = 71.2 bits (173), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/128 (29%), Positives = 63/128 (49%), Gaps = 2/128 (1%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEI-MRT 148
           C L       +         +MIIG  P   ++  G PF G++G +LDK+L S+ +   T
Sbjct: 59  CQLGKNRTHAVIGRGNPTAPIMIIGEAPGQHEDEQGLPFVGRSGQLLDKILDSVGLSTDT 118

Query: 149 QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQK 208
           +++IS      PP NR  +  E++ C+P ++ QI LI+P+I+L  G          D + 
Sbjct: 119 EVYISNAIRCRPPENRTPTASELQACKPYLLEQIRLINPQIILLTGATAVKSLL-GDKRP 177

Query: 209 TYQNLGKW 216
             +  G+W
Sbjct: 178 ITKIRGQW 185


>gi|94970381|ref|YP_592429.1| phage SPO1 DNA polymerase-related protein [Candidatus Koribacter
           versatilis Ellin345]
 gi|94552431|gb|ABF42355.1| phage SPO1 DNA polymerase-related protein [Candidatus Koribacter
           versatilis Ellin345]
          Length = 217

 Score = 70.9 bits (172), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 80/185 (43%), Gaps = 11/185 (5%)

Query: 64  VQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNI 123
           VQ    +  K  SL  L    +   +C L  T   T+         ++ +G  P D +++
Sbjct: 8   VQSELPLLMKPRSLEALAHDAKDCRNCDLWKTGTQTVFGEGGAHARVVFVGEQPGDKEDL 67

Query: 124 SGKPFSGKTGNMLDKMLQSIEIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRP 176
            G+PF G  GN+L+  L+   I R +++++       W P G R L    +  E+  CR 
Sbjct: 68  EGRPFVGPAGNLLNTALEQAGINRNEVYVTNAVKHFKWEPRGKRRLHKKPNAAEVAACRS 127

Query: 177 IIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQE 236
            +  +I  I P+I++ +G            + T Q   +   L  P+     LATVHP  
Sbjct: 128 WMDGEIAAIQPEIIVCLGATAAQAMLGRSFRVTKQ---RGEFLPGPNG-ASVLATVHPSS 183

Query: 237 LIQYP 241
           +++ P
Sbjct: 184 ILRAP 188


>gi|219856673|ref|YP_002473795.1| hypothetical protein CKR_3330 [Clostridium kluyveri NBRC 12016]
 gi|219570397|dbj|BAH08381.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 196

 Score = 70.9 bits (172), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 82/190 (43%), Gaps = 9/190 (4%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQ---DLMIIGYTPSDSDNISGKPFSGKT 132
            L + + L     +C+ C    S I     +G    DL+ IG  P   ++  G PF GK 
Sbjct: 4   KLLKWRELYEQCINCNKCGLGDSRINMVFGDGNPKADLVFIGEAPGADEDRIGLPFVGKA 63

Query: 133 GNMLDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILL 191
           G +L K L+S+++ R +  +I  I    P  NR     E + C P +  Q+ LI PKI++
Sbjct: 64  GKLLTKALESLDLYRKKDYYICNICKCRPKNNRTPYEDEEKACLPYLRNQVALIKPKIIV 123

Query: 192 FIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
            +G          D + T ++ GKW             AT HP  +++    K   W  L
Sbjct: 124 CLGATAMGCILGKDWRIT-RDRGKW----VERKGFYITATFHPSAILRDENKKPLFWQDL 178

Query: 252 ITLKKALKNL 261
             +++  + +
Sbjct: 179 KNIRRKYEEI 188


>gi|163782570|ref|ZP_02177567.1| N-terminus of phage SPO1 DNA polymerase [Hydrogenivirga sp.
           128-5-R1-1]
 gi|159882143|gb|EDP75650.1| N-terminus of phage SPO1 DNA polymerase [Hydrogenivirga sp.
           128-5-R1-1]
          Length = 220

 Score = 70.9 bits (172), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 77/167 (46%), Gaps = 8/167 (4%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEGQD---LMIIGYTPSDSDNISGKPFSGKTGNML 136
           L+    SF DC  C    +       +G     ++ +G  P + ++  G+PF G+ G  L
Sbjct: 38  LRRHFDSFKDCAKCELHRNRTQVVFGDGNPYSPVVFVGEAPGEDEDRQGRPFVGRAGKYL 97

Query: 137 DKMLQSI-EIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           +K ++ +  + R +++I+ +    PPGNR  +  E+  C P + ++I++I PK++  +G 
Sbjct: 98  NKKIEEVLGLRREEVYITNVCKCRPPGNRKPTPAEISACFPYLKKEIDIIKPKVICCLGA 157

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHS-IIPTLATVHPQELIQYP 241
                        T     +  N+  P+   I  L T HP  +++ P
Sbjct: 158 TAGEGILGKKLSITKV---RGKNVPYPYDPSITVLLTYHPAYILRNP 201


>gi|319787262|ref|YP_004146737.1| phage SPO1 DNA polymerase-related protein [Pseudoxanthomonas
           suwonensis 11-1]
 gi|317465774|gb|ADV27506.1| phage SPO1 DNA polymerase-related protein [Pseudoxanthomonas
           suwonensis 11-1]
          Length = 219

 Score = 70.9 bits (172), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 51/192 (26%), Positives = 86/192 (44%), Gaps = 24/192 (12%)

Query: 64  VQQADSIAQKACSLHE--LKSLLRSFHDCHLC---STSLSTICATQTEGQDLMIIGYTPS 118
           V+QA  +A+    + +  L +L R    C  C     +  T+         ++++G  P 
Sbjct: 10  VEQAPRLARPVDEVPQGSLSALRREAAGCRRCPLWRPATQTVFGAGPARAQVLLVGEQPG 69

Query: 119 DSDNISGKPFSGKTGNMLDKML-------QSIEIMRTQIHISMISPWHPPGNRNL----S 167
           D +++ GKPF G  G +L K L       QS+ +  T  H      + P G R L    +
Sbjct: 70  DREDLEGKPFVGPAGQLLRKALVEAGLAPQSLYLTNTVKHFK----FQPRGKRRLHQRAN 125

Query: 168 NIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIP 227
             E   CRP +  +++ I+P I++ +G       F    + T+Q  G+W  L  PH+   
Sbjct: 126 AAEQAACRPWLAAELDRINPDIVVALGAMAAQTLFGPGFRLTHQR-GQWQRL-GPHTQ-- 181

Query: 228 TLATVHPQELIQ 239
            LAT HP  +++
Sbjct: 182 ALATWHPSAILR 193


>gi|190572663|ref|YP_001970508.1| putative uracil DNA glycosylase [Stenotrophomonas maltophilia
           K279a]
 gi|190010585|emb|CAQ44194.1| putative uracil DNA glycosylase [Stenotrophomonas maltophilia
           K279a]
          Length = 486

 Score = 70.9 bits (172), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/185 (22%), Positives = 85/185 (45%), Gaps = 11/185 (5%)

Query: 62  PLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSD 121
           P+   A +      SL  L+    +   C L  T+  T+         +M+IG  P D++
Sbjct: 277 PMRGDAAAARPDTASLQTLRQQASACRQCPLWETATQTVFGQGPADARVMVIGEQPGDTE 336

Query: 122 NISGKPFSGKTGNMLDKMLQSIEIMRTQIHIS-MISPWHPPG------NRNLSNIEMEIC 174
           ++ G+PF+G  G +LD+ L  + I R  ++++  +  +H         ++   +  ++ C
Sbjct: 337 DLRGQPFAGPAGQLLDRALAELGIDRATLYLTNAVKHFHHERRGKVRLHKRPESRHIQAC 396

Query: 175 RPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHP 234
           RP +M +I  + P++++ +G       F  D   + ++ G+W  L          ATVHP
Sbjct: 397 RPWLMGEIARVRPQLIVCLGATAAASVFGRDFNLS-RDRGRWHTL---EEGTRGYATVHP 452

Query: 235 QELIQ 239
             +++
Sbjct: 453 AWVLR 457


>gi|289581122|ref|YP_003479588.1| phage SPO1 DNA polymerase-related protein [Natrialba magadii ATCC
           43099]
 gi|289530675|gb|ADD05026.1| phage SPO1 DNA polymerase-related protein [Natrialba magadii ATCC
           43099]
          Length = 200

 Score = 70.9 bits (172), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 84/180 (46%), Gaps = 12/180 (6%)

Query: 89  DCHLCSTSLST----ICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIE 144
           +C  C   + +    +  T  E  D++ +G  P   ++  G+PF G++G++LD  L+ + 
Sbjct: 11  ECERCPALVDSRSQIVNGTGPEDADILFVGEGPGAQEDSQGEPFVGRSGSVLDDQLRIVG 70

Query: 145 IMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNN 204
           + R  + I+      PP NR+ +  E+E CR  + ++IEL+ P +++ +G        + 
Sbjct: 71  LDRDTVRITNCVRCRPPENRDPTTDELENCRSYLEQEIELLDPDVIVTLGKVPTEHLLDR 130

Query: 205 DAQKTYQNLGKWSNL---CTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
           D   T +  G   ++    TP  +   L  VHP   + Y   ++ T+ + +     L  +
Sbjct: 131 DVAVTKE-AGSVEDVRVNGTPRRL---LICVHPAATL-YDRSQEETFESALERAAELAGV 185


>gi|167043274|gb|ABZ07980.1| putative Uracil DNA glycosylase superfamily protein [uncultured
           marine crenarchaeote HF4000_ANIW141M12]
          Length = 191

 Score = 70.9 bits (172), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 61/111 (54%)

Query: 84  LRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSI 143
           +++   C LC T  + +     +  D++ IG  P  ++++ G+PF G  G  LD  L+++
Sbjct: 14  VKTCEKCDLCITRKNAVPGKGNQNADIVFIGEAPGKNEDLRGEPFIGTAGKKLDDALKNV 73

Query: 144 EIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
            + R  ++I+ I    PP NR  +++E  +C   +  ++ +I+PKI+  +G
Sbjct: 74  GLTRNSVYITNIVKCRPPKNRIPNDLEKIMCSNYLEGELAIINPKIICLLG 124


>gi|15889460|ref|NP_355141.1| hypothetical protein Atu2180 [Agrobacterium tumefaciens str. C58]
 gi|15157326|gb|AAK87926.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 481

 Score = 70.9 bits (172), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 85/175 (48%), Gaps = 14/175 (8%)

Query: 80  LKSLLRSFHDCHLCS---TSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L+SL R    C  C+    +  T+     E  D+MI+G  P D+++++GKPF G  G + 
Sbjct: 292 LQSLAREARQCTRCALHCKATQTVFGEGPEDADIMIVGEQPGDNEDLAGKPFIGPAGQLF 351

Query: 137 DKMLQSIEIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELISPKI 189
           D+ L+ I   R +++++       +   G R +    +  E+E CR  + R+I L+ PK+
Sbjct: 352 DRTLREIGAERKKLYVTNAVKHFKYETRGKRRIHQRPNAGEVEQCRWWLNREIALVRPKL 411

Query: 190 LLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIK 244
           ++ +G  T  +      +K  +  G+   +    ++     TVHP  L++   I+
Sbjct: 412 IVAMGA-TALYALTGGKEKVSEIRGRPLPMEEGRTL---FVTVHPSYLLRLADIR 462


>gi|300865821|ref|ZP_07110571.1| phage SPO1 DNA polymerase-related protein [Oscillatoria sp. PCC
           6506]
 gi|300336187|emb|CBN55726.1| phage SPO1 DNA polymerase-related protein [Oscillatoria sp. PCC
           6506]
          Length = 229

 Score = 70.9 bits (172), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 75/159 (47%), Gaps = 14/159 (8%)

Query: 88  HDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEI-M 146
           H C L     + +         +MIIG  P  +++ +G PF G++G +LDK+L+S+ +  
Sbjct: 51  HRCELGKNRQNAVIGRGNLQAPIMIIGEAPGQNEDETGLPFVGRSGQLLDKILESVGLST 110

Query: 147 RTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDA 206
              + I  ++   PP NR  +  E + C+P ++ QI +++P+I+L  G  T       + 
Sbjct: 111 ERDVFICNVNKCRPPDNRTPTPKERDACKPYLLEQIRIVNPQIILLTG-ATALKGLTGEK 169

Query: 207 QKTYQNLGKW----SNLCTPHSIIPTLATVHPQELIQYP 241
           Q   +  G+W       C        +A  HP  L++ P
Sbjct: 170 QAISKIRGQWIEWEGRQC--------MAIFHPSYLLRNP 200


>gi|153956358|ref|YP_001397123.1| Phage-related DNA polymerase [Clostridium kluyveri DSM 555]
 gi|146349216|gb|EDK35752.1| Phage-related DNA polymerase [Clostridium kluyveri DSM 555]
          Length = 192

 Score = 70.5 bits (171), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 76/173 (43%), Gaps = 6/173 (3%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C L  + ++ +        DL+ IG  P   ++  G PF GK G +L K L+S+++ R +
Sbjct: 17  CGLGDSRINMVFGDGNPKADLVFIGEAPGADEDRIGLPFVGKAGKLLTKALESLDLYRKK 76

Query: 150 -IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQK 208
             +I  I    P  NR     E + C P +  Q+ LI PKI++ +G          D + 
Sbjct: 77  DYYICNICKCRPKNNRTPYEDEEKACLPYLRNQVALIKPKIIVCLGATAMGCILGKDWRI 136

Query: 209 TYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
           T ++ GKW             AT HP  +++    K   W  L  +++  + +
Sbjct: 137 T-RDRGKW----VERKGFYITATFHPSAILRDENKKPLFWQDLKNIRRKYEEI 184


>gi|225164210|ref|ZP_03726485.1| phage SPO1 DNA polymerase-related protein [Opitutaceae bacterium
           TAV2]
 gi|224801184|gb|EEG19505.1| phage SPO1 DNA polymerase-related protein [Opitutaceae bacterium
           TAV2]
          Length = 310

 Score = 70.5 bits (171), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 60/140 (42%), Gaps = 15/140 (10%)

Query: 110 LMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPP-------- 161
           +M +G  P   + + G+PF G  G +L +M+  + + R  ++I  I  W P         
Sbjct: 135 IMFVGEAPGAEEEVRGEPFVGPAGQLLTRMIAGMGLKREDVYIGNIMNWRPQIPTPPGCE 194

Query: 162 --GNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTY-QNLGKWSN 218
             GNR  S  EME C P    Q+ +++P IL+ +G             KT  Q  G+W  
Sbjct: 195 QIGNRPPSQAEMEFCLPFFRAQVAIVNPDILVALGKTAAQGMLGLGNVKTLGQVRGRWHT 254

Query: 219 LCTPHSIIPTLATVHPQELI 238
                   P + T HP  L+
Sbjct: 255 F----DGKPLMVTYHPSYLL 270


>gi|225872285|ref|YP_002753740.1| uracil-DNA glycosylase, family 4 [Acidobacterium capsulatum ATCC
           51196]
 gi|225793303|gb|ACO33393.1| uracil-DNA glycosylase, family 4 [Acidobacterium capsulatum ATCC
           51196]
          Length = 301

 Score = 70.5 bits (171), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/176 (23%), Positives = 77/176 (43%), Gaps = 9/176 (5%)

Query: 80  LKSLLRSFHDCHLCSTSLST----ICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           L+ L     DC  C  +       +         LM +G  P   ++  G PF G+ G +
Sbjct: 106 LRVLREEIGDCTRCQLAFEGRHKIVFGDGDPSARLMFVGEGPGADEDAQGLPFVGRAGQL 165

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           L+ M+ ++ + R+Q++I+ I    PP NR     E   C   + RQ++++ P++++ +G+
Sbjct: 166 LNNMIGAMGLERSQVYIANIVKCRPPQNRVPEPDEANTCTQFLFRQMQIVRPEMIVALGS 225

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
               +     A+   + L    +      +I    T HP  L++ P  KK  W  L
Sbjct: 226 TAATYLLG--AKSPLKALRGRIHQAHGSKLI---VTYHPAYLLRDPNQKKEAWADL 276


>gi|119356182|ref|YP_910826.1| phage SPO1 DNA polymerase-related protein [Chlorobium
           phaeobacteroides DSM 266]
 gi|119353531|gb|ABL64402.1| phage SPO1 DNA polymerase-related protein [Chlorobium
           phaeobacteroides DSM 266]
          Length = 223

 Score = 70.5 bits (171), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 86/178 (48%), Gaps = 5/178 (2%)

Query: 84  LRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSI 143
           ++S   C L ++  + +         L++IG  P   ++  G+PF G++G +LDK+LQ++
Sbjct: 34  VKSCTKCRLSASRKNVVFGEGDPRAALVVIGEAPGADEDSQGRPFVGRSGQLLDKILQAV 93

Query: 144 EIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFN 203
           +  R ++ I  I    PP NRN    E+E C P ++ Q+EL++PK++L +G    N    
Sbjct: 94  QFKREEVFICNILKCRPPQNRNPLADEIECCMPWLLLQLELLNPKLILLLGKVAANTILQ 153

Query: 204 NDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
           N       ++G              + T HP  L++ P  KK  W  +  +++    L
Sbjct: 154 NSL-----SMGAMRGRIVKWKAYDCMVTYHPAALLRNPGWKKACWEDVQMMRQHYDKL 206


>gi|18312072|ref|NP_558739.1| uracil DNA glycosylase (PA-UDGa) [Pyrobaculum aerophilum str. IM2]
 gi|18159500|gb|AAL62921.1| uracil DNA glycosylase (Pa-UDGa) [Pyrobaculum aerophilum str. IM2]
          Length = 196

 Score = 70.1 bits (170), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 43/175 (24%), Positives = 79/175 (45%), Gaps = 14/175 (8%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQ---DLMIIGYTPSDSDNISGKPFSGKTG 133
           LHEL        +C  C        A   EG+    +MI+G  P  S++ +G+PF G  G
Sbjct: 6   LHEL------IKNCDKCPLHKYRKNAVPGEGEMKLGVMIVGEAPGASEDEAGRPFVGAAG 59

Query: 134 NMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFI 193
            +L + L  + + R  + I+ +    PP NR  +  E+E C P +++QI ++ P+ ++ +
Sbjct: 60  QLLTEALSRLGVRRGDVFITNVVKCRPPNNRTPNREEVEACLPYLIQQIGILKPRRIIAL 119

Query: 194 GNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSI----IPTLATVHPQELIQYPLIK 244
           G  +         ++  + LG     C    I    +    T HP  +++ P ++
Sbjct: 120 GLISAKALMELMGRRA-EKLGDVKGKCYQGRIAGVQVELCITYHPAAVLRKPALR 173


>gi|187735611|ref|YP_001877723.1| phage SPO1 DNA polymerase-related protein [Akkermansia muciniphila
           ATCC BAA-835]
 gi|187425663|gb|ACD04942.1| phage SPO1 DNA polymerase-related protein [Akkermansia muciniphila
           ATCC BAA-835]
          Length = 305

 Score = 69.7 bits (169), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 49/191 (25%), Positives = 90/191 (47%), Gaps = 14/191 (7%)

Query: 77  LHELKSLLRSFHDCH-LCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           L  L++L +++     L S   + + AT      LM+IG  P   + +  +PF G+ G  
Sbjct: 104 LQYLRNLAQNWKPARELNSLRDTMVFATGNPHTKLMLIGEAPGYYEEVQQEPFVGRAGEK 163

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPP------GNRNLSNIEMEICRPIIMRQIELISPKI 189
           L+++L+++ + R  ++IS I  + P        NR  +  E+E C PIIM +I +I PK+
Sbjct: 164 LNQILRAMGLSRDMVYISNIVKFRPALPNQRTNNRAPTPEEIEACLPIIMHEIRVIQPKM 223

Query: 190 LLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ--YPLIKKNT 247
           ++ +G              +    G++ +L      IP   T HP  L++   P  K+  
Sbjct: 224 IVALGGTAAVGLLGEQGSVSSMR-GRFHDLNG----IPVRVTYHPSYLLRSDSPREKRKV 278

Query: 248 WHALITLKKAL 258
           W  ++ + + L
Sbjct: 279 WEDMLAVMERL 289


>gi|254521313|ref|ZP_05133368.1| uracil DNA glycosylase superfamily protein [Stenotrophomonas sp.
           SKA14]
 gi|219718904|gb|EED37429.1| uracil DNA glycosylase superfamily protein [Stenotrophomonas sp.
           SKA14]
          Length = 472

 Score = 69.7 bits (169), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 41/185 (22%), Positives = 87/185 (47%), Gaps = 11/185 (5%)

Query: 62  PLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSD 121
           P+ + + + +    SL  L+    +   C L  T+  T+         +M+IG  P D++
Sbjct: 263 PMREDSATSSTDTRSLQNLRQQASACRQCPLWETATQTVFGQGPADARVMVIGEQPGDTE 322

Query: 122 NISGKPFSGKTGNMLDKMLQSIEIMRTQIHIS-MISPWHPPG------NRNLSNIEMEIC 174
           ++ G PF+G  G +LD+ L  + I R  ++++  +  +H         ++   +  ++ C
Sbjct: 323 DLRGLPFAGPAGQLLDRALAELGIDRATLYLTNAVKHFHHERRGKIRLHKRPESRHIQAC 382

Query: 175 RPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHP 234
           RP +M +I  + P++++ +G       F  D   + ++ G+W  L        + ATVHP
Sbjct: 383 RPWLMGEIARVRPQVIVCLGATAAASVFGRDFNLS-RDRGRWHTL---EDGTQSYATVHP 438

Query: 235 QELIQ 239
             +++
Sbjct: 439 AWVLR 443


>gi|187777334|ref|ZP_02993807.1| hypothetical protein CLOSPO_00886 [Clostridium sporogenes ATCC
           15579]
 gi|187774262|gb|EDU38064.1| hypothetical protein CLOSPO_00886 [Clostridium sporogenes ATCC
           15579]
          Length = 193

 Score = 69.7 bits (169), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 68/147 (46%), Gaps = 6/147 (4%)

Query: 110 LMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSN 168
           ++ IG  P   ++ +GKPF GK G +L K L ++E  R +  +I  +    P  NR    
Sbjct: 40  IIFIGEAPGADEDRTGKPFVGKAGQLLTKALLALEFKRDEHYYICNVCKCRPENNRTPKE 99

Query: 169 IEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPT 228
            E   C P +  Q+ L+ PKI++ +G     +      + T ++ GKW      H     
Sbjct: 100 EEARECLPFLRNQVALVKPKIIVCLGATPLKYIIGEQFRIT-RDRGKWIERKGYH----I 154

Query: 229 LATVHPQELIQYPLIKKNTWHALITLK 255
           +AT HP  L +    KK  W  L ++K
Sbjct: 155 MATFHPAALFRDESKKKLFWQDLKSIK 181


>gi|292654621|ref|YP_003534518.1| uracil DNA glycosylase [Haloferax volcanii DS2]
 gi|291372686|gb|ADE04913.1| uracil DNA glycosylase [Haloferax volcanii DS2]
          Length = 198

 Score = 69.7 bits (169), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 36/153 (23%), Positives = 72/153 (47%), Gaps = 2/153 (1%)

Query: 109 DLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSN 168
           DL+ +G  P   ++  G+PF G++G++LD  L+   + R  + I+      PP NR+ ++
Sbjct: 35  DLLFLGEAPGAKEDEGGEPFVGRSGSVLDDALREAGLARADVRITNCVRCRPPDNRDPTS 94

Query: 169 IEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPT 228
            E+  CR  + R++EL+ P++++ +G        +     T ++ G   +     +    
Sbjct: 95  DELSNCRGYLARELELVDPELVVTLGKVPSQHLLDRGVAITNES-GSVVDARVGDASYRV 153

Query: 229 LATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
           L +VHP   + Y   ++  +   I     L  L
Sbjct: 154 LLSVHPAATL-YDRSQREGFFETIARAADLSGL 185


>gi|117927329|ref|YP_871880.1| phage SPO1 DNA polymerase-related protein [Acidothermus
           cellulolyticus 11B]
 gi|117647792|gb|ABK51894.1| phage SPO1 DNA polymerase-related protein [Acidothermus
           cellulolyticus 11B]
          Length = 217

 Score = 69.7 bits (169), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 76/182 (41%), Gaps = 18/182 (9%)

Query: 74  ACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTG 133
              L EL+   R    C L   +  T+ ++      ++++G  P D ++  G PF G  G
Sbjct: 15  GAGLDELRRAARGCQGCPLYRNATQTVFSSGPPTARIVLVGEQPGDQEDRRGAPFVGPAG 74

Query: 134 NMLDKMLQSIEIMRTQIHISMISP-----WHPPGNRNLSNI----EMEICRPIIMRQIEL 184
           N+LD+ L+ + I R   +++            PG R +       E+  CRP +  ++ +
Sbjct: 75  NILDRALEEVGIDRAAAYVTNAVKHFKFRQDGPGARRIHQTPDQREITACRPWLAAELAI 134

Query: 185 ISPKILLFIGNKTKNFFFNND--AQKTYQNLGKWSNLCTPHSIIPT-----LATVHPQEL 237
           + P I++ +G       F  D    +T   L  W     PH          LAT+HP  +
Sbjct: 135 VDPDIIVALGATAGRALFGPDFRVNRTRGALLPWP--APPHEDAVRVNKFFLATIHPSAV 192

Query: 238 IQ 239
           ++
Sbjct: 193 LR 194


>gi|315426164|dbj|BAJ47808.1| DNA polymerase bacteriophage-type [Candidatus Caldiarchaeum
           subterraneum]
          Length = 200

 Score = 69.7 bits (169), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 75/164 (45%), Gaps = 13/164 (7%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEGQ---DLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L ++      C LC        A   EG    +LM IG  P + +++ G+PF G++G +L
Sbjct: 9   LDAIAEEVRACRLCPLWRGRRNAVPGEGNPRAELMFIGEGPGEEEDLQGRPFVGRSGRLL 68

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEIC-RPIIMRQIELISPKILLFIGN 195
            + L+   I R  + I+ +    PP NR  +  E + C    + RQIE ++P++++ +G+
Sbjct: 69  TEALEKAGIRREDVFITNVVKCRPPENREPTPEERQTCTNKYLFRQIEAVNPRLIVLLGS 128

Query: 196 KTKNFFFNNDA-----QKTYQNLGKWSNLCTPHSIIPTLATVHP 234
                     +      K ++ +G+    CT H   P  A  +P
Sbjct: 129 VAVQTLLGISSVTAVRGKAFEKMGR-RFFCTYH---PAAALYNP 168


>gi|255527794|ref|ZP_05394645.1| phage SPO1 DNA polymerase-related protein [Clostridium
           carboxidivorans P7]
 gi|255508507|gb|EET84896.1| phage SPO1 DNA polymerase-related protein [Clostridium
           carboxidivorans P7]
          Length = 190

 Score = 69.7 bits (169), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 74/168 (44%), Gaps = 6/168 (3%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-T 148
           C L +   + +         ++ +G  P   ++  G PF G+ G +L K L +++++R  
Sbjct: 17  CDLGNKRTNMVFGDGNSRGKIVFVGEAPGADEDRIGLPFVGRAGQLLTKGLTALDLIREN 76

Query: 149 QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQK 208
             +I  +    P  NR     E E C P +  Q+ LI PKI++ +G     +   ND + 
Sbjct: 77  DYYICNVCKCRPDNNRVPYENEAEACLPYLRNQVALIKPKIIVCLGATAMKYILGNDFRI 136

Query: 209 TYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
           T ++ GKW            +AT HP  L +    K   W  L ++KK
Sbjct: 137 T-RDRGKW----IERKGCYIIATFHPAALFRDENKKVLFWEDLKSVKK 179


>gi|48425936|pdb|1VK2|A Chain A, Crystal Structure Of Uracil-Dna Glycosylase (Tm0511) From
           Thermotoga Maritima At 1.90 A Resolution
          Length = 204

 Score = 69.7 bits (169), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 71/153 (46%), Gaps = 6/153 (3%)

Query: 90  CHLCSTSLSTICATQTEGQ---DLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIM 146
           C  C   L+       EG     ++ +G  P + ++ +G+PF G+ G +L ++L+   I 
Sbjct: 30  CTACPLHLNRTNVVVGEGNLDTRIVFVGEGPGEEEDKTGRPFVGRAGXLLTELLRESGIR 89

Query: 147 RTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDA 206
           R  ++I  +    PP NR  +  E   C   ++ QIE+I+P +++ +G    +FF +   
Sbjct: 90  REDVYICNVVKCRPPNNRTPTPEEQAACGHFLLAQIEIINPDVIVALGATALSFFVDGKK 149

Query: 207 QKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ 239
               +  G   +      +IPT    HP  L++
Sbjct: 150 VSITKVRGNPIDWLGGKKVIPTF---HPSYLLR 179


>gi|315426239|dbj|BAJ47882.1| DNA polymerase bacteriophage-type [Candidatus Caldiarchaeum
           subterraneum]
 gi|315427880|dbj|BAJ49472.1| DNA polymerase bacteriophage-type [Candidatus Caldiarchaeum
           subterraneum]
          Length = 196

 Score = 69.3 bits (168), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 75/164 (45%), Gaps = 13/164 (7%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEGQ---DLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L ++      C LC        A   EG    +LM IG  P + +++ G+PF G++G +L
Sbjct: 5   LDAIAEEVRACRLCPLWRGRRNAVPGEGNPRAELMFIGEGPGEEEDLQGRPFVGRSGRLL 64

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEIC-RPIIMRQIELISPKILLFIGN 195
            + L+   I R  + I+ +    PP NR  +  E + C    + RQIE ++P++++ +G+
Sbjct: 65  TEALEKAGIRREDVFITNVVKCRPPENREPTPEERQTCTNKYLFRQIETVNPRLIVLLGS 124

Query: 196 KTKNFFFNNDA-----QKTYQNLGKWSNLCTPHSIIPTLATVHP 234
                     +      K ++ +G+    CT H   P  A  +P
Sbjct: 125 VAVQTLLGISSVTAVRGKAFEKMGR-RFFCTYH---PAAALYNP 164


>gi|269836973|ref|YP_003319201.1| phage SPO1 DNA polymerase-like protein [Sphaerobacter thermophilus
           DSM 20745]
 gi|269786236|gb|ACZ38379.1| phage SPO1 DNA polymerase-related protein [Sphaerobacter
           thermophilus DSM 20745]
          Length = 202

 Score = 69.3 bits (168), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 63/131 (48%)

Query: 75  CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
            SL  + + +R    C L     + +        ++M IG  P   ++  G PF G  G 
Sbjct: 3   ASLDTIAARVRVCTQCELHRMRTNAVPGNGNPNAEVMFIGEGPGWHEDRQGLPFVGAAGQ 62

Query: 135 MLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
            L++MLQSI + R ++ I+ I    PPGNR+    E+  C   +  QI  I PK+++ +G
Sbjct: 63  FLNEMLQSIGLSRDEVFITNIVKCRPPGNRDPLPDEIAACSAYLDAQIAAIKPKVIVTLG 122

Query: 195 NKTKNFFFNND 205
             +   +F N+
Sbjct: 123 RFSMARWFPNE 133


>gi|170760011|ref|YP_001785403.1| uracil-DNA glycosylase [Clostridium botulinum A3 str. Loch Maree]
 gi|169407000|gb|ACA55411.1| uracil-DNA glycosylase [Clostridium botulinum A3 str. Loch Maree]
          Length = 190

 Score = 69.3 bits (168), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 42/153 (27%), Positives = 69/153 (45%), Gaps = 6/153 (3%)

Query: 110 LMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSN 168
           +M IG  P   ++ +G+PF GK G +L K L +++  R +  +I  +    P  NR    
Sbjct: 37  IMFIGEAPGADEDRTGRPFVGKAGQLLTKALLALDFKRDEHYYICNVCKCRPENNRTPKE 96

Query: 169 IEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPT 228
            E   C P +  Q+ LI PKI++ +G     +      + T ++ GKW            
Sbjct: 97  EEAMTCLPYLRNQVALIKPKIMICLGATALKYIMGEQFRIT-RDRGKW----IERKGYYI 151

Query: 229 LATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
           +AT HP  L +    KK  W  L ++++    L
Sbjct: 152 MATFHPAALFRDESKKKLLWQDLKSIREKYDEL 184


>gi|134094968|ref|YP_001100043.1| putative DNA polymerase-related protein, bacteriophage-type
           [Herminiimonas arsenicoxydans]
 gi|133738871|emb|CAL61918.1| Putative phage SPO1 DNA polymerase-related protein, uracil-DNA
           glycosylase family [Herminiimonas arsenicoxydans]
          Length = 283

 Score = 69.3 bits (168), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 48/205 (23%), Positives = 86/205 (41%), Gaps = 15/205 (7%)

Query: 59  IHSPLVQQADSIAQKAC-------SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLM 111
           +H+P+   A  +A              +LKS++ S   C LC +   T+     +    +
Sbjct: 69  LHAPVTLTASEVATSTSFADIVQMDWAQLKSVVASCTQCGLCKSRTQTVFGVGDQKARWL 128

Query: 112 IIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ-IHISMISPWHP----PGNRNL 166
            +G  P  +++  G+PF G  G +LD M  ++ + R +  +I+ I    P      +R  
Sbjct: 129 FVGEGPGRNEDFQGEPFVGPAGKLLDNMFGAMGLKRGENTYIANIVKCRPIDAGKHDRPP 188

Query: 167 SNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSII 226
           +  E+  C P + RQI LI P +++ +G          D       +GK       ++ +
Sbjct: 189 AAEEVAACIPYLERQIALIKPTVIVALGKTAAISLLKLDPATP---VGKLRGTVHRYADL 245

Query: 227 PTLATVHPQELIQYPLIKKNTWHAL 251
           P + T HP  L++    K   W  L
Sbjct: 246 PLIVTYHPAYLLRNLKDKSKAWADL 270


>gi|289524505|ref|ZP_06441359.1| uracil-DNA glycosylase [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
 gi|289502255|gb|EFD23419.1| uracil-DNA glycosylase [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
          Length = 146

 Score = 69.3 bits (168), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 67/150 (44%), Gaps = 4/150 (2%)

Query: 88  HDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR 147
             C L      ++    ++  +LM +G  P   +++ G PF GK G +L+++  +  I R
Sbjct: 1   RKCPLSENRTQSVFGEGSKKTELMFVGEGPGADEDLQGLPFVGKAGQLLNQIFAAAGIDR 60

Query: 148 TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQ 207
           ++++I+ +    PP NR  +  E   C   +  QI L+ PKIL+ +GN    +      +
Sbjct: 61  SEVYITNVVKCRPPQNRVPTVEECSACNDYLFAQISLVQPKILVTLGNTPTKWLLKTTHE 120

Query: 208 KTYQNLGKWSNLCTPHSIIPTLATVHPQEL 237
              Q  GK    C     I  +   HP  L
Sbjct: 121 GITQLRGK----CFDWYGIKLMPMFHPSYL 146


>gi|117927565|ref|YP_872116.1| phage SPO1 DNA polymerase-related protein [Acidothermus
           cellulolyticus 11B]
 gi|117648028|gb|ABK52130.1| phage SPO1 DNA polymerase-related protein [Acidothermus
           cellulolyticus 11B]
          Length = 225

 Score = 69.3 bits (168), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 53/97 (54%)

Query: 108 QDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLS 167
           + ++++G  P   ++ +G PF G+ G +LD++L    + R  + I  +    PPGNR  +
Sbjct: 46  RPVVLVGEAPGAEEDRTGLPFVGRAGRLLDELLVDAGLPRATVAIVNVLKCRPPGNRVPN 105

Query: 168 NIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNN 204
            +E+  CRP +  Q+ L+ P +++ +G     +FF  
Sbjct: 106 RVEIAACRPWLEAQLALLDPGVVVALGGTAVAWFFER 142


>gi|329765399|ref|ZP_08256979.1| uracil-DNA glycosylase-like protein [Candidatus Nitrosoarchaeum
           limnia SFB1]
 gi|329138305|gb|EGG42561.1| uracil-DNA glycosylase-like protein [Candidatus Nitrosoarchaeum
           limnia SFB1]
          Length = 197

 Score = 68.9 bits (167), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 47/175 (26%), Positives = 78/175 (44%), Gaps = 11/175 (6%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C L  T  +++        D++ +G  P  +++  G+PF G  G  L   L+S  + R  
Sbjct: 18  CDLSKTRTNSVPGKGNFQSDVIFVGEAPGRNEDKKGEPFVGIAGQRLSAALESAGVSRES 77

Query: 150 IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKT 209
           I+I+ +    PP NR  + +E+++C   + ++I +I PKI+  +GN   N          
Sbjct: 78  IYITNVVKCRPPNNRIPTIMELDMCHDYLQKEIAIIKPKIICILGNTAFNSILGGSEITK 137

Query: 210 YQN----LGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
           Y+       K     T H      AT++ QELI    + K     L  L + LKN
Sbjct: 138 YRGKIVKKDKEFYFLTVHP----AATIYNQELIT---VLKEDIIKLFDLIRELKN 185


>gi|255514104|gb|EET90367.1| phage SPO1 DNA polymerase-related protein [Candidatus Micrarchaeum
           acidiphilum ARMAN-2]
          Length = 321

 Score = 68.9 bits (167), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 55/86 (63%)

Query: 110 LMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNI 169
           +M +G  P   ++ + +PF G++G +L  M++   + R + +I+ +  + PP NR  S+ 
Sbjct: 175 IMFLGQAPGSEEDKTLRPFVGRSGMLLTDMIKRAGLDRDKAYITSVVQFFPPRNRAPSSF 234

Query: 170 EMEICRPIIMRQIELISPKILLFIGN 195
           E+++C+P + +QI+++ P +++ +GN
Sbjct: 235 EIDVCKPFLFKQIDIVKPGLVVLLGN 260


>gi|148378081|ref|YP_001252622.1| uracil-DNA glycosylase [Clostridium botulinum A str. ATCC 3502]
 gi|153933715|ref|YP_001382480.1| uracil-DNA glycosylase [Clostridium botulinum A str. ATCC 19397]
 gi|153935117|ref|YP_001386032.1| uracil-DNA glycosylase [Clostridium botulinum A str. Hall]
 gi|148287565|emb|CAL81629.1| putative uracil-DNA glycosylase [Clostridium botulinum A str. ATCC
           3502]
 gi|152929759|gb|ABS35259.1| uracil-DNA glycosylase [Clostridium botulinum A str. ATCC 19397]
 gi|152931031|gb|ABS36530.1| uracil-DNA glycosylase [Clostridium botulinum A str. Hall]
          Length = 190

 Score = 68.9 bits (167), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 69/153 (45%), Gaps = 6/153 (3%)

Query: 110 LMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSN 168
           +M IG  P   ++ +G+PF GK G +L K L +++  R +  +I  +    P  NR    
Sbjct: 37  IMFIGEAPGADEDRTGRPFVGKAGQLLTKALLALDFKRDEHYYICNVCKCRPENNRTPKE 96

Query: 169 IEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPT 228
            E   C P +  Q+ L+ PKI++ +G     +      + T ++ GKW            
Sbjct: 97  EEAMTCLPYLRNQVALVKPKIMICLGATALKYIMGEQFRIT-RDRGKW----IERKGYYI 151

Query: 229 LATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
           +AT HP  L +    KK  W  L ++++    L
Sbjct: 152 MATFHPAALFRDESKKKLLWQDLKSIREKYDEL 184


>gi|257052840|ref|YP_003130673.1| phage SPO1 DNA polymerase-related protein [Halorhabdus utahensis
           DSM 12940]
 gi|256691603|gb|ACV11940.1| phage SPO1 DNA polymerase-related protein [Halorhabdus utahensis
           DSM 12940]
          Length = 194

 Score = 68.9 bits (167), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 68/144 (47%), Gaps = 2/144 (1%)

Query: 109 DLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSN 168
           +L+ +G  P + ++  G+PF G++G +LD  L+   + R  + I+      PP NR+ ++
Sbjct: 35  ELLFVGEAPGEREDEQGEPFVGRSGTVLDDALRDAGLSRADVRITNCVRCRPPENRDPTS 94

Query: 169 IEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPT 228
            E   CRP + R+I+ + P +++ +G          D   T +  G   ++    +    
Sbjct: 95  DERSNCRPYLDREIDQVDPTVIVTLGKVPGEHLLGRDLAVTSE-AGSIEDVDIEGTTRRV 153

Query: 229 LATVHPQELIQYPLIKKNTWHALI 252
           L  VHP   + Y   ++ T+   I
Sbjct: 154 LICVHPAATL-YDRSQRETFERTI 176


>gi|33865707|ref|NP_897266.1| Uracil-DNA glycosylase [Synechococcus sp. WH 8102]
 gi|33632877|emb|CAE07688.1| Uracil-DNA glycosylase [Synechococcus sp. WH 8102]
          Length = 187

 Score = 68.9 bits (167), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 75/162 (46%), Gaps = 9/162 (5%)

Query: 84  LRSFHDCHLCSTSLS---TICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKML 140
           LR    C  C  +L+    + +       LM+IG  P   ++  G+PF G++G +LD++L
Sbjct: 6   LRDCEQCTGCDLALTRERVVISRGAATAPLMLIGEAPGAREDALGQPFVGRSGQLLDRLL 65

Query: 141 QSIEI-MRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKN 199
           Q + +   + ++I       PP NR     E+  CRP +  QI+ ++P++++ +G     
Sbjct: 66  QDVGLNPESDLYICNAVKCRPPQNRRPKRAELTACRPWLDHQIDQVNPRVIVLLGATAVE 125

Query: 200 FFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
                    T Q  G+W +      ++P     HP  L++ P
Sbjct: 126 SLLGIKGGMT-QLRGQWLSW-DGRDVMPIF---HPSYLLRNP 162


>gi|153940469|ref|YP_001389438.1| uracil-DNA glycosylase [Clostridium botulinum F str. Langeland]
 gi|168177407|ref|ZP_02612071.1| uracil-DNA glycosylase [Clostridium botulinum NCTC 2916]
 gi|170756172|ref|YP_001779700.1| uracil-DNA glycosylase [Clostridium botulinum B1 str. Okra]
 gi|226947298|ref|YP_002802389.1| uracil-DNA glycosylase [Clostridium botulinum A2 str. Kyoto]
 gi|152936365|gb|ABS41863.1| uracil-DNA glycosylase [Clostridium botulinum F str. Langeland]
 gi|169121384|gb|ACA45220.1| uracil-DNA glycosylase [Clostridium botulinum B1 str. Okra]
 gi|182671008|gb|EDT82982.1| uracil-DNA glycosylase [Clostridium botulinum NCTC 2916]
 gi|226842858|gb|ACO85524.1| uracil-DNA glycosylase [Clostridium botulinum A2 str. Kyoto]
 gi|322804346|emb|CBZ01896.1| uracil-DNA glycosylase, family 4 [Clostridium botulinum H04402 065]
          Length = 190

 Score = 68.9 bits (167), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 69/153 (45%), Gaps = 6/153 (3%)

Query: 110 LMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSN 168
           +M IG  P   ++ +G+PF GK G +L K L +++  R +  +I  +    P  NR    
Sbjct: 37  IMFIGEAPGADEDRTGRPFVGKAGQLLTKALLALDFKRDEHYYICNVCKCRPENNRTPKE 96

Query: 169 IEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPT 228
            E   C P +  Q+ L+ PKI++ +G     +      + T ++ GKW            
Sbjct: 97  EEAMTCLPYLRNQVALVKPKIMICLGATALKYIMGEQFRIT-RDRGKW----IERKGYYI 151

Query: 229 LATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
           +AT HP  L +    KK  W  L ++++    L
Sbjct: 152 MATFHPAALFRDESKKKLLWQDLKSIREKYDEL 184


>gi|15643277|ref|NP_228321.1| hypothetical protein TM0511 [Thermotoga maritima MSB8]
 gi|31615491|pdb|1L9G|A Chain A, Crystal Structure Of Uracil-Dna Glycosylase From T.
           Maritima
 gi|4981023|gb|AAD35596.1|AE001727_8 conserved hypothetical protein [Thermotoga maritima MSB8]
          Length = 192

 Score = 68.9 bits (167), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 71/153 (46%), Gaps = 6/153 (3%)

Query: 90  CHLCSTSLSTICATQTEGQ---DLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIM 146
           C  C   L+       EG     ++ +G  P + ++ +G+PF G+ G +L ++L+   I 
Sbjct: 18  CTACPLHLNRTNVVVGEGNLDTRIVFVGEGPGEEEDKTGRPFVGRAGMLLTELLRESGIR 77

Query: 147 RTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDA 206
           R  ++I  +    PP NR  +  E   C   ++ QIE+I+P +++ +G    +FF +   
Sbjct: 78  REDVYICNVVKCRPPNNRTPTPEEQAACGHFLLAQIEIINPDVIVALGATALSFFVDGKK 137

Query: 207 QKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ 239
               +  G   +      +IPT    HP  L++
Sbjct: 138 VSITKVRGNPIDWLGGKKVIPTF---HPSYLLR 167


>gi|76800697|ref|YP_325705.1| uracil-DNA glycosylase-like protein [Natronomonas pharaonis DSM
           2160]
 gi|76556562|emb|CAI48133.1| uracil-DNA glycosylase homolog [Natronomonas pharaonis DSM 2160]
          Length = 194

 Score = 68.9 bits (167), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 76/171 (44%), Gaps = 13/171 (7%)

Query: 89  DCHLCSTSLSTICATQTE--------GQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKML 140
           DC  CS     +CA+++           DL+ +G  P ++++  G+PF G++G++LD+ L
Sbjct: 9   DCRRCSE----LCASRSRIVNGVGPTDADLLFVGEAPGETEDEVGEPFVGRSGDVLDEGL 64

Query: 141 QSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNF 200
           +   + R  I I+      PP NR+ +  E   CRP +  +I  + P +++ +G      
Sbjct: 65  RDRGLSRRDIRITNCVRCRPPDNRDPTAEERSNCRPYLDAEIAAVDPDVVVALGKVPAEH 124

Query: 201 FFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
             +     T +  G   +     +    L  VHP   +  P  ++    AL
Sbjct: 125 LLDRSVAVT-EAAGAIYDARIDGTARRVLVCVHPAATLYDPSQREQFDAAL 174


>gi|15806754|ref|NP_295474.1| DNA polymerase-like protein [Deinococcus radiodurans R1]
 gi|6459521|gb|AAF11304.1|AE002016_6 DNA polymerase-related protein [Deinococcus radiodurans R1]
          Length = 237

 Score = 68.9 bits (167), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 49/207 (23%), Positives = 89/207 (42%), Gaps = 11/207 (5%)

Query: 62  PLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSD 121
           PL Q AD       +L  L+   R    C L  ++   + +       L+I+G  P   +
Sbjct: 11  PLHQAADP--PDPAALLALEDRNRGCAACPLRVSASQVVVSDGDPRAPLLIVGEGPGAEE 68

Query: 122 NISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMR- 180
           +  G+PF G+ G +LD++L +  + R + +++ ++    P NR    +E   C  + +  
Sbjct: 69  DRDGRPFVGQAGQLLDRILAAASLAREEAYLTNVTKCRAPNNRTPLPLETATCTGLWLEP 128

Query: 181 QIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTL--ATVHPQELI 238
           Q+ L+ P+++L +GN    F        T    G+W     P    P L    +HP  L+
Sbjct: 129 QLALLRPRVVLSLGNTATQFLLGTPRGITRLR-GQWFTYRHPAWPQPALLMPLLHPAYLL 187

Query: 239 QYPL-----IKKNTWHALITLKKALKN 260
           + P+      K  TW  +  +   L+ 
Sbjct: 188 RNPVRTPGGPKSLTWRDIREVAAVLRG 214


>gi|148254428|ref|YP_001239013.1| putative Uracil-DNA glycosylase [Bradyrhizobium sp. BTAi1]
 gi|146406601|gb|ABQ35107.1| Putative Uracil-DNA glycosylase [Bradyrhizobium sp. BTAi1]
          Length = 496

 Score = 68.9 bits (167), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 88/194 (45%), Gaps = 12/194 (6%)

Query: 57  RHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYT 116
           R   +P  + +  +A  A  L  L+    +   C L   +  T+     +   LM++G  
Sbjct: 277 RKPTAPAAETSPDVA--AADLETLREEAAACRACPLWKDATQTVFGEGPDHAPLMLVGEQ 334

Query: 117 PSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMIS---PWHPPGNRNL----SNI 169
           P D ++++G PF G  G MLD+ LQ   I R++++++       + P G   L    +  
Sbjct: 335 PGDKEDLAGHPFVGPAGQMLDRALQEAGIDRSKVYVTNAVKHFKFVPRGKIRLHQKPATP 394

Query: 170 EMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTL 229
           E++ CR    R++  + P +++ +G       F      T +N G   +L    ++I T 
Sbjct: 395 EIKACRQWYERELATVRPALVVALGATAAQSVFGKITPVT-KNRGHVVDLPEGPNMIATK 453

Query: 230 A--TVHPQELIQYP 241
           A  TVHP  L++ P
Sbjct: 454 AMVTVHPSYLLRLP 467


>gi|315636217|ref|ZP_07891471.1| uracil-DNA glycosylase [Arcobacter butzleri JV22]
 gi|315479578|gb|EFU70257.1| uracil-DNA glycosylase [Arcobacter butzleri JV22]
          Length = 222

 Score = 68.6 bits (166), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 91/186 (48%), Gaps = 8/186 (4%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           + ELK+ +   + C LC    + +         +M I   P+ S++  G  + G +G +L
Sbjct: 43  IKELKNSVEHCYLCELCKVRKNVLFGYGNINSKIMFICDEPTKSEDELGSFYVGNSGELL 102

Query: 137 DKMLQSI-EIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
            KM++++  I +  ++I+ +           +N   + C   +++QIELI PK+++ +G 
Sbjct: 103 SKMIENVLNIKKEDVYITTLVKCKSLNGA--TNSSFDTCNDYLLKQIELIKPKLIVSLGE 160

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
           KT ++   N     +Q  GK  N  +    I  +A   P  L++ P +KK+ ++ ++ +K
Sbjct: 161 KTYSYLMKN-GDNFFQIRGKMLNFNS----IALMAVYSPTFLLRNPSLKKDAYYDMLKIK 215

Query: 256 KALKNL 261
             ++ L
Sbjct: 216 SFMEEL 221


>gi|158424630|ref|YP_001525922.1| phage SPO1 DNA polymerase-related protein [Azorhizobium caulinodans
           ORS 571]
 gi|158331519|dbj|BAF89004.1| phage SPO1 DNA polymerase-related protein [Azorhizobium caulinodans
           ORS 571]
          Length = 472

 Score = 68.6 bits (166), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 41/185 (22%), Positives = 83/185 (44%), Gaps = 12/185 (6%)

Query: 64  VQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNI 123
           +++A   A++A  L  L++       C L + +  T+         +M +G  P D +++
Sbjct: 268 LEKAALDAEQADGLEALRAQALGCRACPLWAPATQTVFGEGPTDAPVMFVGEQPGDQEDL 327

Query: 124 SGKPFSGKTGNMLDKMLQSIEIMRTQIHISMIS---PWHPPGNRNLSN----IEMEICRP 176
            G+PF G  G + D+ LQ   + R + +++       + P G R L      +E+  C  
Sbjct: 328 DGRPFVGPAGRLFDQALQDAGLERARAYVTNAVKHFKFEPRGKRRLHQSPNPVEIRACNT 387

Query: 177 IIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQE 236
            + R+I L+ P++++ +G        +  A +  ++ G+      P      L +VHP  
Sbjct: 388 WLAREIALVRPRLVVALGASAAQ-AVSGRAVRVGESRGR----IMPLEGRDALVSVHPSY 442

Query: 237 LIQYP 241
           L++ P
Sbjct: 443 LLRLP 447


>gi|284052961|ref|ZP_06383171.1| phage SPO1 DNA polymerase-related protein [Arthrospira platensis
           str. Paraca]
 gi|291571857|dbj|BAI94129.1| uracil-DNA glycosylase [Arthrospira platensis NIES-39]
          Length = 238

 Score = 68.6 bits (166), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 56/106 (52%), Gaps = 1/106 (0%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEI-MRT 148
           C L       +         +MIIG  P   ++  G PF G++G +LD +L S+ +   T
Sbjct: 63  CELGKNRTHAVIGRGNPTAPIMIIGEAPGQHEDEQGLPFVGRSGKLLDNILDSVGLSTDT 122

Query: 149 QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           +++IS      PP NR  +  E++ C+P ++ QI LI+P+I+L  G
Sbjct: 123 EVYISNAIRCRPPENRTPTASELQACKPYLLEQIRLINPQIILLTG 168


>gi|157737025|ref|YP_001489708.1| hypothetical protein Abu_0774 [Arcobacter butzleri RM4018]
 gi|157698879|gb|ABV67039.1| conserved hypothetical protein [Arcobacter butzleri RM4018]
          Length = 222

 Score = 68.6 bits (166), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 91/186 (48%), Gaps = 8/186 (4%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           + ELK+ +   + C LC    + +         +M I   P+ S++  G  + G +G +L
Sbjct: 43  IKELKNSVEHCYLCELCKVRKNVLFGYGNINSKIMFICDEPTKSEDELGSFYVGNSGELL 102

Query: 137 DKMLQSI-EIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
            KM++++  I +  ++I+ +           +N   + C   +++QIELI PK+++ +G 
Sbjct: 103 SKMIENVLNIKKEDVYITTLVKCKSLNGA--TNSSFDTCNDYLLKQIELIKPKLIVSLGE 160

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
           KT ++   N     +Q  GK  N  +    I  +A   P  L++ P +KK+ ++ ++ +K
Sbjct: 161 KTYSYLMKN-GDNFFQIRGKMLNFNS----IALIAVYSPTFLLRNPSLKKDAYYDMLKIK 215

Query: 256 KALKNL 261
             ++ L
Sbjct: 216 SFMEEL 221


>gi|329889045|ref|ZP_08267388.1| uracil-DNA glycosylase, family 4 family protein [Brevundimonas
           diminuta ATCC 11568]
 gi|328844346|gb|EGF93910.1| uracil-DNA glycosylase, family 4 family protein [Brevundimonas
           diminuta ATCC 11568]
          Length = 475

 Score = 68.6 bits (166), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 46/202 (22%), Positives = 85/202 (42%), Gaps = 11/202 (5%)

Query: 48  SAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEG 107
           SA +P    + + +P V +A +       L EL   ++    C L   +   +C    + 
Sbjct: 256 SAPKPNERFQRVRAPSVDRAPTDDLVPGDLDELARGVQGCRRCPLWRDATQGVCGEGPKR 315

Query: 108 QDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMIS---PWHPPGNR 164
             LM++G  P D +++ G+PF+G  G +LD   +   + R  ++++         P G R
Sbjct: 316 AALMVVGEQPGDQEDLVGRPFTGPAGRLLDAAFEEAGLHRRDLYLTNAVKHFKHEPRGKR 375

Query: 165 NL----SNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLC 220
            L    S  E++ CR  +  +  L+ P+++L +G  T                G+   + 
Sbjct: 376 RLHRTPSPSEVQACRWWLDHERRLVKPRLILALG-ATAGLAVLGRKPAVQAERGR---VI 431

Query: 221 TPHSIIPTLATVHPQELIQYPL 242
           T         TVHP  L++ P+
Sbjct: 432 TADDGARVFLTVHPAYLLRLPV 453


>gi|225619055|ref|YP_002720281.1| uracil-DNA glycosylase [Brachyspira hyodysenteriae WA1]
 gi|225213874|gb|ACN82608.1| uracil-DNA glycosylase [Brachyspira hyodysenteriae WA1]
          Length = 249

 Score = 68.6 bits (166), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 78/170 (45%), Gaps = 11/170 (6%)

Query: 78  HELKSLLRSFHDC----HLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTG 133
            ELK +      C     LC++ L+ +     E  D++ +G  P   ++  G PF G+ G
Sbjct: 58  EELKKIYSEVEKCMKCEALCNSRLNVVFGRGDEEPDIVFVGEAPGADEDKQGLPFVGRGG 117

Query: 134 NMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFI 193
            +LDK ++ + I   + +I       PP NR+    E   CR   + Q+++++PKI+  +
Sbjct: 118 KLLDKWIERMNINNKKYYIMNALKCRPPENRDPLPEEKSNCRDYFVNQLKILNPKIICAL 177

Query: 194 GNKTKNFFFNNDAQKTYQNLGKWSNLCTPHS----IIPTLATVHPQELIQ 239
           G        + D +  +   GK  N    ++     +P +AT HP  +++
Sbjct: 178 GRHGFGNLIDFDLKTPF---GKARNKVHYYNNNGKDVPVIATYHPAYILR 224


>gi|88808859|ref|ZP_01124368.1| phage SPO1 DNA polymerase-related protein [Synechococcus sp. WH
           7805]
 gi|88786801|gb|EAR17959.1| phage SPO1 DNA polymerase-related protein [Synechococcus sp. WH
           7805]
          Length = 191

 Score = 68.6 bits (166), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 59/120 (49%), Gaps = 1/120 (0%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L  L S   +   C L       +      G DLM+IG  P   ++  G PF G++G +
Sbjct: 3   ALDALNSQCAACRRCDLAHHRQKAVVGRGNPGSDLMLIGEAPGADEDSLGLPFVGRSGRL 62

Query: 136 LDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           L  +L+  E+   Q ++I  +    PP NR  +  E+  CRP +  Q+EL++P ++L  G
Sbjct: 63  LSALLKEAELDEDQDLYICNVIKCRPPNNRKPTLEEIRQCRPWLEEQLELVNPSLVLMAG 122


>gi|322368254|ref|ZP_08042823.1| phage SPO1 DNA polymerase-related protein [Haladaptatus
           paucihalophilus DX253]
 gi|320552270|gb|EFW93915.1| phage SPO1 DNA polymerase-related protein [Haladaptatus
           paucihalophilus DX253]
          Length = 195

 Score = 68.6 bits (166), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 56/106 (52%)

Query: 106 EGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRN 165
           E  D++ IG  P   ++  G+PF G++G++LD+ L+   + R  + I+      PP NR+
Sbjct: 32  EDADVLFIGEAPGAREDERGEPFVGRSGSVLDEKLRDRGLSRADVRITNCVRCRPPENRD 91

Query: 166 LSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQ 211
            +  E+  CR  + R+IEL+ P +++ +G        + D   T +
Sbjct: 92  PTTEELGNCREYLEREIELVDPDVIVTLGKVPSQHVLDRDVAVTNE 137


>gi|20092394|ref|NP_618469.1| uracil-DNA glycosylase [Methanosarcina acetivorans C2A]
 gi|19917647|gb|AAM06949.1| uracil-DNA glycosylase [Methanosarcina acetivorans C2A]
          Length = 203

 Score = 68.6 bits (166), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 58/112 (51%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C L  ++   +    +    +M IG  P  +++ +G PF+G+ G  LDKM++ + +    
Sbjct: 42  CPLHKSATKRVIGKGSCNPKVMFIGEAPGKTEDETGIPFNGRAGKKLDKMVEYMGLSEED 101

Query: 150 IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFF 201
             ++      PP NR     E+E C+P ++ QI L+ P+I++ +GN  +  +
Sbjct: 102 WFVANTVKCRPPENRRPKASEIECCKPFLIAQITLLDPEIIILLGNTAEKAY 153


>gi|260221974|emb|CBA31074.1| hypothetical protein Csp_C26730 [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 286

 Score = 68.2 bits (165), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 51/231 (22%), Positives = 93/231 (40%), Gaps = 9/231 (3%)

Query: 35  ATYESQRKEKSIDSAIQPI-TNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLC 93
           A    QR    +  A +P+   +  + S    Q  ++A  A   + L     +   C LC
Sbjct: 55  APLTEQRPSAPVPMASRPVPVQVAAVESAAPAQPSALA--ALDWNGLADTAAACESCGLC 112

Query: 94  STSL-STICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ--- 149
           +    +T+   Q    D M++G  P + ++ + + F    G +LD ML+++   R+    
Sbjct: 113 AGRKHATLQPAQQAQADWMVVGDPPEEDEDSAAQAFVEAPGLLLDNMLKAVGAGRSGSGP 172

Query: 150 --IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQ 207
              + + +    PP  RN    ++  C   + R+IEL+ PK++  +G        +    
Sbjct: 173 QGAYATNVVKCRPPHGRNPQPADLAQCAAYLQREIELVQPKVIFAVGRFAIQTLLSEHGA 232

Query: 208 KTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
              Q LGK       +  IP + +  P+ L++    K   W  L     AL
Sbjct: 233 LATQPLGKLRGSVYRYRGIPVVVSYPPKLLLRNSADKAKAWADLCLAMDAL 283


>gi|295317544|gb|ADF97921.1| uracil-DNA glycosylase [Clostridium botulinum F str. 230613]
          Length = 174

 Score = 68.2 bits (165), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 69/153 (45%), Gaps = 6/153 (3%)

Query: 110 LMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSN 168
           +M IG  P   ++ +G+PF GK G +L K L +++  R +  +I  +    P  NR    
Sbjct: 21  IMFIGEAPGADEDRTGRPFVGKAGQLLTKALLALDFKRDEHYYICNVCKCRPENNRTPKE 80

Query: 169 IEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPT 228
            E   C P +  Q+ L+ PKI++ +G     +      + T ++ GKW            
Sbjct: 81  EEAMTCLPYLRNQVALVKPKIMICLGATALKYIMGEQFRIT-RDRGKW----IERKGYYI 135

Query: 229 LATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
           +AT HP  L +    KK  W  L ++++    L
Sbjct: 136 MATFHPAALFRDESKKKLLWQDLKSIREKYDEL 168


>gi|148556998|ref|YP_001264580.1| uracil-DNA glycosylase superfamily protein [Sphingomonas wittichii
           RW1]
 gi|148502188|gb|ABQ70442.1| Uracil-DNA glycosylase superfamily [Sphingomonas wittichii RW1]
          Length = 261

 Score = 68.2 bits (165), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 74/161 (45%), Gaps = 4/161 (2%)

Query: 98  STICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISP 157
           + I A+      LM++   P   D  +G+  SG  G++ DKML ++   R  +++S ++P
Sbjct: 104 ARIAASGDPATGLMVLVDLPEAEDPANGRLLSGPAGDLFDKMLGAMGRDRQSLYLSAMAP 163

Query: 158 WHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWS 217
             P G   +   +  +   +    + L  P+ LL +G +    F N       +  G+  
Sbjct: 164 GRPSGG-FVDPTQGALFGRLARHHVLLAQPRALLLMGEQPSRTFLN---LGFVEARGRVH 219

Query: 218 NLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
           ++  P   +  +AT HP+ L+Q+P  K+  W  L  L K L
Sbjct: 220 DVQLPGGAVNAVATFHPRTLLQHPQQKRRAWEDLQLLMKLL 260


>gi|91762762|ref|ZP_01264727.1| probable DNA-directed DNA polymerase [Candidatus Pelagibacter
           ubique HTCC1002]
 gi|91718564|gb|EAS85214.1| probable DNA-directed DNA polymerase [Candidatus Pelagibacter
           ubique HTCC1002]
          Length = 243

 Score = 68.2 bits (165), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 61/264 (23%), Positives = 125/264 (47%), Gaps = 31/264 (11%)

Query: 3   SKRILSQEQILTIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSP 62
           SK++++Q+     + F   +G  ++FDE                    +PI  +++  + 
Sbjct: 2   SKKVINQKTNFD-SEFLNSTGSDFIFDE--------------------KPINRLKNTSND 40

Query: 63  L-----VQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTP 117
           L     +Q+ D + +    L  LK  + S  DC+L + S   I         +MIIG  P
Sbjct: 41  LKKDLSIQKIDKVKE----LENLKEQINSISDCNLKNNSKKIILGDGNINSLIMIIGEAP 96

Query: 118 SDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPI 177
              ++ +G  F G+ G++L KML +I I +  I+ +    + PP +R  ++ E++     
Sbjct: 97  GIEEDNAGLTFMGEVGDLLKKMLIAINIKKQNIYATYAVNFRPPEDRKPNSTEIKRYSQF 156

Query: 178 IMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQEL 237
           + + I +I+PKI++ +G+         +++ + +  GKW  +   ++    + T +P  L
Sbjct: 157 LQKHISIINPKIIILMGSTAMESLTGLNSKISIER-GKWKEVIIKNTSYNVIITFNPSYL 215

Query: 238 IQYPLIKKNTWHALITLKKALKNL 261
           ++ P  KK++W  L  +K+ + +L
Sbjct: 216 LRAPENKKHSWDDLKKIKQKILDL 239


>gi|168187460|ref|ZP_02622095.1| uracil-DNA glycosylase family 4 protein [Clostridium botulinum C
           str. Eklund]
 gi|169294650|gb|EDS76783.1| uracil-DNA glycosylase family 4 protein [Clostridium botulinum C
           str. Eklund]
          Length = 185

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 76/170 (44%), Gaps = 6/170 (3%)

Query: 88  HDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR 147
           H C+L     + +         LM IG  P   ++ +G+PF G+ GN+L K L ++++ R
Sbjct: 15  HKCNLVEGRNNMVFGEGNPKAKLMFIGEAPGADEDRTGRPFVGRAGNLLTKGLMALDLHR 74

Query: 148 TQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDA 206
            +  +I+ I    P  NRN    E   C   +  Q+ LI P+I++ +G     +  + D 
Sbjct: 75  EKDYYITNICKCRPENNRNPMEHEAYACIQYLRNQVALIKPEIIVCLGAVAGKYIIDKDL 134

Query: 207 QKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
           + T ++ G W         I  +   HP  +++    K   W  L  +K+
Sbjct: 135 RIT-RDRGMW----VEKKGIYIMPIFHPAAILRDDKKKVMFWKDLKEIKR 179


>gi|294101873|ref|YP_003553731.1| phage SPO1 DNA polymerase-related protein [Aminobacterium
           colombiense DSM 12261]
 gi|293616853|gb|ADE57007.1| phage SPO1 DNA polymerase-related protein [Aminobacterium
           colombiense DSM 12261]
          Length = 212

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 60/204 (29%), Positives = 93/204 (45%), Gaps = 17/204 (8%)

Query: 64  VQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNI 123
           +++A  +A K     EL   + S   C L  T +ST+         LM++G  P + ++ 
Sbjct: 14  IKEAQKLAWK-----ELIQQISSCGKCGLHKTRVSTVPGEGNTKTHLMLVGEGPGEEEDE 68

Query: 124 SGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIE 183
            GKPF GK G +L K+L++  I R  ++I+ +    PP NR  +  EM  C   +  QI 
Sbjct: 69  QGKPFVGKAGQLLTKILKAAGISRKDVYITNVVKCRPPHNRVPAIEEMMTCNMYLEAQIA 128

Query: 184 LISPKILLFIGNKTKNFFFNNDAQKTYQNL-GKWSNLCTPHSIIPTLATVHPQELIQYPL 242
           LI P I+L +GN    +F      +   NL G+W         I  +   HP  L++   
Sbjct: 129 LIRPSIILCLGNTPTKWFLKTS--EGISNLRGRWFKW----RGIDLMPIFHPSYLLRNES 182

Query: 243 IKKN-----TWHALITLKKALKNL 261
            KK      TW  +  +K+ L  L
Sbjct: 183 RKKGSPKDLTWQDIRAVKEKLDQL 206


>gi|103486672|ref|YP_616233.1| uracil-DNA glycosylase superfamily protein [Sphingopyxis alaskensis
           RB2256]
 gi|98976749|gb|ABF52900.1| Uracil-DNA glycosylase superfamily [Sphingopyxis alaskensis RB2256]
          Length = 262

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 54/239 (22%), Positives = 98/239 (41%), Gaps = 29/239 (12%)

Query: 26  WVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLR 85
           W+   P N+A     R+  +  +  QP+ +     S         +++        +L  
Sbjct: 33  WLAMSPANDAAASRPRRTATAAAEPQPLPDALQRQS---------SERPVESRGPTALPA 83

Query: 86  SFHDCHLCSTSLSTICATQTEGQDLMIIGYT----------PSDSDNISGKPFSGKTGNM 135
            + D H    S   +  +Q + + ++ +G            P   D   G+ F+G  G +
Sbjct: 84  DWKDFHQWLGSSEAVPGSQWDARRVLPVGEAAAPLMLLTAWPEIDDQREGQLFAGPAGKL 143

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           LD MLQ+I ++R Q +++ ++   PPG R  ++   E+ R ++   + L  P+ LL IG 
Sbjct: 144 LDAMLQAIGLVRRQCYVASLAVTRPPGGRIDAHDAAELDR-LLWHHLRLAMPQRLLLIGG 202

Query: 196 KTKNFFFN---NDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
                      +DA+      GK  +L      + T+A  HP  L+  P  K   W +L
Sbjct: 203 DIVRIAAGLTLSDAR------GKLLDLNQDGGKMETVAVAHPAMLLARPAQKAAAWDSL 255


>gi|126730048|ref|ZP_01745860.1| Uracil-DNA glycosylase superfamily protein [Sagittula stellata
           E-37]
 gi|126709428|gb|EBA08482.1| Uracil-DNA glycosylase superfamily protein [Sagittula stellata
           E-37]
          Length = 488

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 83/181 (45%), Gaps = 14/181 (7%)

Query: 71  AQKACSLHELKSLLRSFHDCHLC---STSLSTICATQTEGQDLMIIGYTPSDSDNISGKP 127
           A++A  L    + L +   C  C    ++   +     E   LM +G  P D+++++G+P
Sbjct: 273 AEQAAKLDTQDAFLTALKSCRRCPLWESATQPVAGEGPEDAALMFVGEQPGDTEDLTGRP 332

Query: 128 FSGKTGNMLDKMLQSIEIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRPIIMR 180
           F+G  G M DK LQ   I R +  ++       + P G R L       E+  C+  +  
Sbjct: 333 FTGPAGQMFDKALQVNGIRRQEAFVTNAVKHFKFRPRGKRRLHQNPDRDEIAHCKWWLDL 392

Query: 181 QIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQY 240
           +I+ ++P++++ +G  T         +   +  G++ +  TP    P L TVHP  +++ 
Sbjct: 393 EIQRVAPRLIVVMGG-TALQSLTGSREGLLKRRGRFEH--TPED-TPILVTVHPSYILRL 448

Query: 241 P 241
           P
Sbjct: 449 P 449


>gi|327398392|ref|YP_004339261.1| phage SPO1 DNA polymerase-like protein [Hippea maritima DSM 10411]
 gi|327181021|gb|AEA33202.1| phage SPO1 DNA polymerase-related protein [Hippea maritima DSM
           10411]
          Length = 209

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 65/152 (42%), Gaps = 5/152 (3%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C L  T  + +        DLM +G  P   +++ G+PF G+ G +L  +L+ I I    
Sbjct: 44  CELHKTRTNVVFGEGNINADLMFVGEAPGRDEDVQGRPFVGRAGRLLRDILRDIGIKPQD 103

Query: 150 IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKT 209
           ++I+      PP NR+    E+  C   + +QI LI PKI+  +G  +     N      
Sbjct: 104 VYIANCLKCRPPNNRDPLPEELVACFGYLKQQISLIKPKIIATLGRYSTYELTNQKGA-- 161

Query: 210 YQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
              LG        +  I  +   HP  L++ P
Sbjct: 162 ---LGTLRGKVFVYGNIKVIPLYHPAYLLRNP 190


>gi|118575792|ref|YP_875535.1| uracil-DNA glycosylase [Cenarchaeum symbiosum A]
 gi|118194313|gb|ABK77231.1| uracil-DNA glycosylase [Cenarchaeum symbiosum A]
          Length = 216

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 55/105 (52%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C LC    + +  T       +++G  P   +++ GKPF G  G +LDK L+   I R+ 
Sbjct: 51  CGLCEGRTNAVPGTGPASARAILVGEAPGREEDLQGKPFVGGAGRVLDKELERAGIPRST 110

Query: 150 IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           ++I+ +    PP NR  S+ E + C   +  +I +I+P+I+  +G
Sbjct: 111 VYITNVVKCRPPKNRVPSDEERDACIEYLKEEISVINPRIVCILG 155


>gi|119898540|ref|YP_933753.1| putative DNA polymerase related protein [Azoarcus sp. BH72]
 gi|119670953|emb|CAL94866.1| putative DNA polymerase related protein [Azoarcus sp. BH72]
          Length = 216

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/182 (21%), Positives = 81/182 (44%), Gaps = 14/182 (7%)

Query: 67  ADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGK 126
           A    Q   +L EL++   +   C L   +  T+     +   +M++G  P D+++  G 
Sbjct: 10  AAPFVQPDATLAELRAAAGACTGCDLYRDATQTVFGEGPDDAPVMLVGEQPGDAEDRQGH 69

Query: 127 PFSGKTGNMLDKMLQSIEIMRTQIHIS--------MISPWHPPGNRNLSNIEMEICRPII 178
           PF G  G +LD+ L    I R++ +++        + +  H   ++    +E++ C P +
Sbjct: 70  PFVGPAGKLLDRALTDAGIDRSRSYVTNAVKHFKWIFTRGHKRLHQTPRTVEVQACAPWL 129

Query: 179 MRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIP-TLATVHPQEL 237
             +I  + P++L+ +G         +  + T Q       +  P  + P  +AT+HP  L
Sbjct: 130 EAEIARVKPQVLILLGATAAKSLLGSGFRVTAQR-----GVPQPSPLAPRVVATIHPSAL 184

Query: 238 IQ 239
           ++
Sbjct: 185 LR 186


>gi|302382564|ref|YP_003818387.1| phage SPO1 DNA polymerase-related protein [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302193192|gb|ADL00764.1| phage SPO1 DNA polymerase-related protein [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 481

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 55/210 (26%), Positives = 89/210 (42%), Gaps = 13/210 (6%)

Query: 41  RKEKSIDSA-IQPITNIRHIHSPLVQQADSIAQK-ACSLHELKSLLRSFHDCHLCSTSLS 98
           R E  +DSA   P   +    +P V+      Q+    L EL+  ++    C L   +  
Sbjct: 253 RTETMVDSAPTLPNAKLASAVAPDVRGGGLDDQQIVGDLGELRQAIQGCRRCPLWRDATQ 312

Query: 99  TICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMIS-- 156
            +C     G  LMI+G  P D ++++G PF G  G +LD  L+   I R+ ++++     
Sbjct: 313 GVCGVGPVGARLMIVGEQPGDQEDLAGLPFVGPAGQVLDAALEEAGIDRSDVYVTNAVKH 372

Query: 157 -PWHPPGNRNLSNI----EMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQ 211
               P G R L       E+  CR  + ++  L+ P + L +G  T  F   N      +
Sbjct: 373 FKHEPRGKRRLHKTPNAGEVTACRWWLDQERTLVRPSLTLTLG-ATAAFAVLNQKVAVMK 431

Query: 212 NLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
             G+   L  P      + TVHP  L++ P
Sbjct: 432 TRGE--PLPLPDGSR-AMVTVHPSYLLRLP 458


>gi|302348684|ref|YP_003816322.1| Uracil-DNA glycosylase [Acidilobus saccharovorans 345-15]
 gi|302329096|gb|ADL19291.1| Uracil-DNA glycosylase [Acidilobus saccharovorans 345-15]
          Length = 213

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/180 (21%), Positives = 80/180 (44%), Gaps = 5/180 (2%)

Query: 69  SIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPF 128
           S+  K  S  ++   +R+   C L     + +         +M++G  P  +++  G+PF
Sbjct: 5   SLDNKKASYDDIAERVRNCKACPLHRLRTNAVPGEGNLSAKIMLVGEAPGKNEDEQGRPF 64

Query: 129 SGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPK 188
            G  G +L  +L+   + R  ++I+ +    PP NR  +  E+  C   +  +I L+ PK
Sbjct: 65  VGAAGQLLSSLLEQAGLRRQDVYITNVVKCRPPNNRTPTEDEVAACIGFLKEEISLVRPK 124

Query: 189 ILLFIGNKTKNFFFNNDAQKTYQNL----GKWSNLCTPHSIIPTLATVHPQELIQYPLIK 244
           +++ +GN T      + A K ++ +    G+   +      +  + T HP   +  P +K
Sbjct: 125 VIVALGN-TAGSALMSLAGKQWRGVTAERGRKVKVSIGGVELTVIPTYHPAAALYKPDLK 183


>gi|152979854|ref|YP_001353212.1| DNA polymerase bacteriophage-type [Janthinobacterium sp. Marseille]
 gi|151279931|gb|ABR88341.1| DNA polymerase bacteriophage-type [Janthinobacterium sp. Marseille]
          Length = 286

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 85/196 (43%), Gaps = 10/196 (5%)

Query: 61  SPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDS 120
           S ++Q A  IA  +    +LK ++ +  +C LC     T+     +    + +G  P  +
Sbjct: 83  SAVLQPARDIA--SMGWEQLKEVVSNCTECGLCKGRTQTVFGVGDQKAKWLFVGEGPGRN 140

Query: 121 DNISGKPFSGKTGNMLDKMLQSIEIMRTQ-IHISMISPWHP--PGNRNLSNI--EMEICR 175
           ++  G+PF G  G +LD M  ++ + R +  +I+ I    P     R+ + +  E + C 
Sbjct: 141 EDFQGEPFVGPAGKLLDNMFIAMGLKRGENTYIANIVKCRPTDENKRDRAPVAQESDACM 200

Query: 176 PIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQ 235
           P + RQI L++P +++ +G          D       L         ++ IP + T HP 
Sbjct: 201 PYLQRQIALVNPTVIVALGKTAALSLLKLDPATPVARL---RGTVHRYADIPVVVTYHPA 257

Query: 236 ELIQYPLIKKNTWHAL 251
            L++    K   W  L
Sbjct: 258 YLLRTLKDKSKAWADL 273


>gi|257075752|ref|ZP_05570113.1| DNA polymerase [Ferroplasma acidarmanus fer1]
          Length = 321

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 56/86 (65%), Gaps = 1/86 (1%)

Query: 110 LMIIGYTPSDSDNISGKPFSGKTGNMLDKML-QSIEIMRTQIHISMISPWHPPGNRNLSN 168
           + I+G  P  +++I  KPF G++G +L+ ++   + + R  ++I+ +  + PP NR  S+
Sbjct: 177 IFIVGQAPGRNEDIMKKPFVGRSGKLLESLITDELHMDRESLYITSVVQFFPPENRAPSD 236

Query: 169 IEMEICRPIIMRQIELISPKILLFIG 194
            E+ +C P +M+QIE+++P I++ +G
Sbjct: 237 DEIALCLPYLMKQIEIVNPAIIVLLG 262


>gi|71082815|ref|YP_265534.1| DNA-directed DNA polymerase [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|71061928|gb|AAZ20931.1| probable DNA-directed DNA polymerase [Candidatus Pelagibacter
           ubique HTCC1062]
          Length = 243

 Score = 67.0 bits (162), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 59/261 (22%), Positives = 123/261 (47%), Gaps = 31/261 (11%)

Query: 3   SKRILSQEQILTIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSP 62
           SK++++Q+     + F   +G  ++FDE                    +PI  +++  + 
Sbjct: 2   SKKVINQKTNFD-SEFLNSTGSDFIFDE--------------------KPINRLKNTSND 40

Query: 63  L-----VQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTP 117
           L     +Q+ D + +    L  LK  + S  DC+L + S   I         +M+IG  P
Sbjct: 41  LKKDLSIQKIDKVKE----LANLKEQINSISDCNLKNNSKKIILGDGNINSPIMLIGEAP 96

Query: 118 SDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPI 177
              ++ +G  F G+ G++L KML +I I +  I+ +    + PP +R  ++ E++     
Sbjct: 97  GVEEDNAGLTFMGEVGDLLKKMLIAINIEKQNIYTTYAVNFRPPEDRKPNSTEIKRYSQF 156

Query: 178 IMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQEL 237
           + + I +I+PKI++ +G+         +++ + +  GKW  +   ++    + T +P  L
Sbjct: 157 LQKHISIINPKIIILMGSTAMESLTGLNSKISIER-GKWKEVIVKNTSYNVIITFNPSYL 215

Query: 238 IQYPLIKKNTWHALITLKKAL 258
           ++ P  KK++W  L  +K+ +
Sbjct: 216 LRAPENKKHSWDDLKKIKQKI 236


>gi|209884314|ref|YP_002288171.1| transcriptional regulator, Fis family [Oligotropha carboxidovorans
           OM5]
 gi|209872510|gb|ACI92306.1| transcriptional regulator, Fis family [Oligotropha carboxidovorans
           OM5]
          Length = 209

 Score = 67.0 bits (162), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 71/159 (44%), Gaps = 11/159 (6%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           CHL   +  T+         +M +G  P D ++++G+PF G  G +LD+ L+   I R +
Sbjct: 29  CHLYKNATQTVFGEGAAHAAVMFVGEQPGDKEDLAGRPFVGPAGQVLDRGLKEAGIARNK 88

Query: 150 IHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFF 202
            +I+       + P G   L    +  E++ CRP   R++  + P +++ +G       F
Sbjct: 89  TYITNAVKHFKFVPRGKIRLHQKPTTPEIKACRPWYERELATVKPALVVAMGATAAQCVF 148

Query: 203 NNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
                   +N G+  +L         L TVHP  L++ P
Sbjct: 149 GK-ITPIGKNRGRLFDLAEDAK---ALVTVHPSYLLRLP 183


>gi|118473024|ref|YP_884681.1| uracil DNA glycosylase superfamily protein [Mycobacterium smegmatis
           str. MC2 155]
 gi|118174311|gb|ABK75207.1| uracil DNA glycosylase superfamily protein [Mycobacterium smegmatis
           str. MC2 155]
          Length = 209

 Score = 67.0 bits (162), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 39/170 (22%), Positives = 78/170 (45%), Gaps = 10/170 (5%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C L   +   +         +M+IG  P D ++++G PF G  G +LD+ L++ +I R  
Sbjct: 27  CGLYRDATQAVFGAGGRSARIMMIGEQPGDKEDLAGLPFVGPAGRLLDRALEAADIDRDA 86

Query: 150 IHISMISP-----WHPPGNRNL----SNIEMEICRPIIMRQIELISPKILLFIGNKTKNF 200
           ++++             G R +    S  E+  CRP ++ ++  + P +++ +G      
Sbjct: 87  LYVTNAVKHFKFTRAAGGKRRIHKTPSRTEVVACRPWLIAEMTSVEPDVVVLLGATAAKA 146

Query: 201 FFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHA 250
              ND + T Q+ G+  ++         +ATVHP  L++ P  ++ +  A
Sbjct: 147 LLGNDFRVT-QHRGEVLHVDDVPGDPALVATVHPSSLLRGPKEERESAFA 195


>gi|15896249|ref|NP_349598.1| Uracil-DNA glycosylase [Clostridium acetobutylicum ATCC 824]
 gi|15026053|gb|AAK80938.1|AE007796_8 Uracil-DNA glycosylase [Clostridium acetobutylicum ATCC 824]
 gi|325510404|gb|ADZ22040.1| Uracil-DNA glycosylase [Clostridium acetobutylicum EA 2018]
          Length = 206

 Score = 67.0 bits (162), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 46/190 (24%), Positives = 75/190 (39%), Gaps = 26/190 (13%)

Query: 88  HDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR 147
             C L     + +         LM +G  P   ++  G+PF G+ G +L K L ++ + R
Sbjct: 15  QKCRLGENRTNMVFGEGNPEAKLMFVGEAPGADEDRLGRPFVGRAGQLLTKGLTALNLSR 74

Query: 148 TQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN----------- 195
            +  +I+ +    P  NR     E E C P +  Q  LI PKIL+ +G+           
Sbjct: 75  DRDYYIANVCKCRPEKNRTPYEDEAEACMPYLRNQFALIKPKILVCLGSTAMKFIMEPAL 134

Query: 196 ----------KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKK 245
                     + +N  + N   +  ++ GKW  +      I  +AT HP  L +    K 
Sbjct: 135 NKILQQNNTIEEENLIWKNGQMRITRDRGKWLKV----KGIYMMATFHPAALFRDENKKT 190

Query: 246 NTWHALITLK 255
             W  L  +K
Sbjct: 191 AFWEDLKLIK 200


>gi|48478092|ref|YP_023798.1| DNA polymerase [Picrophilus torridus DSM 9790]
 gi|48430740|gb|AAT43605.1| DNA polymerase, bacteriophage-type [Picrophilus torridus DSM 9790]
          Length = 360

 Score = 66.6 bits (161), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 54/86 (62%)

Query: 109 DLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSN 168
           +++ +G  P  +++   +PF G++G +L+ ML  I I R  ++I+ +  ++P  NR    
Sbjct: 214 EIVFVGQAPGKTEDEMKRPFVGRSGRILNSMLSMININRESVYITSVVQFYPEKNRVPDK 273

Query: 169 IEMEICRPIIMRQIELISPKILLFIG 194
            E++ C P + RQ+++ISPKI++ +G
Sbjct: 274 SEIDACFPYLKRQLDVISPKIIVILG 299


>gi|227498884|ref|ZP_03929024.1| uracil-DNA glycosylase [Acidaminococcus sp. D21]
 gi|226904336|gb|EEH90254.1| uracil-DNA glycosylase [Acidaminococcus sp. D21]
          Length = 212

 Score = 66.6 bits (161), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 45/167 (26%), Positives = 75/167 (44%), Gaps = 8/167 (4%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQD---LMIIGYTPSDSDNISGKPFSGKTG 133
           + EL  L R   DC  C      I      G     L+I+G  P   ++  G P  G +G
Sbjct: 1   MEELDILQRKMEDCTACPLRGDCIAPVGWFGDPHSPLVIVGEGPGGVEDDYGCPLIGPSG 60

Query: 134 NMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEIC-RPIIMRQIELISPKILLF 192
            +LDK L S++I R  +  + +    P  NR  +  E   C   I+  ++ LI+PK+++ 
Sbjct: 61  QLLDKALWSVKITRDHVLTTNVIKCRPRNNRTPTPEEAAFCAHRILDEELRLIAPKVIIA 120

Query: 193 IGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ 239
           +G     +F   +A+ T +  G+W      +     +AT HP  L++
Sbjct: 121 LGGVALKYFKGPEARITKER-GQWFRT---NQGFDAIATFHPSYLLR 163


>gi|296241955|ref|YP_003649442.1| phage SPO1 DNA polymerase-like protein [Thermosphaera aggregans DSM
           11486]
 gi|296094539|gb|ADG90490.1| phage SPO1 DNA polymerase-related protein [Thermosphaera aggregans
           DSM 11486]
          Length = 202

 Score = 66.6 bits (161), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 56/114 (49%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C L    ++T+         +++IG  P   ++  G PF G  G +L+ +L++  + R +
Sbjct: 20  CRLHENRINTVPGEGPLTAKVVLIGEAPGRKEDEVGSPFVGPAGRLLNTLLENSGLKREE 79

Query: 150 IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFN 203
           + I+ I    PPGNR     E+  C   + RQ+ LI P++L+ +GN      + 
Sbjct: 80  VFITNIVKCRPPGNRKPRRDEISQCLGYLGRQLRLIKPRVLILLGNTAAETIYG 133


>gi|58578289|emb|CAI48083.1| hypothetical protein [uncultured bacterium]
          Length = 208

 Score = 66.6 bits (161), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 53/101 (52%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C L  T  + +    +    ++ +G  P   ++  G PF GK G +L  ++ ++ + R +
Sbjct: 74  CPLAQTRKNVVFGAGSLSAQVVFVGEAPGADEDEQGLPFVGKAGQLLTNIITAMGLTRKE 133

Query: 150 IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKIL 190
           ++I  I    PPGNR     E+ +C P + RQ+ LI+P+IL
Sbjct: 134 VYICNILKCRPPGNRTPLPEEIRLCEPFLKRQLSLIAPQIL 174


>gi|148269551|ref|YP_001244011.1| phage SPO1 DNA polymerase-related protein [Thermotoga petrophila
           RKU-1]
 gi|170288227|ref|YP_001738465.1| phage SPO1 DNA polymerase-related protein [Thermotoga sp. RQ2]
 gi|281411730|ref|YP_003345809.1| phage SPO1 DNA polymerase-related protein [Thermotoga naphthophila
           RKU-10]
 gi|147735095|gb|ABQ46435.1| phage SPO1 DNA polymerase-related protein [Thermotoga petrophila
           RKU-1]
 gi|170175730|gb|ACB08782.1| phage SPO1 DNA polymerase-related protein [Thermotoga sp. RQ2]
 gi|281372833|gb|ADA66395.1| phage SPO1 DNA polymerase-related protein [Thermotoga naphthophila
           RKU-10]
          Length = 193

 Score = 66.6 bits (161), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 37/153 (24%), Positives = 70/153 (45%), Gaps = 6/153 (3%)

Query: 90  CHLCSTSLSTICATQTEGQ---DLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIM 146
           C  C   L+       EG     ++ +G  P + ++ +G+PF G+ G +L ++L+   I 
Sbjct: 18  CTACPLHLNRTNVVVGEGNLDTRIVFVGEGPGEEEDKTGRPFVGRAGMLLTELLRESGIR 77

Query: 147 RTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDA 206
           R  ++I  +    PP NR  +  E   C   ++ QIE+I+P +++ +G    +F  +   
Sbjct: 78  REDVYICNVVKCRPPNNRTPTPEEQAACGHFLLAQIEIINPDVIVALGATALSFLMDGKK 137

Query: 207 QKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ 239
               +  G   +      +IPT    HP  L++
Sbjct: 138 VSITKIRGNPIDWLAGKKVIPTF---HPSYLLR 167


>gi|120404181|ref|YP_954010.1| phage SPO1 DNA polymerase--like protein [Mycobacterium vanbaalenii
           PYR-1]
 gi|119956999|gb|ABM14004.1| phage SPO1 DNA polymerase-related protein [Mycobacterium
           vanbaalenii PYR-1]
          Length = 217

 Score = 66.6 bits (161), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 41/196 (20%), Positives = 83/196 (42%), Gaps = 24/196 (12%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L  L +  +S   C L   +   +  +   G  +M++G  P D ++++G+PF G  G +L
Sbjct: 16  LSTLAAAAQSCRGCDLFENASRAVFGSGPVGARMMLVGEQPGDREDVAGEPFVGPAGRLL 75

Query: 137 DKMLQSIEIMRTQI-------HISMISPWHPPGNRNL----SNIEMEICRPIIMRQIELI 185
           DK L    + R  +       H   +      G R +    S  E+  CRP ++ +++ +
Sbjct: 76  DKALDEAGLPRAPVYLTNAVKHFKFVPAER--GTRRIHKTPSRTEVVACRPWLIAEMQAV 133

Query: 186 SPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIP-------TLATVHPQELI 238
            P +++ +G         N  + T     +   L  P    P        + TVHP  ++
Sbjct: 134 EPAVVVLLGATAAKSLLGNAFRLTAH---RGEVLSLPAETKPVGGRDAKVVVTVHPSSVL 190

Query: 239 QYP-LIKKNTWHALIT 253
           + P   ++ ++ +L++
Sbjct: 191 RGPSQAREESFRSLVS 206


>gi|70606003|ref|YP_254873.1| uracil DNA glycosylase superfamily protein [Sulfolobus
           acidocaldarius DSM 639]
 gi|68566651|gb|AAY79580.1| uracil DNA glycosylase superfamily protein [Sulfolobus
           acidocaldarius DSM 639]
          Length = 213

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 77/173 (44%), Gaps = 7/173 (4%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQ---DLMIIGYTPSDSDNISGKPFSGKTGNM 135
           EL  +      C  C   +    A   EG     +M IG  P ++++  G+PF G  G +
Sbjct: 2   ELDEIANEIKVCRKCKLWMDRRNAVPGEGNPKAKVMFIGEAPGETEDEEGRPFVGSAGKL 61

Query: 136 LDKMLQ-SIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           L K+++ ++ I R ++ I+ +    PP NR+    E+  C   +  QI LI P++++ +G
Sbjct: 62  LTKLIEDTLGIKRDEVFITNVVKCRPPNNRDPEEDEITACSSYLDLQIRLIKPQVIVTLG 121

Query: 195 NKTKNFFF---NNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIK 244
             + ++     N +     ++ GK         +I    T HP   +  P ++
Sbjct: 122 RHSTSYILSKANIEFHSITKSRGKVYEWKIDDHVINIFPTYHPAAALYNPNLR 174


>gi|153877406|ref|ZP_02004223.1| conserved hypothetical protein [Beggiatoa sp. PS]
 gi|152066130|gb|EDN65777.1| conserved hypothetical protein [Beggiatoa sp. PS]
          Length = 91

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 50/91 (54%)

Query: 111 MIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIE 170
           M+IG  P   ++  G+PF G  G +L+ ML++I+  R +++I+ +    PPGNRN    E
Sbjct: 1   MLIGEAPGADEDAVGEPFVGPAGQLLNAMLRAIDFKREEVYIANMVKCRPPGNRNPKLEE 60

Query: 171 MEICRPIIMRQIELISPKILLFIGNKTKNFF 201
           M  C   +  QI LI PK++  +     N F
Sbjct: 61  MVCCHGFLQHQISLIKPKLIELLAELLLNIF 91


>gi|126435587|ref|YP_001071278.1| phage SPO1 DNA polymerase-related protein [Mycobacterium sp. JLS]
 gi|126235387|gb|ABN98787.1| phage SPO1 DNA polymerase-related protein [Mycobacterium sp. JLS]
          Length = 229

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 43/193 (22%), Positives = 81/193 (41%), Gaps = 25/193 (12%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKM 139
           L   +++   C L   +   +    +    +M +G  P D ++ +G+PF G  G +LDK 
Sbjct: 21  LADAVQACRGCELYRDATQGVFGQGSADATVMFVGEQPGDREDRAGEPFVGPAGRLLDKA 80

Query: 140 LQSIEIMRTQI-------HISMISPWHPPGNRNL----SNIEMEICRPIIMRQIELISPK 188
           L S  I R  +       H     P    G R +    S  E+  CRP ++ +++ + P+
Sbjct: 81  LVSAGIDRDGVYVTNAVKHFKFTLPER--GKRRIHKTPSRTEVVACRPWLLAELDAVRPE 138

Query: 189 ILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPT--------LATVHPQELIQY 240
           +++ +G         ND + T +   +   L  P    P         +AT HP  +++ 
Sbjct: 139 VVVLLGATAAKALLGNDFRLTAR---RGEVLALPPVTEPADLDVDPAVVATAHPSSVLRG 195

Query: 241 PLI-KKNTWHALI 252
           P   ++  + AL+
Sbjct: 196 PAENRQQAFDALV 208


>gi|33863050|ref|NP_894610.1| Uracil-DNA glycosylase [Prochlorococcus marinus str. MIT 9313]
 gi|33634967|emb|CAE20953.1| Uracil-DNA glycosylase [Prochlorococcus marinus str. MIT 9313]
          Length = 207

 Score = 66.2 bits (160), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 69/133 (51%), Gaps = 6/133 (4%)

Query: 110 LMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEI-MRTQIHISMISPWHPPGNRNLSN 168
           LM+IG  P   ++  GKPF G++G ++D++++S+ +  +T  +I  +    PP NR  + 
Sbjct: 38  LMLIGEAPGAREDELGKPFVGRSGQLIDRLMESVGLDPQTDAYICNVVKCRPPKNRRPTL 97

Query: 169 IEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPT 228
           +E+  CRP + +QIEL+ P ++   G+             T    G+W +      ++P 
Sbjct: 98  VEIASCRPWLQQQIELVDPCVIALAGSTAVEAILGIKGGITRLR-GQWQHW-QGRLLMPL 155

Query: 229 LATVHPQELIQYP 241
           L   HP  L++ P
Sbjct: 156 L---HPAYLLRNP 165


>gi|296161715|ref|ZP_06844518.1| phage SPO1 DNA polymerase-related protein [Burkholderia sp. Ch1-1]
 gi|295888029|gb|EFG67844.1| phage SPO1 DNA polymerase-related protein [Burkholderia sp. Ch1-1]
          Length = 214

 Score = 65.9 bits (159), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 37/166 (22%), Positives = 74/166 (44%), Gaps = 14/166 (8%)

Query: 86  SFHDCHLCSTSLSTICATQTEG---QDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQS 142
           S  +C  C+   +   A   EG     +M++G  P D++++ G+PF G  G +LDK L+ 
Sbjct: 28  SLDECRRCALWRNATQAVPGEGPQRASIMLVGEQPGDAEDLQGRPFVGPAGALLDKALEE 87

Query: 143 IEIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELISPKILLFIGN 195
             + R  ++++       W P G R +       E+E C   + +++  +  ++++ +G 
Sbjct: 88  AGLKRKDVYVTNAVKHFKWTPRGKRRMHKTPGQREIEACGYWLEQELRAVGARVIVALGA 147

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
                  ++   +   +LGK       H     +AT HP   ++ P
Sbjct: 148 TALKAVLDDSHARLQDSLGK----TIGHGEHLVVATYHPSFALRAP 189


>gi|330813682|ref|YP_004357921.1| uracil-DNA glycosylase, family 4 [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327486777|gb|AEA81182.1| uracil-DNA glycosylase, family 4 [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 227

 Score = 65.9 bits (159), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 83/171 (48%), Gaps = 4/171 (2%)

Query: 92  LCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIH 151
           +  T+   I + +     +M++G  PS  D  + + FS  +G +L KML +I I  +Q++
Sbjct: 58  VTGTNKKIILSNKNYKSKIMVLGDMPSQKDIDNNELFSDDSGELLTKMLGAISIDSSQVY 117

Query: 152 ISMISPWH--PPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKT 209
           ++ I P++      +N+      + R I+   I  I+P  +L +G+      F  +    
Sbjct: 118 LANIIPFYLTKEEGKNIKKYN-SLLRKIVHEHISTINPGTILLLGSFALQTLFGEEYS-I 175

Query: 210 YQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
            +N G+W +    ++ I  + + HP  L++ P  KK +W  L  L+K L N
Sbjct: 176 AKNRGQWLSYSAANNSINIIPSFHPTFLLKQPSQKKKSWEDLQKLQKKLNN 226


>gi|108762098|ref|YP_630262.1| uracil-DNA glycosylase [Myxococcus xanthus DK 1622]
 gi|108465978|gb|ABF91163.1| uracil-DNA glycosylase, family 4 [Myxococcus xanthus DK 1622]
          Length = 231

 Score = 65.9 bits (159), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 81/180 (45%), Gaps = 27/180 (15%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQD-----LMIIGYTPSDSDNISGKPFSGKTG 133
           +L+        C L  T   T+   + EGQ      +M++G  P D ++ +G+PF G +G
Sbjct: 26  KLRKAAAGCQACPLWRTGTQTVFG-EPEGQPRPGPRVMLVGEQPGDQEDRAGRPFVGPSG 84

Query: 134 NMLDKMLQSIEIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELIS 186
            +LD+ L++  I R Q++++       W   G R +    +  E+  C P +  +I +  
Sbjct: 85  RLLDEALEAAGIDRAQVYVTNTVKHFKWTGQGPRRIHAKPTTTEIRACLPWLEAEIRVFR 144

Query: 187 PKILLFIGNKTKNFFFNNDAQKTYQNLGK-----WSNLCTPHSIIPTLATVHPQELIQYP 241
           P +L+ +G           A +  Q+ G+     W+ +         +ATVHP  +++ P
Sbjct: 145 PDVLVCLGATAAQALLGK-AFRVTQSRGQPMASEWARV--------VVATVHPSSILRAP 195


>gi|239815784|ref|YP_002944694.1| phage SPO1 DNA polymerase-related protein [Variovorax paradoxus
           S110]
 gi|239802361|gb|ACS19428.1| phage SPO1 DNA polymerase-related protein [Variovorax paradoxus
           S110]
          Length = 237

 Score = 65.9 bits (159), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 41/196 (20%), Positives = 84/196 (42%), Gaps = 25/196 (12%)

Query: 66  QADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISG 125
           +A S+A  AC             +C L + +  ++      G  LM++G  P D +++ G
Sbjct: 12  KALSVATDAC------------RECPLGAHATQSVFGEGPVGAALMVVGEQPGDKEDLVG 59

Query: 126 KPFSGKTGNMLDKMLQSIEIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRPII 178
           +PF G  G + D+ +  +   R +++++       + P G R +       E++ C   +
Sbjct: 60  RPFVGPAGKLFDRAVAELGWSREKLYVTNAVKHFKYEPRGKRRMHKTPGQREVDACHHWL 119

Query: 179 MRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKW-SNLCTPHSIIPTLATVHPQEL 237
             ++EL+ P+  + +G                +  G+W  +  T   +   L T+HP  L
Sbjct: 120 ESEMELVQPRACIALGGTAARSLLGRPVA-VMKERGQWVEDAATGRRV---LVTLHPSAL 175

Query: 238 IQY-PLIKKNTWHALI 252
           ++  PL ++  W A +
Sbjct: 176 LRGDPLQREAAWEAWL 191


>gi|75676446|ref|YP_318867.1| phage SPO1 DNA polymerase-related protein [Nitrobacter winogradskyi
           Nb-255]
 gi|74421316|gb|ABA05515.1| phage SPO1 DNA polymerase-related protein [Nitrobacter winogradskyi
           Nb-255]
          Length = 225

 Score = 65.9 bits (159), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 83/182 (45%), Gaps = 14/182 (7%)

Query: 70  IAQKACSLHELKSLLRSFHDCHLC---STSLSTICATQTEGQDLMIIGYTPSDSDNISGK 126
           +A+++ +   L SL      C  C     +  T+         +M++G  P D ++++GK
Sbjct: 19  MARQSSAHDSLPSLREEAAGCRACPLWKDATQTVFGEGLAHAQVMLVGEQPGDKEDLAGK 78

Query: 127 PFSGKTGNMLDKMLQSIEIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRPIIM 179
           PF G  G MLD+ L+   I RT+++++       + P G   L    +  E+  CRP   
Sbjct: 79  PFIGPAGQMLDRALKEAGIDRTKVYVTNAVKHFKFVPRGKIRLHQKPNTPEIRACRPWYE 138

Query: 180 RQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ 239
           R++  ++P +++ +G+      F        ++ G+  ++         L TVHP  L++
Sbjct: 139 RELAAVNPALVVAMGSTAAQSVFGK-ITPINKSRGRLIDMKDGRK---ALVTVHPSYLLR 194

Query: 240 YP 241
            P
Sbjct: 195 LP 196


>gi|168700619|ref|ZP_02732896.1| DNA polymerase, bacteriophage-type [Gemmata obscuriglobus UQM 2246]
          Length = 253

 Score = 65.9 bits (159), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 43/175 (24%), Positives = 74/175 (42%), Gaps = 9/175 (5%)

Query: 80  LKSLLRSFHDCHLCS----TSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           L +L     +C  CS    T L  +  T     ++  +G  P   ++  G+PF GK G +
Sbjct: 64  LATLAAEVSNCDKCSELFSTRLRAVFGTGPLDPEVAFVGEAPGYEEDAQGEPFVGKGGQL 123

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           L +++ + ++   Q ++  I    PP  R  +  E   CR I  RQ EL+ PK L+ +G 
Sbjct: 124 LRRIIAACQLPSAQEYLLNIIKCRPPRTRPPTMAECGNCRDIFRRQFELVRPKYLVALGL 183

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ--YPLIKKNTW 248
                      + +   LG        +  +P + T HP ++       +K+ TW
Sbjct: 184 TASRLL---SGKVSATALGALRGQVHQYRGVPLICTHHPNDIDADGTGRLKRETW 235


>gi|284992827|ref|YP_003411381.1| phage SPO1 DNA polymerase-like protein [Geodermatophilus obscurus
           DSM 43160]
 gi|284066072|gb|ADB77010.1| phage SPO1 DNA polymerase-related protein [Geodermatophilus
           obscurus DSM 43160]
          Length = 207

 Score = 65.5 bits (158), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 68/143 (47%), Gaps = 6/143 (4%)

Query: 67  ADSIAQKACSLHELKSLLRSFHDCHLCSTSLST-----ICATQTEGQD-LMIIGYTPSDS 120
           A+ +A+ A +  + ++L      C  C    +T     +      G+    ++G  P  S
Sbjct: 11  AEEVARTAAAAPDWEALAAVARPCVACPELAATRQHVVVGDVPAGGRPRFALVGEAPGAS 70

Query: 121 DNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMR 180
           ++ +G+ F GK+G +LD++L    + R +  +  +    PPGNR     E+  C   + R
Sbjct: 71  EDETGRAFVGKSGQLLDRLLVEAGLDRAEAAVLNVVKCRPPGNRTPKASEVARCSGWLRR 130

Query: 181 QIELISPKILLFIGNKTKNFFFN 203
           Q++L+ P +++ +G  +  +F  
Sbjct: 131 QLDLLDPPVVVALGLSSAKWFLG 153


>gi|119719708|ref|YP_920203.1| phage SPO1 DNA polymerase-related protein [Thermofilum pendens Hrk
           5]
 gi|119524828|gb|ABL78200.1| phage SPO1 DNA polymerase-related protein [Thermofilum pendens Hrk
           5]
          Length = 217

 Score = 65.5 bits (158), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 43/194 (22%), Positives = 79/194 (40%), Gaps = 20/194 (10%)

Query: 65  QQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEG---QDLMIIGYTPSDSD 121
           + A S A     L  L+ +      C  C  S S       EG     ++ IG  P  ++
Sbjct: 5   KPAGSNASCGDVLRALEEIAGEIAKCEKCPLSRSRTHTVPGEGNPCSGVVFIGEAPGRNE 64

Query: 122 NISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQ 181
           ++ G+PF G  G +L +++    + R ++ I+ +    PP NR     E+  C P ++ Q
Sbjct: 65  DLQGRPFVGAAGALLTELISLAGLSREEVFITNVVKCRPPNNREPREEEIAACLPYLLAQ 124

Query: 182 IELISPKILLFIGNKTKNFFFNNDAQ----------KTYQNLGKWSNLCTPHSIIPTLAT 231
           +  I P++++ +G  +                    K Y    +W  +    ++ PTL  
Sbjct: 125 LRAIKPRLIVTLGKHSTKTILRMRGMSVDSIMSVRGKAYTVNAEWGQV----TVFPTL-- 178

Query: 232 VHPQELIQYPLIKK 245
            HP   +  P ++K
Sbjct: 179 -HPAAALYNPAMRK 191


>gi|302528267|ref|ZP_07280609.1| DNA polymerase [Streptomyces sp. AA4]
 gi|302437162|gb|EFL08978.1| DNA polymerase [Streptomyces sp. AA4]
          Length = 205

 Score = 65.5 bits (158), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 39/177 (22%), Positives = 76/177 (42%), Gaps = 14/177 (7%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           SL +L+   R    C L   + +T+     +  D+  +G  P D ++  G+PF G  G +
Sbjct: 16  SLGKLREAARECRGCGLYRDATATVFGEGPQRADIFALGEQPGDQEDQRGEPFVGPAGRL 75

Query: 136 LDKMLQSIEIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELISPK 188
           LDK L    + R  ++++       +   G R +    +  E+  CRP ++ ++  + P+
Sbjct: 76  LDKALADAGLDRDSLYVTNAVKHFKFKLRGKRRIHEKPARSEVVACRPWLVAELRAVQPR 135

Query: 189 ILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHS----IIPTLATVHPQELIQYP 241
           ++L +G       +    + T     +   L  P          +ATVHP  +++ P
Sbjct: 136 LVLLLGATAAQSVYGTSFRLTRH---RGERLDPPEEFADLFASAVATVHPSAVLRAP 189


>gi|284166413|ref|YP_003404692.1| phage SPO1 DNA polymerase-related protein [Haloterrigena turkmenica
           DSM 5511]
 gi|284016068|gb|ADB62019.1| phage SPO1 DNA polymerase-related protein [Haloterrigena turkmenica
           DSM 5511]
          Length = 201

 Score = 65.5 bits (158), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 52/89 (58%)

Query: 106 EGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRN 165
           E  DL+ +G  P  +++  G+PF G++G +LD  L+++ + RT + I+      PP NR+
Sbjct: 35  EDADLLFVGEGPGANEDEQGEPFVGRSGTVLDDGLRTVGLDRTDVRITNCVRCRPPENRD 94

Query: 166 LSNIEMEICRPIIMRQIELISPKILLFIG 194
            +  E+  CR  +  +IE + P +++ +G
Sbjct: 95  PTKDELANCRSYLETEIERLDPDVIVTLG 123


>gi|218782236|ref|YP_002433554.1| phage SPO1 DNA polymerase-related protein [Desulfatibacillum
           alkenivorans AK-01]
 gi|218763620|gb|ACL06086.1| phage SPO1 DNA polymerase-related protein [Desulfatibacillum
           alkenivorans AK-01]
          Length = 235

 Score = 65.5 bits (158), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 36/173 (20%), Positives = 73/173 (42%), Gaps = 5/173 (2%)

Query: 86  SFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEI 145
           S  DC L    +  +         LM+ G  P   ++ +G PF G+ G +LD +L+++ +
Sbjct: 63  SCTDCPLHKERIKGVFGQGDPEAALMLAGIAPGMEESKAGLPFQGEVGGLLDNILKAMGM 122

Query: 146 MRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNND 205
            R  +++  +     P       + +  C     +Q+E + P+++   G  T       D
Sbjct: 123 TRDDVYLCNLVKCPVPDGELPDPMCLRACSRFFRKQVEAVRPQVICAFGQITAEAILKQD 182

Query: 206 AQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
              +     +      P+  +  + T HP+EL+  P  K+  WH +  + +A+
Sbjct: 183 LPYS-----RVRGQLQPYLGMRVMPTFHPRELLTAPQKKRAVWHDMQAIMRAI 230


>gi|295111555|emb|CBL28305.1| uracil-DNA glycosylase, family 4 [Synergistetes bacterium SGP1]
          Length = 207

 Score = 65.5 bits (158), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 43/191 (22%), Positives = 79/191 (41%), Gaps = 10/191 (5%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +  +L+  + +   C LC    +T+         ++++G  P   ++  G  F G+ G +
Sbjct: 13  AWEDLRGRVAACRRCGLCEARTNTVFGQGAVRTPIVMVGEGPGADEDAQGLAFVGRAGQL 72

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           L K+L +  I R  + I+ +    PP NR  +  EM  C   +  Q+ L+ P+IL+ +GN
Sbjct: 73  LTKILSAAGIDRESVFITNVVKCRPPNNRTPTQEEMLKCADFLEAQLLLLRPRILVCLGN 132

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKN-----TWHA 250
               +        T    G+W +       +      HP  L++    +K      TW  
Sbjct: 133 TPLKWLLRTSEGITALR-GRWFD----WRGVQLFPMFHPSYLLRNDSRQKGSPKDLTWQD 187

Query: 251 LITLKKALKNL 261
           +  LK  L  +
Sbjct: 188 VQNLKARLDEI 198


>gi|119387332|ref|YP_918366.1| uracil-DNA glycosylase superfamily protein [Paracoccus
           denitrificans PD1222]
 gi|119377907|gb|ABL72670.1| Uracil-DNA glycosylase superfamily [Paracoccus denitrificans
           PD1222]
          Length = 479

 Score = 65.5 bits (158), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 80/179 (44%), Gaps = 12/179 (6%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C LC  +  T+         +MI+G  P D ++++G+PF+G  G +L  M+    +   Q
Sbjct: 296 CKLCEAATQTVWGEGAADAAVMIVGEQPGDHEDLTGRPFAGPAGQLLRGMIADAGLDGAQ 355

Query: 150 IHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFF 202
           I ++       + P G R L    +  E+  CR  +  ++  + P++ L +G  +  F  
Sbjct: 356 IWLTNAVKHFKFAPRGKRRLHRNPARDEIRHCRWWLGLELAFVRPRVTLALG-ASAAFAL 414

Query: 203 NNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
            +D +  ++  G    + T     P L + HP  +++ P   +   HA + L + L  L
Sbjct: 415 TDDDRPMHRRRG---TVETGLHGGPVLISWHPAHILRLPDPDRRN-HARLQLAEDLARL 469


>gi|82702415|ref|YP_411981.1| phage SPO1 DNA polymerase-related protein [Nitrosospira multiformis
           ATCC 25196]
 gi|82410480|gb|ABB74589.1| phage SPO1 DNA polymerase-related protein [Nitrosospira multiformis
           ATCC 25196]
          Length = 209

 Score = 65.1 bits (157), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 73/159 (45%), Gaps = 11/159 (6%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           CHL   +  T+         +M++G  P D ++ +G PF G  G++L   L ++ I R +
Sbjct: 32  CHLWEHATQTVFGEGPSHASIMLVGEQPGDREDATGHPFVGPAGSILSHALTAVGISREE 91

Query: 150 IHISMIS---PWHPPGNRNLS----NIEMEICRPIIMRQIELISPKILLFIGNKTKNFFF 202
           ++++       +   G R +     + E+  C   + R+IELI+P++++ +G        
Sbjct: 92  VYVTNAVKHFKFELRGKRRMHKKPIDTEIVACHAWLQREIELITPRLIIALGATAARSLL 151

Query: 203 NNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
              A     N GK     T  S+   L TVHP  L++ P
Sbjct: 152 GR-ATPVKVNRGKLLEYATGVSL---LITVHPSFLLRMP 186


>gi|78212827|ref|YP_381606.1| phage SPO1 DNA polymerase-related protein [Synechococcus sp.
           CC9605]
 gi|78197286|gb|ABB35051.1| phage SPO1 DNA polymerase-related protein [Synechococcus sp.
           CC9605]
          Length = 187

 Score = 65.1 bits (157), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 68/153 (44%), Gaps = 6/153 (3%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEI-MRT 148
           C L S+  + + +      DLM+IG  P   ++  G PF G++G  LD++L+ +++    
Sbjct: 15  CDLASSRQTVVISRGNPKADLMLIGEAPGAQEDAQGVPFVGRSGCALDQLLRDVDLDPEH 74

Query: 149 QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQK 208
            ++I       PP NR     E+  CR  +  Q+E + PK+++  G              
Sbjct: 75  DLYICNAIKCRPPNNRRPKKTELAACRAWLDLQLEAVDPKVIVLTGATAVEAILGIKGGM 134

Query: 209 TYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
           T    G+W +      ++P     HP  L++ P
Sbjct: 135 TRLR-GEWQSW-NGREVMPIF---HPSYLLRNP 162


>gi|84622266|ref|YP_449638.1| DNA polymerase related protein [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|84366206|dbj|BAE67364.1| DNA polymerase related protein [Xanthomonas oryzae pv. oryzae MAFF
           311018]
          Length = 482

 Score = 65.1 bits (157), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 44/208 (21%), Positives = 83/208 (39%), Gaps = 15/208 (7%)

Query: 41  RKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTI 100
           R  +  + A +P+   R + +    Q D+      SL +L+S  R    C L   +  T+
Sbjct: 249 RVREMAERAPEPVR--RRVPAAPAPQPDTTTH---SLAQLRSAARDCRRCELWQPATQTV 303

Query: 101 CATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISP--- 157
                +   +M+IG  P D +++SG+PF G  G +    L  + + R + +++       
Sbjct: 304 FGEGPDDASVMVIGEQPGDEEDLSGRPFVGPAGRLFTMALGELGVDRQRFYVTNAVKHFR 363

Query: 158 WHPPGNRNL----SNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNL 213
           +   G R L        ++ C   +  +   + P  ++ +G             +  Q  
Sbjct: 364 FEQRGKRRLHRNPERAHLQACSGWLQAERTQLRPAQIVCLGATAAQAVLGRSGFRLMQER 423

Query: 214 GKWSNLCTPHSIIPTLATVHPQELIQYP 241
           G+W  L       P L TVHP  +++ P
Sbjct: 424 GQWQRL---DDGTPVLTTVHPSWVLRQP 448


>gi|168182317|ref|ZP_02616981.1| uracil-DNA glycosylase [Clostridium botulinum Bf]
 gi|182674592|gb|EDT86553.1| uracil-DNA glycosylase [Clostridium botulinum Bf]
          Length = 190

 Score = 65.1 bits (157), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 68/153 (44%), Gaps = 6/153 (3%)

Query: 110 LMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSN 168
           +M IG  P   ++ +G+PF GK G +L K L +++  R +  +I  +    P  NR    
Sbjct: 37  IMFIGEAPGADEDRTGRPFVGKAGQLLTKALLALDFKRDEHYYICNVCKCRPENNRTPKE 96

Query: 169 IEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPT 228
            E   C   +  Q+ L+ PKI++ +G     +      + T ++ GKW            
Sbjct: 97  EEAMTCLHYLRNQVALVKPKIMICLGATALKYIMGEQFRIT-RDRGKW----IERKGYYI 151

Query: 229 LATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
           +AT HP  L +    KK  W  L ++++    L
Sbjct: 152 MATFHPAALFRDESKKKLLWQDLKSIREKYDEL 184


>gi|134291140|ref|YP_001114909.1| phage SPO1 DNA polymerase-related protein [Burkholderia
           vietnamiensis G4]
 gi|134134329|gb|ABO58654.1| phage SPO1 DNA polymerase-related protein [Burkholderia
           vietnamiensis G4]
          Length = 239

 Score = 65.1 bits (157), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 56/105 (53%), Gaps = 8/105 (7%)

Query: 110 LMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMIS---PWHPPGNRNL 166
           +M++G  P D ++ +G PF G  G MLD+ L    I R +++++       W P G R L
Sbjct: 68  IMLVGEQPGDQEDRTGVPFVGAAGRMLDRALDEAGIDRARVYVTNAVKHFKWEPRGKRRL 127

Query: 167 ----SNIEMEICRPIIMRQIELISPKILLFIGNKT-KNFFFNNDA 206
               +  E+  CR  + R++E ++P++++ +G    +    +NDA
Sbjct: 128 HKTPAQREVAACRYWLERELETLAPRVIVALGATALRAVLQDNDA 172


>gi|188578772|ref|YP_001915701.1| uracil DNA glycosylase superfamily protein [Xanthomonas oryzae pv.
           oryzae PXO99A]
 gi|188523224|gb|ACD61169.1| uracil DNA glycosylase superfamily protein [Xanthomonas oryzae pv.
           oryzae PXO99A]
          Length = 477

 Score = 65.1 bits (157), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 44/208 (21%), Positives = 83/208 (39%), Gaps = 15/208 (7%)

Query: 41  RKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTI 100
           R  +  + A +P+   R + +    Q D+      SL +L+S  R    C L   +  T+
Sbjct: 244 RVREMAERAPEPVR--RRVPAAPAPQPDTTTH---SLAQLRSAARDCRRCELWQPATQTV 298

Query: 101 CATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISP--- 157
                +   +M+IG  P D +++SG+PF G  G +    L  + + R + +++       
Sbjct: 299 FGEGPDDASVMVIGEQPGDEEDLSGRPFVGPAGRLFTMALGELGVDRQRFYVTNAVKHFR 358

Query: 158 WHPPGNRNL----SNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNL 213
           +   G R L        ++ C   +  +   + P  ++ +G             +  Q  
Sbjct: 359 FEQRGKRRLHRNPERAHLQACSGWLQAERTQLRPAQIVCLGATAAQAVLGRSGFRLMQER 418

Query: 214 GKWSNLCTPHSIIPTLATVHPQELIQYP 241
           G+W  L       P L TVHP  +++ P
Sbjct: 419 GQWQRL---DDGTPVLTTVHPSWVLRQP 443


>gi|327311693|ref|YP_004338590.1| phage SPO1 DNA polymerase-like protein [Thermoproteus uzoniensis
           768-20]
 gi|326948172|gb|AEA13278.1| phage SPO1 DNA polymerase-related protein [Thermoproteus uzoniensis
           768-20]
          Length = 198

 Score = 65.1 bits (157), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 71/172 (41%), Gaps = 4/172 (2%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L E+   +R    C L  T    +       + +MI+G  P + ++  G+PF G  G +L
Sbjct: 5   LLEIAERIRGCTRCRLHETRRLAVPGEGRAEKGIMIVGEAPGEKEDEEGRPFVGPAGRLL 64

Query: 137 DKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG- 194
             +L    I R + + I+ +    PPGNR     E+  C P ++ QI  I P++++ +G 
Sbjct: 65  TSILTRYGIDRGRDVFITNVVKCRPPGNREPLEDEIAACTPYLVEQIAAIRPRLIVALGV 124

Query: 195 --NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIK 244
              +T   F      K     GK   +           T HP   +  P ++
Sbjct: 125 HSARTLMSFAGRRVAKITDVRGKCFKVRIAGVETTLCVTYHPAAALYNPRLR 176


>gi|320102815|ref|YP_004178406.1| phage SPO1 DNA polymerase-like protein [Isosphaera pallida ATCC
           43644]
 gi|319750097|gb|ADV61857.1| phage SPO1 DNA polymerase-related protein [Isosphaera pallida ATCC
           43644]
          Length = 334

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 48/193 (24%), Positives = 81/193 (41%), Gaps = 11/193 (5%)

Query: 72  QKACSLHELKSLLRSFHDC-HLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSG 130
           Q++ +L  L   + S   C  L ++   T+    +    LM IG  P + ++  G PF G
Sbjct: 139 QRSNALTVLAEEVSSCQACPALVASRTQTVFGVGSPTARLMFIGEAPGEEEDAKGVPFVG 198

Query: 131 KTGNML-DKMLQSIEIMRTQIHISMISPWHPPG----NRNLSNIEMEICRPIIMRQIELI 185
           + G +L D +++ + + R Q++I+      P      NR     E+  C   + RQIE++
Sbjct: 199 RAGQLLTDMIVKGMGLTRDQVYIANACKCRPTDAEGRNRTPDPSEIRNCASYLDRQIEIV 258

Query: 186 SPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKK 245
            P+ L  +G              T   L +       H  +  + T HP  L++ P  KK
Sbjct: 259 RPEFLCLLGKTAAQAVLG-----TPLPLAQLRKRLHRHRGMTVVVTFHPAYLLRNPSDKK 313

Query: 246 NTWHALITLKKAL 258
             W  L  L  A+
Sbjct: 314 EAWEDLKMLMSAM 326


>gi|186474189|ref|YP_001861531.1| phage SPO1 DNA polymerase-related protein [Burkholderia phymatum
           STM815]
 gi|184196521|gb|ACC74485.1| phage SPO1 DNA polymerase-related protein [Burkholderia phymatum
           STM815]
          Length = 244

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/171 (21%), Positives = 75/171 (43%), Gaps = 11/171 (6%)

Query: 78  HELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLD 137
           H+  + L     C L S +   +  T  +   +M++G  P D +++ G PF G  G +LD
Sbjct: 45  HQQPARLAECRRCALWSRATQAVGGTGPKHAPIMMVGEQPGDKEDLQGMPFVGPAGELLD 104

Query: 138 KMLQSIEIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELISPKIL 190
             L+   + R  ++++       W P G R +    +  E++ C   + R++  + P++L
Sbjct: 105 DALKDAGVDRRDVYVTNAVKHFKWEPRGKRRMHKTPAQREVDACHYWLERELASVGPRVL 164

Query: 191 LFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
           + +G        ++   +    +GK       H ++PT    HP   ++ P
Sbjct: 165 VALGATALKAILDDRDARLQAVVGKVLEHGGRH-VVPTY---HPSFALRAP 211


>gi|260436026|ref|ZP_05789996.1| uracil-DNA glycosylase [Synechococcus sp. WH 8109]
 gi|260413900|gb|EEX07196.1| uracil-DNA glycosylase [Synechococcus sp. WH 8109]
          Length = 187

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 69/153 (45%), Gaps = 6/153 (3%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEI-MRT 148
           C L +T  + + +      DLM+IG  P   ++  G PF G++G  LD++L+ +++    
Sbjct: 15  CDLATTRHTVVMSRGNPKADLMLIGEAPGAQEDSQGVPFVGRSGRALDQLLRDVDLDPEH 74

Query: 149 QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQK 208
            ++I       PP NR     E+  CR  +  Q+E + P +++  G              
Sbjct: 75  DLYICNAIKCRPPNNRRPKKAELAACRAWLDLQLETVDPTVIVLTGATAVEAILGIKGGM 134

Query: 209 TYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
           T Q  G+W +     +++P     HP  L++ P
Sbjct: 135 T-QLRGQWQSW-NERAVMPIF---HPSYLLRNP 162


>gi|269926975|ref|YP_003323598.1| phage SPO1 DNA polymerase-related protein [Thermobaculum terrenum
           ATCC BAA-798]
 gi|269790635|gb|ACZ42776.1| phage SPO1 DNA polymerase-related protein [Thermobaculum terrenum
           ATCC BAA-798]
          Length = 201

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 96/203 (47%), Gaps = 27/203 (13%)

Query: 78  HELKSLLRSFHDCHLCSTSLSTICATQTEGQ---DLMIIGYTPSDSDNISGKPFSGKTGN 134
           ++L+ + +    C  C   L +  A    G    +LMIIG +PS+ D  +GKPFSG +G 
Sbjct: 5   YDLQQIAQDLQSCQRCDLYLYSRTAIPGNGDSQANLMIIGESPSEYDESTGKPFSGPSGR 64

Query: 135 MLDKMLQSIEIMRTQIHISMISP-----WHPPGNRNLSNI--EMEICRPIIMRQIELISP 187
           +LD  L+ + + R ++ ++ +          P  RN + I  E + C   +  +I +I P
Sbjct: 65  VLDSWLRKLGLTREEVWLTNVVKHRSVDLKDPRRRNRAPIASEYKACSHWLRLEISIIRP 124

Query: 188 KILLFIGNKT------KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
           KI++ +G           F  + D  KT+   G + ++     ++PT  T +  +L + P
Sbjct: 125 KIIVALGASAGKALLGSGFKISRDRGKTFP--GPYDSI-----VVPTYHTAYILKL-KSP 176

Query: 242 LIKK---NTWHALITLKKALKNL 261
           L+++        L T+K+ L  L
Sbjct: 177 LLEQVSSQVEQDLDTIKRLLSQL 199


>gi|27378134|ref|NP_769663.1| hypothetical protein bll3023 [Bradyrhizobium japonicum USDA 110]
 gi|27351281|dbj|BAC48288.1| bll3023 [Bradyrhizobium japonicum USDA 110]
          Length = 469

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 41/184 (22%), Positives = 82/184 (44%), Gaps = 14/184 (7%)

Query: 68  DSIAQKACSLHELKSLLRSFHDCHLC---STSLSTICATQTEGQDLMIIGYTPSDSDNIS 124
           ++I     + ++L++L      C  C     +  T+     +   +M++G  P D ++++
Sbjct: 260 EAIMGHKAAANDLEALREEAAHCRACPLYKDATQTVFGEGPKDATIMLVGEQPGDKEDLA 319

Query: 125 GKPFSGKTGNMLDKMLQSIEIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRPI 177
           G PF G  G MLD+ L+   + R +++++       + P G   L    +  E++ CRP 
Sbjct: 320 GHPFVGPAGQMLDRALEEAGVDRKKVYVTNAVKHFKFVPRGKIRLHQKPATPEIKACRPW 379

Query: 178 IMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQEL 237
             R++  I P++++ +G       F        +  G+  +L         L TVHP  L
Sbjct: 380 YEREVAAIQPELIVAMGATAAQSVFGK-ITPIGKTRGRLIDLPDGRK---ALVTVHPSYL 435

Query: 238 IQYP 241
           ++ P
Sbjct: 436 LRLP 439


>gi|329114631|ref|ZP_08243390.1| Phage SPO1 DNA Polymerase-Related Protein [Acetobacter pomorum
           DM001]
 gi|326696111|gb|EGE47793.1| Phage SPO1 DNA Polymerase-Related Protein [Acetobacter pomorum
           DM001]
          Length = 420

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 78/189 (41%), Gaps = 18/189 (9%)

Query: 63  LVQQADSIAQKACSLHELKSLLRSFHDCHLCST---SLSTICATQTEGQDLMIIGYTPSD 119
           LV   + +AQ A     L SL     DC  CS    +  T+     E   LM +G  P D
Sbjct: 212 LVPTLEDVAQAAS----LASLSAEAMDCRACSLWQPAKRTVFGEGVENTPLMFVGEQPGD 267

Query: 120 SDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNI-------EME 172
            ++++G+PF G  G + DK L+   I+R  I+++          RN   +        +E
Sbjct: 268 QEDLAGRPFVGPAGQVFDKALEEAGILRNHIYVTNAVKHFRFTWRNTRRLHQKPDQESVE 327

Query: 173 ICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATV 232
            CR  +  +  L+ PK+++ +G              + +     S +   +     L TV
Sbjct: 328 ACRIWLDAERRLVQPKLIVMLGVTAAQSLLKRPVTISRER----SRIFQLNEQCSGLVTV 383

Query: 233 HPQELIQYP 241
           HP  L++ P
Sbjct: 384 HPSYLLRLP 392


>gi|196234456|ref|ZP_03133282.1| Uracil-DNA glycosylase superfamily [Chthoniobacter flavus Ellin428]
 gi|196221512|gb|EDY16056.1| Uracil-DNA glycosylase superfamily [Chthoniobacter flavus Ellin428]
          Length = 159

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 67/138 (48%), Gaps = 15/138 (10%)

Query: 113 IGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMIS---PWHPPGNRNL--- 166
           +G  P D ++ +G+PF G  G +LD+ L+   I R + +++       W P G R L   
Sbjct: 1   MGEQPGDREDRAGRPFVGPAGKLLDRALEEAGIDRQETYVTNAVKHFKWEPRGKRRLHKK 60

Query: 167 -SNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKW--SNLCTPH 223
            S+ ++  C+P +  +++ I+P++L+ +G+        +   +  ++ G    S  C   
Sbjct: 61  PSSRDIAACKPWLEAELQAIAPRVLVLLGSTAAQTILGSKV-RVLRDRGHAMPSEYCQ-- 117

Query: 224 SIIPTLATVHPQELIQYP 241
               T  TVHP  L++ P
Sbjct: 118 ---KTFVTVHPSSLLRAP 132


>gi|209545310|ref|YP_002277539.1| Uracil-DNA glycosylase superfamily [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209532987|gb|ACI52924.1| Uracil-DNA glycosylase superfamily [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 428

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 41/178 (23%), Positives = 79/178 (44%), Gaps = 16/178 (8%)

Query: 75  CSLHELKSLLRSFHDCHLCSTS---LSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGK 131
             +  L +L+ +  DC +C+ +     T+ +    G  LM++G  P D ++  G+PF G 
Sbjct: 226 ARIDSLPALIAAARDCLICAMARQTTQTVFSDGRPGAALMLVGEQPGDQEDRVGRPFVGP 285

Query: 132 TGNMLDKMLQSIEIMRTQIHISMISP---WHPPGNRNL---SNIE-MEICRPIIMRQIEL 184
            G +LD+ L    I R  ++++       +   G R L     +E +  C P +  +  +
Sbjct: 286 AGQLLDRALHEARITRDAVYVTNAVKHFRFQRRGTRRLHEKPTVENVTACAPWLAAERRI 345

Query: 185 ISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPT-LATVHPQELIQYP 241
           ++P++L+ +G                  +G+  +   P +   T L TVHP  L++ P
Sbjct: 346 VAPRVLVMLGATAAGAVLGRSV-----TIGRERSRPIPLADGSTGLVTVHPSFLLRQP 398


>gi|307729968|ref|YP_003907192.1| phage SPO1 DNA polymerase-related protein [Burkholderia sp.
           CCGE1003]
 gi|307584503|gb|ADN57901.1| phage SPO1 DNA polymerase-related protein [Burkholderia sp.
           CCGE1003]
          Length = 490

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 63/141 (44%), Gaps = 7/141 (4%)

Query: 71  AQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSG 130
           A+ A  L E  S L +   C L   +   +         +M+IG  P D +++SG+PF G
Sbjct: 284 AEVAQPLREQPSSLDACRRCDLWRHATQAVGGVGPRDARIMVIGEQPGDHEDLSGQPFVG 343

Query: 131 KTGNMLDKMLQSIEIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIE 183
             G +L+  +    + R Q++++       W P G R L    +  EM+ C   + +++E
Sbjct: 344 PAGQLLNSAITQAGLRREQLYLTNAVKHFKWEPRGKRRLHKTAAQREMQACSHWLTQELE 403

Query: 184 LISPKILLFIGNKTKNFFFNN 204
            + P +++ +G    N     
Sbjct: 404 TVRPSVVVTLGTTALNALLGE 424


>gi|161528564|ref|YP_001582390.1| phage SPO1 DNA polymerase-related protein [Nitrosopumilus maritimus
           SCM1]
 gi|160339865|gb|ABX12952.1| phage SPO1 DNA polymerase-related protein [Nitrosopumilus maritimus
           SCM1]
          Length = 196

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/150 (26%), Positives = 71/150 (47%), Gaps = 2/150 (1%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C L  T  +++        D++ +G  P  +++ +G+PF G  G  L   L+   + R  
Sbjct: 17  CDLYKTRTNSVPGKGNFQSDVIFVGEAPGRNEDKNGEPFVGAAGKKLSAALEGAGVSRED 76

Query: 150 IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKN-FFFNNDAQK 208
           ++I+ +    PP NR  +  E + C+  +  +I +I PKI+  +GN   N     ++  K
Sbjct: 77  VYITNVVKCRPPNNRVPNTNERDTCKEYLKNEILIIKPKIICVLGNTAFNSVLGGSEITK 136

Query: 209 TYQNLGKWSNLCTPHSIIPTLATVHPQELI 238
               L +  N     +I P  AT++ QELI
Sbjct: 137 FRGKLVRKDNQLYFLTIHPA-ATIYNQELI 165


>gi|296116415|ref|ZP_06835029.1| Uracil-DNA glycosylase superfamily protein [Gluconacetobacter
           hansenii ATCC 23769]
 gi|295977008|gb|EFG83772.1| Uracil-DNA glycosylase superfamily protein [Gluconacetobacter
           hansenii ATCC 23769]
          Length = 408

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 43/187 (22%), Positives = 79/187 (42%), Gaps = 13/187 (6%)

Query: 62  PLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSD 121
           PL +  D   ++  +L  +    RS   C +   +  T+    T    LM +G  P D +
Sbjct: 203 PLAEGMD--IERITALPAVAEAARSCLTCAMAHHATQTVFGEGTTTASLMFVGEQPGDQE 260

Query: 122 NISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNI-------EMEIC 174
           +++G+PF G  G + D+ L  + I R  ++++         NRN   I       E+  C
Sbjct: 261 DLAGRPFVGPAGQLFDRALHEVGIARDDVYVTNTVKHFKFFNRNGRRIHQKAGMEEIRAC 320

Query: 175 RPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHP 234
            P +  +  ++ P++L+ +G    +       Q++     + S   T       L TVHP
Sbjct: 321 APWLHAERRMVRPRLLVMLGATAASAIL----QRSVVIGRERSRPITLDDGTCGLVTVHP 376

Query: 235 QELIQYP 241
             L++ P
Sbjct: 377 SFLLRQP 383


>gi|238027270|ref|YP_002911501.1| phage SPO1 DNA polymerase-like protein [Burkholderia glumae BGR1]
 gi|237876464|gb|ACR28797.1| Phage SPO1 DNA polymerase-related protein [Burkholderia glumae
           BGR1]
          Length = 218

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/162 (21%), Positives = 69/162 (42%), Gaps = 8/162 (4%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           +L + L +   C L +++   +         +M++G  P   D+ SG+PFSG  G +LD+
Sbjct: 12  DLPATLDACRRCELWASASRPVAGAGPRRAAIMLVGEQPDAQDDRSGQPFSGTAGRLLDR 71

Query: 139 MLQSIEIMRTQI-------HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILL 191
            L    + R++        H+   +   P  +   +  E++ CR  + R+I  ++P++++
Sbjct: 72  ALTEASLARSETYATYALKHLRRDAAGRPRADEAPAGHELDACRYWLEREIRSVAPRVIV 131

Query: 192 FIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVH 233
             G         +D Q     +     L     +I TLA   
Sbjct: 132 AFGTAALRAVL-DDPQAAVHRMPLPYRLPGGERVIATLAPAQ 172


>gi|148242559|ref|YP_001227716.1| Uracil-DNA glycosylase [Synechococcus sp. RCC307]
 gi|147850869|emb|CAK28363.1| Uracil-DNA glycosylase [Synechococcus sp. RCC307]
          Length = 194

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 56/106 (52%), Gaps = 1/106 (0%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEI-MRT 148
           C L +T  + +         +++IG  P   ++  G+PF G+ G +L+K+L    +  R 
Sbjct: 18  CELATTRHNVVVGRGNPQARVLLIGEAPGQQEDEQGEPFVGRAGQLLEKLLGEAGLDSRR 77

Query: 149 QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
            ++I+ +    PP NR  +  E+E C P + +Q+EL+ P +++  G
Sbjct: 78  DLYIANVIKCRPPQNRKPTRTEIERCLPWLYQQLELLDPPLVVLAG 123


>gi|332799272|ref|YP_004460771.1| phage SPO1 DNA polymerase-like protein [Tepidanaerobacter sp. Re1]
 gi|332697007|gb|AEE91464.1| phage SPO1 DNA polymerase-related protein [Tepidanaerobacter sp.
           Re1]
          Length = 253

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 67/130 (51%), Gaps = 6/130 (4%)

Query: 110 LMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNI 169
           L++IG  P   ++  G+PF G+ G +L  +L  ++I R +++I+ +    PP NR     
Sbjct: 95  LVLIGEGPGFDEDKQGRPFVGRAGQLLTTILNKMDIRREKVYITNVIKCRPPQNRTPLQK 154

Query: 170 EMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTL 229
           E++ C   +  ++ LI PK+++ +G    N+F         +  G+W N    + I+PT 
Sbjct: 155 EIKACSKNLELELSLIQPKVIIALGAVPLNYF--KSGSSIMRERGQWIN-SRDYWIMPTF 211

Query: 230 ATVHPQELIQ 239
              HP  +++
Sbjct: 212 ---HPAYILR 218


>gi|325293540|ref|YP_004279404.1| DNA polymerase bacteriophage-type [Agrobacterium sp. H13-3]
 gi|325061393|gb|ADY65084.1| putative DNA polymerase bacteriophage-type [Agrobacterium sp.
           H13-3]
          Length = 481

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 80/172 (46%), Gaps = 14/172 (8%)

Query: 80  LKSLLRSFHDCHLCS---TSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L SL +    C  C+    +  T+     E   +MI+G  P D ++++GKPF G  G + 
Sbjct: 292 LASLAQEAGQCTRCALHCKATQTVFGMGPEDAKVMIVGEQPGDHEDLAGKPFVGPAGQLF 351

Query: 137 DKMLQSIEIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELISPKI 189
           D+ L    I R +++++       +   G R +       E++ CR  + ++IEL+ PK+
Sbjct: 352 DRTLVEAGIDRKKLYVTNAVKHFKYEARGKRRIHQRPDAGEVQQCRWWLNKEIELVRPKL 411

Query: 190 LLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
           ++ +G  T  +      +K  +  G+   +    ++     TVHP  L++ P
Sbjct: 412 IVAMG-ATALYALTGGKEKVSEVRGRPIPMQEERTL---FVTVHPSYLLRLP 459


>gi|330817358|ref|YP_004361063.1| phage SPO1 DNA polymerase-related protein [Burkholderia gladioli
           BSR3]
 gi|327369751|gb|AEA61107.1| phage SPO1 DNA polymerase-related protein [Burkholderia gladioli
           BSR3]
          Length = 493

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 63/131 (48%), Gaps = 7/131 (5%)

Query: 71  AQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSG 130
           A+ A  + E  S L +   C L   +   + +       +M+IG  P D +++SG+PF G
Sbjct: 283 AEVAQPVREQASSLDACRRCDLWRNATQAVGSAGPSSARIMLIGEQPGDQEDLSGQPFVG 342

Query: 131 KTGNMLDKMLQSIEIMRTQIHISMIS---PWHPPGNRNLSNI----EMEICRPIIMRQIE 183
             G +LD  ++   ++R Q++++       W P G R L       E+E C   +  +++
Sbjct: 343 PAGQLLDLAIERAGLLRDQVYLTNAVKHFKWEPRGKRRLHKTPMQREIEACHHWLEHELD 402

Query: 184 LISPKILLFIG 194
            + P +++ +G
Sbjct: 403 TVRPAVIVALG 413


>gi|116070628|ref|ZP_01467897.1| Phage SPO1 DNA polymerase-related protein [Synechococcus sp. BL107]
 gi|116066033|gb|EAU71790.1| Phage SPO1 DNA polymerase-related protein [Synechococcus sp. BL107]
          Length = 187

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 70/163 (42%), Gaps = 7/163 (4%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           +L + LR    C L  T    +         LM+IG  P   ++ SG PF G++G  LD+
Sbjct: 5   DLDACLRC-SACELARTRQQVVVCRGNPSAPLMLIGEAPGAQEDQSGVPFVGRSGQALDR 63

Query: 139 MLQSIEI-MRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT 197
           +L      +   ++I       PP NR     E+  CRP + +QI  ++P +++  G   
Sbjct: 64  LLIEAGFNIEQDLYICNAVKCRPPNNRRPKKNELAACRPWLDKQIAEVNPAVIVLTGATA 123

Query: 198 KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQY 240
                   A  T +  G+W       S++P     HP  L+++
Sbjct: 124 VQAVLEKKAAMT-ELRGQWQTW-QGRSVMPIF---HPAYLLRH 161


>gi|163857286|ref|YP_001631584.1| putative DNA polymerase bacteriophage-type [Bordetella petrii DSM
           12804]
 gi|163261014|emb|CAP43316.1| putative DNA polymerase bacteriophage-type [Bordetella petrii]
          Length = 204

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/188 (19%), Positives = 79/188 (42%), Gaps = 17/188 (9%)

Query: 85  RSFHDCHLCS---TSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQ 141
           R   DC  C     +   +         +M++G  P D ++++G+PF G  G +LD+ LQ
Sbjct: 20  RRLQDCRRCGLWRDATQPVAGAGKRSARIMLVGEQPGDKEDLAGQPFVGPAGALLDRALQ 79

Query: 142 SIEIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELISPKILLFIG 194
           +  + R  ++++       W   G R +    +  E+E C   +  ++  + P++++ +G
Sbjct: 80  AAGVPREAVYVTNAVKHFKWQARGKRRMHKTPAQREIEACHYWLEDELRAVRPRVVVALG 139

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP--LIKKNTWHALI 252
                             LG+       H  +  +A  HP   ++ P    ++  + A++
Sbjct: 140 ATALRSVMQAKPPALKAVLGR----ALEHDGMAVIAAYHPSFALRAPDTQARRRAFEAIV 195

Query: 253 -TLKKALK 259
             L++A +
Sbjct: 196 QALERAAR 203


>gi|269792546|ref|YP_003317450.1| phage SPO1 DNA polymerase-like protein [Thermanaerovibrio
           acidaminovorans DSM 6589]
 gi|269100181|gb|ACZ19168.1| phage SPO1 DNA polymerase-related protein [Thermanaerovibrio
           acidaminovorans DSM 6589]
          Length = 196

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 87/193 (45%), Gaps = 10/193 (5%)

Query: 69  SIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPF 128
           S+  ++  L ++++   S   C LCS+  + +         LM +G  P   ++  G PF
Sbjct: 2   SLEDRSLMLEQIRNRALSCERCGLCSSRTNVVFGEGVLEGGLMFVGEGPGADEDQQGVPF 61

Query: 129 SGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPK 188
            G+ G +L ++L +  I R Q++I+ +    PPGNR  +  EM  C   +  QI L+ P+
Sbjct: 62  VGRAGQLLTQILSAAGISRDQVYITNVVKCRPPGNRVPTYEEMMACDQFLQAQILLVRPR 121

Query: 189 ILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKN-- 246
           +L+ +G+    +       KT + + K          +  +   HP  L++ P  K    
Sbjct: 122 LLVLLGSTPTKWIL-----KTQEAISKLRGQWFQWRGMEVMPMFHPSYLLRNPSNKVGSP 176

Query: 247 ---TWHALITLKK 256
              TW  +  +K+
Sbjct: 177 KHLTWEDIQEVKR 189


>gi|157413095|ref|YP_001483961.1| Uracil-DNA glycosylase [Prochlorococcus marinus str. MIT 9215]
 gi|157387670|gb|ABV50375.1| Uracil-DNA glycosylase [Prochlorococcus marinus str. MIT 9215]
          Length = 167

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 68/135 (50%), Gaps = 8/135 (5%)

Query: 109 DLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEI-MRTQIHISMISPWHPPGNRNLS 167
           DL+IIG  P   +++ GKP+ GK+G +L ++L    I     ++   +    PP NR  +
Sbjct: 14  DLLIIGEAPGAQEDLEGKPYVGKSGKLLKELLIKAGIDYEADVYFCNVIKCRPPNNRKPT 73

Query: 168 NIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNL-GKWSNLCTPHSII 226
             E++I +P +++QI+L+ PK +L  G+         + + +  NL G+W          
Sbjct: 74  TGEIKIHKPWLLQQIKLVDPKFILLTGSTAMRAIL--EVKDSISNLRGQWIKKDGRE--- 128

Query: 227 PTLATVHPQELIQYP 241
             +   HP  L+++P
Sbjct: 129 -IMVIFHPSYLLRFP 142


>gi|254457996|ref|ZP_05071423.1| uracil-DNA glycosylase superfamily protein [Campylobacterales
           bacterium GD 1]
 gi|207085389|gb|EDZ62674.1| uracil-DNA glycosylase superfamily protein [Campylobacterales
           bacterium GD 1]
          Length = 218

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/198 (23%), Positives = 94/198 (47%), Gaps = 6/198 (3%)

Query: 62  PLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSD 121
           P      S  ++  +L+EL   + S H C L  +   ++        +LMI+ ++ S SD
Sbjct: 26  PFYVNEKSTHEEPKTLNELSQNISSCHLCDLSKSRQQSMSGYGNPNAELMIVDFSVSMSD 85

Query: 122 NISGKPFSGKTGNMLDKMLQSIEIMRT-QIHISMISPWHPPGNRNLSNIEMEICRPIIMR 180
           + +   +SG++G  L  M++ +  ++T  ++ +      P  +   S  E + C+  +  
Sbjct: 86  DSNNGYYSGRSGESLTNMIEKVIGLKTDDVYFTHAIKCKPLNSNVPSASEWDSCKSYLFT 145

Query: 181 QIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQY 240
           QI+ + PK+++ +G +   +F     +  +QN+         + +IP     HPQ L++ 
Sbjct: 146 QIDFVKPKVIVTLGEEA--YFKLTSEESDFQNVRGHVIDFKKYKLIP---IYHPQFLLRN 200

Query: 241 PLIKKNTWHALITLKKAL 258
           P +K+ T + L T+K  L
Sbjct: 201 PELKRITLNDLKTIKSCL 218


>gi|289548718|ref|YP_003473706.1| phage SPO1 DNA polymerase-related protein [Thermocrinis albus DSM
           14484]
 gi|289182335|gb|ADC89579.1| phage SPO1 DNA polymerase-related protein [Thermocrinis albus DSM
           14484]
          Length = 217

 Score = 63.5 bits (153), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/125 (23%), Positives = 62/125 (49%)

Query: 71  AQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSG 130
           ++K  +L EL   + +   C     S   +         ++ +G  P + ++   +PF G
Sbjct: 29  SEKKMALAELYRTMEAEGRCVRYEGSNGYVLGEGNPCSPVIFVGEAPGEEEDRQRRPFVG 88

Query: 131 KTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKIL 190
           + G  L+  L+ + + R  ++I+ +    PPGNR  +  E+  C   + ++IE+I PK++
Sbjct: 89  RAGQYLNAKLEEVGLRRQDVYITNVVKSRPPGNRTPTAQEIASCVSYLRKEIEIIKPKVI 148

Query: 191 LFIGN 195
           + +G+
Sbjct: 149 VCLGS 153


>gi|171910613|ref|ZP_02926083.1| phage SPO1 DNA polymerase-related protein [Verrucomicrobium
           spinosum DSM 4136]
          Length = 476

 Score = 63.5 bits (153), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 71/161 (44%), Gaps = 15/161 (9%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C L   +  T+        +++ +G  P D ++++GKPF G  G +LD+ LQ   I R  
Sbjct: 296 CPLYKDATQTVFGEGHVSAEIVFLGEQPGDQEDLAGKPFVGPAGRLLDQALQEAGIDRET 355

Query: 150 IHISMIS---PWHPPGNRNLSNI----EMEICRPIIMRQIELISPKILLFIGNKTKNFFF 202
            +++       W   G R L       E+  C+P    ++ +I P+IL+ +G        
Sbjct: 356 CYVTNAVKHFKWKRQGKRRLHQTPVQAEIHACKPWWRAELAIIKPRILVCLGATAARTVL 415

Query: 203 NNDAQKTYQNLGKW--SNLCTPHSIIPTLATVHPQELIQYP 241
            + A K     G++  +  C       TL TVHP  L++ P
Sbjct: 416 EH-AVKIGDVRGEFMETTWCE-----KTLVTVHPSSLLRQP 450


>gi|91779684|ref|YP_554892.1| Phage SPO1 DNA polymerase-related protein [Burkholderia xenovorans
           LB400]
 gi|91692344|gb|ABE35542.1| Phage SPO1 DNA polymerase-related protein [Burkholderia xenovorans
           LB400]
          Length = 214

 Score = 63.5 bits (153), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/166 (21%), Positives = 73/166 (43%), Gaps = 14/166 (8%)

Query: 86  SFHDCHLCSTSLSTICATQTEG---QDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQS 142
           +  +C  C+   +   A   EG     +M++G  P D++++ G+PF G  G +LDK L+ 
Sbjct: 28  TLDECRRCTLWRNATQAVPGEGPRRASIMLVGEQPGDAEDLQGRPFVGPAGALLDKALEE 87

Query: 143 IEIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELISPKILLFIGN 195
             + R  ++++       W P G R +       E+E C   + +++  +  ++++ +G 
Sbjct: 88  AGLKRKDVYVTNAVKHFKWTPRGKRRMHKTPGQREIEACGYWLEQELRTVRARVIVALGA 147

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
                  ++   +    LGK       H     +AT HP   ++ P
Sbjct: 148 TALKAVLDDSHARLQDALGK----TIGHGEHLVVATYHPSFALRAP 189


>gi|325523775|gb|EGD02024.1| phage SPO1 DNA polymerase-related protein [Burkholderia sp. TJI49]
          Length = 164

 Score = 63.5 bits (153), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 45/77 (58%), Gaps = 1/77 (1%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C LC    +T+        D M++G  P ++++  G+PF G+ G +LD ML+S+ + R +
Sbjct: 85  CRLCEKRTNTVFGVGDREADWMLVGEAPGENEDKQGEPFVGQAGKLLDNMLRSLSLERGR 144

Query: 150 -IHISMISPWHPPGNRN 165
            ++I+ +    PPGNRN
Sbjct: 145 NVYIANVIKCRPPGNRN 161


>gi|288573334|ref|ZP_06391691.1| phage SPO1 DNA polymerase-related protein [Dethiosulfovibrio
           peptidovorans DSM 11002]
 gi|288569075|gb|EFC90632.1| phage SPO1 DNA polymerase-related protein [Dethiosulfovibrio
           peptidovorans DSM 11002]
          Length = 192

 Score = 63.5 bits (153), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 59/120 (49%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           S  +L+  + +   C L  T  + +     E   ++++G  P   ++ +G+PF G++G  
Sbjct: 2   SWSKLREAVGTCRGCSLWETRNNAVFGEGPEDSPVLLVGEAPGAEEDSTGRPFVGRSGRF 61

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           L  ++    + R  + IS I    PPGNRN    E+  C   +   + L+ P++++ +GN
Sbjct: 62  LSDLMAEAGLRREDLFISNIVHCRPPGNRNPKKGEIRACLQWLEDIVGLLRPQVVVTVGN 121


>gi|126696066|ref|YP_001090952.1| Uracil-DNA glycosylase [Prochlorococcus marinus str. MIT 9301]
 gi|126543109|gb|ABO17351.1| Uracil-DNA glycosylase [Prochlorococcus marinus str. MIT 9301]
          Length = 167

 Score = 63.5 bits (153), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 69/135 (51%), Gaps = 8/135 (5%)

Query: 109 DLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEI-MRTQIHISMISPWHPPGNRNLS 167
           DL+IIG  P   +++ GKP+ GK+G +L+++L    I  +  ++   +    PP NR  +
Sbjct: 14  DLLIIGEAPGAQEDLEGKPYVGKSGKLLNELLIQAGIDYKKDVYFCNVIKCRPPNNRKPT 73

Query: 168 NIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNL-GKWSNLCTPHSII 226
             E+ I +P +++QI+L+ PK +L  G+         + +    NL G+W        +I
Sbjct: 74  AREINIHKPWLLQQIKLVDPKFILLTGSTAMRAIL--EVKDPISNLRGQWIKQDGREIMI 131

Query: 227 PTLATVHPQELIQYP 241
                 HP  L+++P
Sbjct: 132 ----IFHPSYLLRFP 142


>gi|237793391|ref|YP_002860943.1| uracil-DNA glycosylase [Clostridium botulinum Ba4 str. 657]
 gi|229263750|gb|ACQ54783.1| uracil-DNA glycosylase [Clostridium botulinum Ba4 str. 657]
          Length = 190

 Score = 63.5 bits (153), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 67/153 (43%), Gaps = 6/153 (3%)

Query: 110 LMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSN 168
           +M IG  P   ++ +G+PF GK G +L K L +++  R +  +I  +    P  NR    
Sbjct: 37  IMFIGEAPGADEDRTGRPFVGKAGQLLTKALLALDFKRDEHYYICNVCKCRPENNRTPKE 96

Query: 169 IEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPT 228
            E   C   +  Q+ L+ PKI++ +G     +      + T ++ GKW            
Sbjct: 97  EEAMTCLHYLRNQVALVKPKIMICLGATALKYIMGEQFRIT-RDRGKW----IERKGYYI 151

Query: 229 LATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
           + T HP  L +    KK  W  L ++++    L
Sbjct: 152 MVTFHPAALFRDESKKKLLWQDLKSIREKYDEL 184


>gi|300853380|ref|YP_003778364.1| putative phage related DNA polymerase [Clostridium ljungdahlii DSM
           13528]
 gi|300433495|gb|ADK13262.1| predicted phage related DNA polymerase [Clostridium ljungdahlii DSM
           13528]
          Length = 192

 Score = 63.5 bits (153), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 75/179 (41%), Gaps = 6/179 (3%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           EL     S   C L     + +         +M IG  P   ++ +G PF G+ G +L K
Sbjct: 6   ELYEECLSCSKCSLGDNRTNMVFGDGNPKAHIMFIGEAPGADEDRTGIPFVGRAGQLLTK 65

Query: 139 MLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT 197
            L ++++ R +  +I  I    P  NR     E + C P +  Q+ L+ PKI++ +G   
Sbjct: 66  ALLALDLHRERDYYICNICKCRPKNNRTPYEEEEKACIPYLRNQVALVRPKIIVCLGATA 125

Query: 198 KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
                  + + T ++ GKW             AT HP  +++    K   W  L ++K+
Sbjct: 126 MGCILGKEWRIT-RDRGKW----IERKGFYMTATFHPSAVLRDANKKAAFWEDLKSIKE 179


>gi|206896457|ref|YP_002247082.1| DNA polymerase, bacteriophage-type [Coprothermobacter proteolyticus
           DSM 5265]
 gi|206739074|gb|ACI18152.1| DNA polymerase, bacteriophage-type [Coprothermobacter proteolyticus
           DSM 5265]
          Length = 186

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 37/171 (21%), Positives = 72/171 (42%), Gaps = 4/171 (2%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           EL+    +   C LC T  + +  +      L ++G  P  +++  G PF G+ G +LD 
Sbjct: 8   ELEQFALNCKACELCKTRRNVVFGSGDPNSRLWLVGEAPGSNEDEQGLPFVGQAGAILDT 67

Query: 139 MLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTK 198
            L+     R  + I+ +    PP N + +  +   C PI+  Q+ +  PK +L +G    
Sbjct: 68  FLEKNGFKRHSLFITNVIKCRPPNNADPTEDQKSNCFPILAAQLAIGKPKYILALGRHAA 127

Query: 199 NFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWH 249
             F      K ++++ +             + T HP  +++ P + +   H
Sbjct: 128 EAF----VPKPFRSIKEIRGQVVLSGETKVVVTYHPAAVLRNPRLGEIVEH 174


>gi|269925234|ref|YP_003321857.1| phage SPO1 DNA polymerase-related protein [Thermobaculum terrenum
           ATCC BAA-798]
 gi|269788894|gb|ACZ41035.1| phage SPO1 DNA polymerase-related protein [Thermobaculum terrenum
           ATCC BAA-798]
          Length = 206

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 70/163 (42%), Gaps = 23/163 (14%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C L  T    +      G  +M +G  P + ++ +G PF G+ G +LD++L+   I R  
Sbjct: 25  CTLWQTRTQVVFGAGKAGSKIMFVGEAPGEDEDRTGTPFVGRAGILLDQLLEEAGIGRES 84

Query: 150 IHISMISPWHPPG-------NRNLSNIEMEICRPIIMRQIELISPKILLFIG---NKT-- 197
            +I+ I    P         NR     E+  C P +  +I L+ P +++ +G    KT  
Sbjct: 85  TYITNIIRCRPTAVTQGKITNRAPRAGEVSACEPWMWLEIHLVKPSVIVCVGAPAAKTLI 144

Query: 198 -KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ 239
            KNF  ++     Y+              I  +AT+HP  L++
Sbjct: 145 DKNFRLSDQRGDVYEK----------EDGIRYIATLHPAYLLR 177


>gi|171320930|ref|ZP_02909924.1| Uracil-DNA glycosylase superfamily [Burkholderia ambifaria MEX-5]
 gi|171093795|gb|EDT38932.1| Uracil-DNA glycosylase superfamily [Burkholderia ambifaria MEX-5]
          Length = 171

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 69/139 (49%), Gaps = 17/139 (12%)

Query: 111 MIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMIS---PWHPPGNRNL- 166
           M++G  P D ++ +G PF G  G MLD+ L+   I R  ++++       W P G R L 
Sbjct: 1   MLVGEQPGDQEDRTGIPFVGAAGRMLDRALEEAGIERASVYVTNAVKHFKWEPRGKRRLH 60

Query: 167 ---SNIEMEICRPIIMRQIELISPKILLFIGNKT-KNFFFNNDA--QKTYQNLGKWSNLC 220
              +  E+  CR  + R++  + P++++ +G    +    +NDA  ++T Q       + 
Sbjct: 61  KTPAQREVAACRYWLERELAALGPRVIVALGATALRAVLQDNDATLERTRQ------PVR 114

Query: 221 TPHSIIPTLATVHPQELIQ 239
           +P   +  +AT HP  +++
Sbjct: 115 SPDGCL-VVATYHPSYVLR 132


>gi|255070667|ref|XP_002507415.1| predicted protein [Micromonas sp. RCC299]
 gi|226522690|gb|ACO68673.1| predicted protein [Micromonas sp. RCC299]
          Length = 248

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 48/205 (23%), Positives = 88/205 (42%), Gaps = 10/205 (4%)

Query: 63  LVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDN 122
           L   AD+ +    SL EL   LRS     L S     +         +MIIG  P   ++
Sbjct: 41  LASDADARSPSFSSLDELAHHLRSLTGDPLESDGGRIVTFRGDTNARVMIIGEAPGAEED 100

Query: 123 ISGKPFSGKTGNMLDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQ 181
             G PF G+ G +LD++  S+ +   +  +++ +    P  NR+ +  E+E  R  +  +
Sbjct: 101 KLGVPFVGRAGKLLDEIFASVTLSTDRHCYVTNVVKRRPLNNRDPTAREIEWYRGYLREE 160

Query: 182 IELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
           I L+ P I++  G  +       + +   +  G+W ++     ++P     HP  L++ P
Sbjct: 161 IRLLDPAIIVCTGRHSMRTLLGKNCEGITKIRGRWFDVDG-RVVMPMF---HPSYLLRNP 216

Query: 242 L-----IKKNTWHALITLKKALKNL 261
                  K  TW  +  +K+ +  L
Sbjct: 217 QKTPGSPKALTWDDIREVKRKVDEL 241


>gi|172065650|ref|YP_001816362.1| phage SPO1 DNA polymerase-related protein [Burkholderia ambifaria
           MC40-6]
 gi|171997892|gb|ACB68809.1| phage SPO1 DNA polymerase-related protein [Burkholderia ambifaria
           MC40-6]
          Length = 217

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 77/171 (45%), Gaps = 17/171 (9%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           E  + L +   C L   +   +         +M++G  P D ++ +G PF G  G MLD+
Sbjct: 15  EAPATLDACRRCGLWEHATQPVPGAGPTDARIMLVGEQPGDQEDRTGIPFVGAAGRMLDR 74

Query: 139 MLQSIEIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELISPKILL 191
            L    I R  ++++       W P G R L    +  E+  CR  + R++  + P++++
Sbjct: 75  ALDEAGIERASVYVTNAVKHFKWEPRGKRRLHKTPAQREVAACRYWLERELAALGPRVIV 134

Query: 192 FIGNKT-KNFFFNNDA--QKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ 239
            +G    +    +NDA  ++T Q       + +P   +  +AT HP  +++
Sbjct: 135 ALGATALRAVLQDNDATLERTRQ------PVRSPDGCL-VVATYHPSYVLR 178


>gi|108799959|ref|YP_640156.1| phage SPO1 DNA polymerase-related protein [Mycobacterium sp. MCS]
 gi|119869069|ref|YP_939021.1| phage SPO1 DNA polymerase-related protein [Mycobacterium sp. KMS]
 gi|108770378|gb|ABG09100.1| phage SPO1 DNA polymerase-related protein [Mycobacterium sp. MCS]
 gi|119695158|gb|ABL92231.1| phage SPO1 DNA polymerase-related protein [Mycobacterium sp. KMS]
          Length = 230

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 44/199 (22%), Positives = 80/199 (40%), Gaps = 26/199 (13%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKM 139
           L   +++   C L   +   +    +    +M +G  P D ++ +G+PF G  G +LDK 
Sbjct: 21  LADAVQACRGCELYRDATQGVFGQGSANATVMFVGEQPGDQEDRAGEPFVGPAGRLLDKA 80

Query: 140 LQSIEIMRTQI-------HISMISPWHPPGNRNL----SNIEMEICRPIIMRQIELISPK 188
           L S  I R  +       H     P    G R +    S  E+  CRP ++ +++ + P+
Sbjct: 81  LVSAGIDRDGVYVTNAVKHFKFTLPER--GKRRIHKTPSRTEVVACRPWLLAELDAVRPE 138

Query: 189 ILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPT--------LATVHPQELIQY 240
           +++ +G         ND + T     +   L  P    P         + T HP  +++ 
Sbjct: 139 VVVLLGATAAKALLGNDFRLTAH---RGEVLALPPVTEPADLHVDPAVVVTAHPSSVLRG 195

Query: 241 PLIKKNTWHALITLKKALK 259
           P   +N   A   L + L+
Sbjct: 196 P--AENRQQAFDALVEDLR 212


>gi|108803651|ref|YP_643588.1| phage SPO1 DNA polymerase-like protein [Rubrobacter xylanophilus
           DSM 9941]
 gi|108764894|gb|ABG03776.1| phage SPO1 DNA polymerase-related protein [Rubrobacter xylanophilus
           DSM 9941]
          Length = 209

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 26/108 (24%), Positives = 57/108 (52%), Gaps = 2/108 (1%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C LC +    +         L ++G  P  +++ +G+PF G +G +L+ +L S+ + R +
Sbjct: 16  CGLCQSRTRVVFGEGPLNARLFVVGEAPGHNEDAAGRPFQGASGMLLEGLLGSVGLSREE 75

Query: 150 IHISMISPWHPPGN--RNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           ++++ +    PPG   R+    E+  CR  ++ Q+  + PK+++ +G 
Sbjct: 76  VYLTTLVKCRPPGTPPRSPRPSEVSSCRRYLISQLVAVDPKVVVALGE 123


>gi|78779060|ref|YP_397172.1| phage SPO1 DNA polymerase-related protein [Prochlorococcus marinus
           str. MIT 9312]
 gi|78712559|gb|ABB49736.1| phage SPO1 DNA polymerase-related protein [Prochlorococcus marinus
           str. MIT 9312]
          Length = 167

 Score = 63.2 bits (152), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 68/135 (50%), Gaps = 8/135 (5%)

Query: 109 DLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEI-MRTQIHISMISPWHPPGNRNLS 167
           DL+IIG  P   +++ GKP+ GK+G +L+++L    I  +  ++   +    PP NR  +
Sbjct: 14  DLLIIGEAPGAQEDLEGKPYVGKSGKLLNELLIKAGIDYKEDVYFCNVIKCRPPNNRKPT 73

Query: 168 NIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNL-GKWSNLCTPHSII 226
             E+ I +P +++QI+L+ PK +L  G+         + +    NL G+W          
Sbjct: 74  AREINIHKPWLLQQIKLVDPKFILLTGSTAMRAIL--EVKDPISNLRGQW----IKKDGR 127

Query: 227 PTLATVHPQELIQYP 241
             +   HP  L+++P
Sbjct: 128 EIMVIFHPSYLLRFP 142


>gi|78184753|ref|YP_377188.1| Phage SPO1 DNA polymerase-related protein [Synechococcus sp.
           CC9902]
 gi|78169047|gb|ABB26144.1| Phage SPO1 DNA polymerase-related protein [Synechococcus sp.
           CC9902]
          Length = 187

 Score = 63.2 bits (152), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 72/169 (42%), Gaps = 7/169 (4%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           +L + LR    C L +T    +         LM+IG  P   ++ +G PF G++G  LD+
Sbjct: 5   DLDACLRC-SACELATTRQKVVVYRGNPKAPLMLIGEAPGAQEDQTGLPFKGRSGQALDR 63

Query: 139 MLQSIEI-MRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT 197
           +L      +   ++I       PP NR     E+  CRP + +QI  ++P +++  G   
Sbjct: 64  LLIEAGFNIEKDLYICNAVKCRPPNNRRPKKTELTACRPWLDKQIAEVNPAVIVLTGATA 123

Query: 198 KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKN 246
                      T +  GKW       S++P     HP  L+++   K+ 
Sbjct: 124 VQALLELKTAMT-ELRGKWQTW-QGRSVMPIF---HPAYLLRHASAKEG 167


>gi|116074927|ref|ZP_01472188.1| phage SPO1 DNA polymerase-related protein [Synechococcus sp.
           RS9916]
 gi|116068149|gb|EAU73902.1| phage SPO1 DNA polymerase-related protein [Synechococcus sp.
           RS9916]
          Length = 201

 Score = 62.8 bits (151), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 56/108 (51%), Gaps = 6/108 (5%)

Query: 93  CSTSLST-----ICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR 147
           C  SLST     + +       +M+IG  P  S++  G PF G++G +LD++L    +  
Sbjct: 18  CRCSLSTQRQQVVVSRGNPNAQVMLIGEAPGASEDAQGLPFVGRSGQLLDQLLVQAGLSP 77

Query: 148 TQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
            + + I+ +    PP NR  S  E+  CRP I  QI ++ P +++ +G
Sbjct: 78  DRDLFITNVVKCRPPDNRKPSAKELSACRPWIEEQIAIVDPTVVILVG 125


>gi|254467751|ref|ZP_05081158.1| putative DNA polymerase related protein [Rhodobacterales bacterium
           Y4I]
 gi|206684188|gb|EDZ44674.1| putative DNA polymerase related protein [Rhodobacterales bacterium
           Y4I]
          Length = 488

 Score = 62.8 bits (151), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 39/170 (22%), Positives = 77/170 (45%), Gaps = 14/170 (8%)

Query: 82  SLLRSFHDCHLCSTSLSTICATQTEG-QD--LMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
            L  +   C  C    +   A   EG QD  LM++G  P D ++++G+PF G  G +LD 
Sbjct: 287 GLAAALAGCTRCPLHCAATQAVPGEGPQDAALMLVGEQPGDREDLTGRPFVGPAGQLLDA 346

Query: 139 MLQSIEIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELISPKILL 191
           +     + R  ++++       + P G R +       E++ CR  +  +++L+ P++++
Sbjct: 347 VAAEAGVAREAVYLTNAVKHFKFRPQGRRRMHQRPDAGEVQRCRWWLDAEVKLVRPRLIV 406

Query: 192 FIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
            +G  T         ++     G    + T    +P L T+HP  +++ P
Sbjct: 407 AMG-ATAALALTGRGEQLMARRG---TVETSRQGMPVLLTLHPAHILRTP 452


>gi|33861232|ref|NP_892793.1| Uracil-DNA glycosylase [Prochlorococcus marinus subsp. pastoris
           str. CCMP1986]
 gi|33639964|emb|CAE19134.1| Uracil-DNA glycosylase [Prochlorococcus marinus subsp. pastoris
           str. CCMP1986]
          Length = 167

 Score = 62.8 bits (151), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 68/135 (50%), Gaps = 10/135 (7%)

Query: 109 DLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEI-MRTQIHISMISPWHPPGNRNLS 167
           +L+IIG  P   +++ G+P+ G++G +LD++L    I ++  ++   +    PP NR  +
Sbjct: 14  NLLIIGEAPGALEDLEGEPYVGRSGKLLDELLIEAGIDLQKDVYFCNVIKCRPPNNRKPT 73

Query: 168 NIEMEICRPIIMRQIELISPKILLFIGNKTKNFFF--NNDAQKTYQNLGKWSNLCTPHSI 225
           N E+ I +P +M+QI+L+ PK ++  G+          N   KT    GKW        I
Sbjct: 74  NKEINIHKPWLMQQIKLVDPKFIILTGSTAMRTILEIKNPISKTR---GKWFKKGGREII 130

Query: 226 IPTLATVHPQELIQY 240
                  HP  L+++
Sbjct: 131 ----TIFHPSYLLRF 141


>gi|182680237|ref|YP_001834383.1| phage SPO1 DNA polymerase-related protein [Beijerinckia indica
           subsp. indica ATCC 9039]
 gi|182636120|gb|ACB96894.1| phage SPO1 DNA polymerase-related protein [Beijerinckia indica
           subsp. indica ATCC 9039]
          Length = 211

 Score = 62.8 bits (151), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 50/211 (23%), Positives = 94/211 (44%), Gaps = 17/211 (8%)

Query: 56  IRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGY 115
           +R   SP+++  +    K  SL  L+   R+   C L   +  T+     +   L+I+G 
Sbjct: 1   MRSQASPIMRDGNIPLPK--SLEALREAARTCQRCPLWKHATQTVFGEGPKDARLLIVGE 58

Query: 116 TPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMIS---PWHPPGNRNL----SN 168
            P D +++ G PF G  G +LDK L  + I R +++++       + P G R +    + 
Sbjct: 59  QPGDKEDLQGHPFVGPAGLLLDKALGEVGIDRRRVYVTNAVKHFKFEPRGKRRMHKTPTT 118

Query: 169 IEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSI-IP 227
            E++ CR  +  +  L+ PK++L +G    +    + A+     +G+      P      
Sbjct: 119 TEIKACRFWLEGEFALLEPKLVLALGATALHGLLGHVAR-----IGEMRGEPIPFGDNAK 173

Query: 228 TLATVHPQELIQY--PLIKKNTWHALITLKK 256
            L T HP  +++   P+  +N    L  LK+
Sbjct: 174 LLVTTHPSAILRMKEPMRAQNYADFLNDLKR 204


>gi|123968265|ref|YP_001009123.1| Uracil-DNA glycosylase [Prochlorococcus marinus str. AS9601]
 gi|123198375|gb|ABM70016.1| Uracil-DNA glycosylase [Prochlorococcus marinus str. AS9601]
          Length = 167

 Score = 62.8 bits (151), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 68/135 (50%), Gaps = 8/135 (5%)

Query: 109 DLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEI-MRTQIHISMISPWHPPGNRNLS 167
           DL++IG  P   +++ GKP+ GK+G +L+++L    I  +  ++   +    PP NR  +
Sbjct: 14  DLLVIGEAPGAQEDLEGKPYVGKSGKLLNELLIQAGIDYKKDVYFCNVIKCRPPNNRKPT 73

Query: 168 NIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNL-GKWSNLCTPHSII 226
             E+ I +P +++QI+L+ PK +L  G+         + +    NL G+W          
Sbjct: 74  AREINIHKPWLLQQIKLVDPKFILLTGSTAMRAIL--EVKDPISNLRGQWIKKDGRE--- 128

Query: 227 PTLATVHPQELIQYP 241
             +   HP  L+++P
Sbjct: 129 -IMVIFHPSYLLRFP 142


>gi|110634843|ref|YP_675051.1| phage SPO1 DNA polymerase-related protein [Mesorhizobium sp. BNC1]
 gi|110285827|gb|ABG63886.1| phage SPO1 DNA polymerase-related protein [Chelativorans sp. BNC1]
          Length = 476

 Score = 62.8 bits (151), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 77/189 (40%), Gaps = 15/189 (7%)

Query: 63  LVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQ---DLMIIGYTPSD 119
           L ++  SI+ ++  L  L  L      C LC        A   EG    ++M +G  P D
Sbjct: 267 LAERMASISAQSGELLPLDVLREEIQSCRLCPLHGPATQAVPGEGAPEAEIMFVGEQPGD 326

Query: 120 SDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMIS---PWHPPGNRNL----SNIEME 172
            ++++G+PF G  G + ++ L    I R + +++       + P G R +    S  E+ 
Sbjct: 327 QEDLAGRPFVGPAGQVFERALLEAGIARQKTYVTNAVKHFKFEPRGKRRVHMKPSGGEVS 386

Query: 173 ICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATV 232
            CR  + R+I  + PK+++ +G              T     K             L TV
Sbjct: 387 KCRFWLDREISAVKPKLVVALGATAMLGLTGRPVPVT-----KARGQVIAADSFSILVTV 441

Query: 233 HPQELIQYP 241
           HP  L++ P
Sbjct: 442 HPSYLLRLP 450


>gi|222478815|ref|YP_002565052.1| phage SPO1 DNA polymerase-related protein [Halorubrum lacusprofundi
           ATCC 49239]
 gi|222451717|gb|ACM55982.1| phage SPO1 DNA polymerase-related protein [Halorubrum lacusprofundi
           ATCC 49239]
          Length = 204

 Score = 62.4 bits (150), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 63/126 (50%), Gaps = 1/126 (0%)

Query: 109 DLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSN 168
           DL+ +G  P   ++  G+PF G++G++LD  L+   + R  + I+      PP NR+ + 
Sbjct: 40  DLLFVGEGPGAQEDERGEPFVGRSGDVLDDALRDAGLARADVRITNCVRCRPPDNRDPTT 99

Query: 169 IEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPT 228
            E+  CR  +  +I+ + P++++ +G        +     T ++ G+  ++    +    
Sbjct: 100 EELANCRGYLDAEIDRLDPELIVTLGKVPSEHLLDRSVAITSES-GEVVDVRIAGASRRV 158

Query: 229 LATVHP 234
           L +VHP
Sbjct: 159 LLSVHP 164


>gi|32472802|ref|NP_865796.1| DNA polymerase related protein [Rhodopirellula baltica SH 1]
 gi|32444039|emb|CAD73481.1| putative DNA polymerase related protein [Rhodopirellula baltica SH
           1]
          Length = 496

 Score = 62.4 bits (150), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 44/207 (21%), Positives = 86/207 (41%), Gaps = 31/207 (14%)

Query: 54  TNIRHIHS-----PLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQ 108
           T IRH        P + +  S  + + S+  L+        C L   +  T+        
Sbjct: 275 TMIRHAEGGVSARPFLPEV-STGESSQSIARLREAAAVCQGCDLHGPATQTVFGVGNPNA 333

Query: 109 DLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMIS---PWHPPGNRN 165
            L+++G  P D ++++G+PF G  G +L + L  + +   +++I+       + P G R 
Sbjct: 334 KLVLVGEQPGDREDLAGEPFVGPAGQLLRETLNDVGLDPAELYITNSVKHFKFKPTGKRR 393

Query: 166 L----SNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFN-------NDAQKTYQNLG 214
           L    +  E+  CRP +  ++++I PK+++ +G                +  Q    +  
Sbjct: 394 LHVKPAAREVAACRPWLEAELDVIRPKMVVALGATAAGVLLGPGFRLLKSRGQVQRSDHA 453

Query: 215 KWSNLCTPHSIIPTLATVHPQELIQYP 241
           KW           T+AT HP  +++ P
Sbjct: 454 KW-----------TIATYHPSAILRVP 469


>gi|21233304|ref|NP_639221.1| DNA polymerase-related protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66770264|ref|YP_245026.1| DNA polymerase-related protein [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|188993464|ref|YP_001905474.1| putative phage-related protein [Xanthomonas campestris pv.
           campestris str. B100]
 gi|21115573|gb|AAM43495.1| DNA polymerase-related protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66575596|gb|AAY51006.1| DNA polymerase-related protein [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|167735224|emb|CAP53436.1| putative phage-related protein [Xanthomonas campestris pv.
           campestris]
          Length = 219

 Score = 62.4 bits (150), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 50/217 (23%), Positives = 87/217 (40%), Gaps = 26/217 (11%)

Query: 61  SPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDS 120
           +PL +  D++   + +L  L++  +    C L   +   +         LMIIG  P D 
Sbjct: 12  TPLAKPVDTV--PSGTLTALRAQAQDCRRCDLWKPATQVVFGAGPARAPLMIIGEQPGDQ 69

Query: 121 DNISGKPFSGKTGNMLDKMLQSIE-------IMRTQIHISMISPWHPPGNRNL----SNI 169
           ++  G+PF G  G +L  ++           +  T  H   +    P G R L    +  
Sbjct: 70  EDQQGRPFVGPAGQLLGTLMADAGLDPAMAYVTNTVKHFKFV----PRGKRRLHQRATAG 125

Query: 170 EMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTL 229
           E   CRP +  ++  + P+I+L +G       F N  + T +  G+W  L         L
Sbjct: 126 EQAACRPWLAAELLRVRPRIVLALGAMAAQTLFGNAFRLTTER-GQWRAL---DGRTTAL 181

Query: 230 ATVHPQELIQYPLIKKNTWHALIT-----LKKALKNL 261
           A+ HP  +++     +    AL+      +  AL NL
Sbjct: 182 ASWHPSAILRMREPDRTATRALLREDLAQVAAALDNL 218


>gi|218460666|ref|ZP_03500757.1| putative uracil DNA glycosylase protein [Rhizobium etli Kim 5]
          Length = 329

 Score = 62.4 bits (150), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 49/219 (22%), Positives = 100/219 (45%), Gaps = 21/219 (9%)

Query: 35  ATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQK----ACSLHELKSLLRSFHDC 90
           A+ ES+ +E +   A Q +      H  L Q A +++ +    A +L  L++       C
Sbjct: 93  ASAESKVREMAAREATQSLP----FHDRLQQAARNLSAEPELPAGTLEALRAEAAVCTRC 148

Query: 91  HLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQI 150
            L + +  T+        D+M +G  P D ++I+G+PF G  G + D+++    I R+ +
Sbjct: 149 PLHANATQTVFGEGPRDADVMFVGEQPGDQEDIAGRPFVGPAGRLFDQVIGEAGIDRSTL 208

Query: 151 HISMIS---PWHPPGNRNLSNI----EMEICRPIIMRQIELISPKILLFIGNKTKNFFFN 203
           +++       + P G R +       E++ CR  +  ++ L+ PK+++ +G         
Sbjct: 209 YVTNAVKHFKYEPRGKRRVHQKPNMGEVKHCRWWLDLELALVKPKLIVAMGATALAAL-- 266

Query: 204 NDAQKTYQNL-GKWSNLCTPHSIIPTLATVHPQELIQYP 241
            D +   Q++ G+   +    ++     TVHP  L++ P
Sbjct: 267 TDVKGRLQDVRGRAMAIEGGRTL---FVTVHPSYLLRIP 302


>gi|257055335|ref|YP_003133167.1| uracil-DNA glycosylase, family 4 [Saccharomonospora viridis DSM
           43017]
 gi|256585207|gb|ACU96340.1| uracil-DNA glycosylase, family 4 [Saccharomonospora viridis DSM
           43017]
          Length = 211

 Score = 62.4 bits (150), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 36/161 (22%), Positives = 74/161 (45%), Gaps = 14/161 (8%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C L + +  T+     +   L+++G  P D ++  G+PF G +GN+LD+ L    I R  
Sbjct: 30  CDLFTDATQTVFGEGADRARLVLVGEMPGDREDREGRPFVGPSGNLLDRALGEAGIDRDT 89

Query: 150 IHISMISP---WHPPGNRNL------SNIEMEICRPIIMRQIELISPKILLFIGNKTKNF 200
           ++++       +   GNR        +  ++  C+P ++ +++ + P ++  +G      
Sbjct: 90  VYVTNAVKHFRFTREGNRRRRLHKKPTRSQITACKPWLLAELDAVRPDVVGLLGATAAQA 149

Query: 201 FFNNDAQKTYQNLGKWSNLCTPHSIIPTL--ATVHPQELIQ 239
            F+ D + +     +   L  P    P L  ATVHP  +++
Sbjct: 150 LFDADFRVSAH---RGEVLKLPGLDDPPLAVATVHPSAVLR 187


>gi|327539936|gb|EGF26537.1| Uracil DNA glycosylase superfamily protein [Rhodopirellula baltica
           WH47]
          Length = 496

 Score = 62.4 bits (150), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 44/207 (21%), Positives = 86/207 (41%), Gaps = 31/207 (14%)

Query: 54  TNIRHIHS-----PLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQ 108
           T IRH        P + +  S  + + S+  L+        C L   +  T+        
Sbjct: 275 TMIRHAEGGVSARPFLPEV-STGESSQSIARLREAAAVCQGCDLHGPATQTVFGVGNPNA 333

Query: 109 DLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMIS---PWHPPGNRN 165
            L+++G  P D ++++G+PF G  G +L + L  + +   +++I+       + P G R 
Sbjct: 334 KLVLVGEQPGDREDLAGEPFVGPAGQLLRETLNDVGLDPAELYITNSVKHFKFKPTGKRR 393

Query: 166 L----SNIEMEICRPIIMRQIELISPKILLFIGNKTKNF-------FFNNDAQKTYQNLG 214
           L    +  E+  CRP +  ++++I PK+++ +G                +  Q    +  
Sbjct: 394 LHVKPAAREVAACRPWLEAELDVIRPKMVVALGATAAGVVLGPGFRLLKSRGQVQRSDHA 453

Query: 215 KWSNLCTPHSIIPTLATVHPQELIQYP 241
           KW           T+AT HP  +++ P
Sbjct: 454 KW-----------TIATYHPSAILRVP 469


>gi|319780107|ref|YP_004139583.1| phage SPO1 DNA polymerase-related protein [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317165995|gb|ADV09533.1| phage SPO1 DNA polymerase-related protein [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 485

 Score = 62.4 bits (150), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 31/137 (22%), Positives = 66/137 (48%), Gaps = 7/137 (5%)

Query: 65  QQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNIS 124
           Q  ++    A ++ EL+   +    C L   +  T+     +   ++ +G  P D ++++
Sbjct: 281 QPVEAPEDDASTIPELREAAKGCRRCPLWRDATQTVFGEGPDNAKVIFVGEQPGDQEDLA 340

Query: 125 GKPFSGKTGNMLDKMLQSIEIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRPI 177
           GKPF G  G + D +L    + R +++++       + P G R +    ++ E++ CR  
Sbjct: 341 GKPFVGPAGKVFDAILDDAGVDRQKVYVTNAVKHFKFEPRGKRRIHSKPNSGEIQACRWW 400

Query: 178 IMRQIELISPKILLFIG 194
           I ++ ELI P + + +G
Sbjct: 401 IDQEFELIKPNLAVALG 417


>gi|163846564|ref|YP_001634608.1| phage SPO1 DNA polymerase-like protein [Chloroflexus aurantiacus
           J-10-fl]
 gi|222524355|ref|YP_002568826.1| phage SPO1 DNA polymerase-related protein [Chloroflexus sp.
           Y-400-fl]
 gi|163667853|gb|ABY34219.1| phage SPO1 DNA polymerase-related protein [Chloroflexus aurantiacus
           J-10-fl]
 gi|222448234|gb|ACM52500.1| phage SPO1 DNA polymerase-related protein [Chloroflexus sp.
           Y-400-fl]
          Length = 210

 Score = 62.0 bits (149), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 61/132 (46%), Gaps = 4/132 (3%)

Query: 78  HELKSLLRSFHDCHLCSTSLSTICATQTEG---QDLMIIGYTPSDSDNISGKPFSGKTGN 134
           H L ++ +    C  C+       A   EG     +M+IG  P   ++  G+PF G +G 
Sbjct: 5   HTLFAIAQEVQHCTACNLHKGRTRAVPGEGPANARIMLIGEGPGYHEDRQGRPFVGPSGQ 64

Query: 135 MLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEIC-RPIIMRQIELISPKILLFI 193
            L  +L    + R +++I+ +    PP NR+    E+  C +  +MRQI  I P +++ +
Sbjct: 65  FLTDLLALAGLRRDEVYIANVVKCRPPQNRDPEPEEIATCTKLFLMRQIAAIDPAVIVTL 124

Query: 194 GNKTKNFFFNND 205
           G  +   F   +
Sbjct: 125 GRFSMGLFLPGE 136


>gi|315500110|ref|YP_004088913.1| uracil-DNA glycosylase superfamily [Asticcacaulis excentricus CB
           48]
 gi|315418122|gb|ADU14762.1| Uracil-DNA glycosylase superfamily [Asticcacaulis excentricus CB
           48]
          Length = 280

 Score = 62.0 bits (149), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 71/142 (50%), Gaps = 5/142 (3%)

Query: 109 DLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSN 168
           D++I+G  P   ++ +   F GK G++ D  L ++ +    + +  +  W P G R  ++
Sbjct: 131 DVLIVGDVPDADEDEAQAAFQGKPGHLTDAALSALGLNARTLRLPGLF-WRPAGGRPATD 189

Query: 169 IEMEICRPIIMRQIELISPKILLFIG-NKTKNFFFNNDAQKTYQNLGKWSNLC-TPHSII 226
            ++ +  P + R IEL +PK+L+  G    ++   +ND+ +  +  GK  +L  +  S +
Sbjct: 190 EDIRLTSPFLRRLIELSAPKVLILCGATAVRSVLDSNDSVQKLR--GKAHHLTLSGGSSL 247

Query: 227 PTLATVHPQELIQYPLIKKNTW 248
               T  P  L++ PL KK  W
Sbjct: 248 RVFVTFPPALLLRQPLAKKAFW 269


>gi|5932364|gb|AAD56917.1|AF180145_9 hypothetical protein; zm12orf4 [Zymomonas mobilis subsp. mobilis
           ZM4]
          Length = 206

 Score = 62.0 bits (149), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 40/181 (22%), Positives = 80/181 (44%), Gaps = 12/181 (6%)

Query: 67  ADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGK 126
           +++  +KA S  +L   L   H C L   +   +C   +    ++ +G  P D ++++G+
Sbjct: 2   SEAAVKKAPSWEDLTEALHHCHSCALYQKATQVVCGEGSHTSPVIFVGEQPGDQEDLAGR 61

Query: 127 PFSGKTGNMLDKMLQSIEIMRTQIHIS----MISPWHPPGNRNLSNI----EMEICRPII 178
           PF G  G + D+++ SI   R +I+++        W   G R +       E++ CR  +
Sbjct: 62  PFVGPAGQVFDEVMASIGWPREEIYLTNAVKHFKFWL-KGERRIHQTPAPEEVDCCRYWL 120

Query: 179 MRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELI 238
            ++  L+ P++ + +G  T         Q      GK   L    +  P + T HP  ++
Sbjct: 121 RQEWRLLKPRLTIALGG-TAVLALTGKKQTLGSLRGK--ILTLGKAAAPFIVTYHPSYIL 177

Query: 239 Q 239
           +
Sbjct: 178 R 178


>gi|162148935|ref|YP_001603396.1| uracil-DNA glycosylase [Gluconacetobacter diazotrophicus PAl 5]
 gi|161787512|emb|CAP57108.1| Uracil-DNA glycosylase [Gluconacetobacter diazotrophicus PAl 5]
          Length = 433

 Score = 62.0 bits (149), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 41/178 (23%), Positives = 78/178 (43%), Gaps = 16/178 (8%)

Query: 75  CSLHELKSLLRSFHDCHLCSTS---LSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGK 131
             +  L +L+ +  DC +C  +     T+ +    G  LM++G  P D ++  G+PF G 
Sbjct: 231 ARIDSLPALIAAARDCLICPMARQTTQTVFSDGRPGAALMLVGEQPGDQEDRVGRPFVGP 290

Query: 132 TGNMLDKMLQSIEIMRTQIHISMISP---WHPPGNRNL---SNIE-MEICRPIIMRQIEL 184
            G +LD+ L    I R  ++++       +   G R L     +E +  C P +  +  +
Sbjct: 291 AGQLLDRTLHEAGITRDAVYVTNAVKHFRFQRRGTRRLHEKPTVENVTACAPWLAAERRI 350

Query: 185 ISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPT-LATVHPQELIQYP 241
           ++P++L+ +G                  +G+  +   P +   T L TVHP  L++ P
Sbjct: 351 VAPRVLVMLGATAAGAVLGRSV-----TIGRERSRPIPLADGSTGLVTVHPSFLLRQP 403


>gi|161522495|ref|YP_001585424.1| phage SPO1 DNA polymerase-related protein [Burkholderia multivorans
           ATCC 17616]
 gi|189348630|ref|YP_001941826.1| bacteriophage-type DNA polymerase [Burkholderia multivorans ATCC
           17616]
 gi|160346048|gb|ABX19132.1| phage SPO1 DNA polymerase-related protein [Burkholderia multivorans
           ATCC 17616]
 gi|189338768|dbj|BAG47836.1| bacteriophage-type DNA polymerase [Burkholderia multivorans ATCC
           17616]
          Length = 219

 Score = 62.0 bits (149), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 81/179 (45%), Gaps = 14/179 (7%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C L   +   +  T      ++++G  P D ++ +G PF G  G++LD+ L +  I R  
Sbjct: 28  CGLWEHATQPVPGTGPRHASIVLVGEQPGDQEDRTGVPFVGAAGHVLDRALDAAGIDRRS 87

Query: 150 IHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELISPKILLFIGNKT-KNFF 201
           ++++       W P G R L    +  E+  CR  + R++E + P++++ +G    +   
Sbjct: 88  VYLTNAVKHFKWEPRGKRRLHKTPAQREITACRYWLDRELESVHPRVIVALGGTALRAVL 147

Query: 202 FNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
            +NDA  T Q     +     + ++   AT HP  +++         HA  TL  AL+ 
Sbjct: 148 QDNDA--TLQRTPTPTRTAQGYLVV---ATYHPSYVLRTRGADSRE-HAYQTLVDALRT 200


>gi|297568259|ref|YP_003689603.1| phage SPO1 DNA polymerase-related protein [Desulfurivibrio
           alkaliphilus AHT2]
 gi|296924174|gb|ADH84984.1| phage SPO1 DNA polymerase-related protein [Desulfurivibrio
           alkaliphilus AHT2]
          Length = 277

 Score = 62.0 bits (149), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 46/193 (23%), Positives = 79/193 (40%), Gaps = 17/193 (8%)

Query: 79  ELKSLLRSFHDCHLCS----TSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
           +L  L     DC  C                E + L+I GY P  ++  +G P  G  G 
Sbjct: 90  DLTVLAAQLQDCRQCPHHQWRQKVIFGQGSAEARLLLIAGY-PGAAEEGAGLPCQGAAGE 148

Query: 135 MLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSN-------IEMEICRPIIMRQIELISP 187
           +LD+ML +I++ R QI+++ +    P   R  +          +  C P + +QI  I P
Sbjct: 149 LLDRMLAAIQLSRRQIYLTTLVKCIPEAARQAATSPAPPEPAAISACLPFLQQQIAAIRP 208

Query: 188 KILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNT 247
            ++  +G            +   Q  G++      +  IP + T+ P  L+  P +KK  
Sbjct: 209 ALICTLGPLPAQALLRT-GKHLLQLRGRFHQ----YRDIPLMPTLAPDFLLHNPEMKKYA 263

Query: 248 WHALITLKKALKN 260
           W  L  ++K L+ 
Sbjct: 264 WQDLQLIQKFLQK 276


>gi|197123093|ref|YP_002135044.1| phage SPO1 DNA polymerase-related protein [Anaeromyxobacter sp. K]
 gi|196172942|gb|ACG73915.1| phage SPO1 DNA polymerase-related protein [Anaeromyxobacter sp. K]
          Length = 224

 Score = 62.0 bits (149), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 36/172 (20%), Positives = 76/172 (44%), Gaps = 14/172 (8%)

Query: 80  LKSLLRSFHDCHLC---STSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L +L R+   C  C        T+      G  +M++G  P + ++ +G+PF G  G +L
Sbjct: 21  LPALRRAAAGCTACPLWERGTQTVFGAGPPGATVMLVGEQPGNDEDRAGEPFVGPAGRLL 80

Query: 137 DKMLQSIEIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELISPKI 189
           D+ L +  + R   +++       W P G R +    +  E+  C P +  +I  + P+ 
Sbjct: 81  DRALAAAGLDRRDAYVTNAVKHFKWEPRGKRRIHQKPNAGEVRACLPWLEAEIAAVRPRA 140

Query: 190 LLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
           ++ +G            + T +   +   + +P + +  +AT+HP  +++ P
Sbjct: 141 VVCLGATAAQALLGRGFRLTER---RGQPVPSPLAEV-VIATLHPSAVLRAP 188


>gi|221198651|ref|ZP_03571696.1| uracil-DNA glycosylase, family 4 [Burkholderia multivorans CGD2M]
 gi|221207882|ref|ZP_03580889.1| uracil-DNA glycosylase, family 4 [Burkholderia multivorans CGD2]
 gi|221172379|gb|EEE04819.1| uracil-DNA glycosylase, family 4 [Burkholderia multivorans CGD2]
 gi|221181102|gb|EEE13504.1| uracil-DNA glycosylase, family 4 [Burkholderia multivorans CGD2M]
          Length = 258

 Score = 62.0 bits (149), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 81/179 (45%), Gaps = 14/179 (7%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C L   +   +  T      ++++G  P D ++ +G PF G  G++LD+ L +  I R  
Sbjct: 67  CGLWEHATQPVPGTGPRHASIVLVGEQPGDQEDRTGVPFVGAAGHVLDRALDAAGIDRRS 126

Query: 150 IHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELISPKILLFIGNKT-KNFF 201
           ++++       W P G R L    +  E+  CR  + R++E + P++++ +G    +   
Sbjct: 127 VYLTNAVKHFKWEPRGKRRLHKTPAQREITACRYWLDRELESVHPRVIVALGGTALRAVL 186

Query: 202 FNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
            +NDA  T Q     +     + ++   AT HP  +++         HA  TL  AL+ 
Sbjct: 187 QDNDA--TLQRTPTPTRTAQGYLVV---ATYHPSYVLRTRGADSRE-HAYQTLVDALRT 239


>gi|332185098|ref|ZP_08386847.1| hypothetical protein SUS17_137 [Sphingomonas sp. S17]
 gi|332014822|gb|EGI56878.1| hypothetical protein SUS17_137 [Sphingomonas sp. S17]
          Length = 258

 Score = 62.0 bits (149), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 38/159 (23%), Positives = 68/159 (42%), Gaps = 16/159 (10%)

Query: 99  TICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPW 158
           ++ AT      LM++   P   D  +G+  SG  G + D+ML +I   R  +H++ +   
Sbjct: 101 SLTATGPADATLMVLVDCPDRDDGEAGQILSGAPGRLFDRMLAAIGQSRETVHLASVCAR 160

Query: 159 HPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSN 218
            P   R  +++E  +   I    + LI P+ LL +GN         +      +L     
Sbjct: 161 RPLAGRTPADLESRLAE-IARHHVGLIRPRGLLLLGNAASRAVLGTELTSARGHL----- 214

Query: 219 LCTPHSI------IPTLATVHPQELIQYPLIKKNTWHAL 251
               H++         +A+ HP+ LI+ P+ K  +W  L
Sbjct: 215 ----HAVDHKNGKSQAVASFHPRFLIEKPMAKAESWKDL 249


>gi|222102769|ref|YP_002539808.1| hypothetical protein Avi_7466 [Agrobacterium vitis S4]
 gi|221739370|gb|ACM40103.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 492

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 85/182 (46%), Gaps = 12/182 (6%)

Query: 73  KACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKT 132
           +A ++  L+   R  + C L   +  T+         +M++G  P D ++++G+PF G  
Sbjct: 297 EADTIDALRQEARRCNRCDLSCRATQTVFGEGPVDAKIMVVGEQPGDQEDLAGRPFVGPA 356

Query: 133 GNMLDKMLQSIEIMRTQIHISMIS---PWHPPGNRNL---SNI-EMEICRPIIMRQIELI 185
           G + D+ L    + R  ++++       + P G R +    NI E++ CR  + ++IE++
Sbjct: 357 GRVFDEALAQAGMDRRALYVTNAVKHFKYEPRGKRRIHQRPNIAEVQQCRWWLTQEIEMV 416

Query: 186 SPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP-LIK 244
            PK+++ +G      F   D +   +++   S             TVHP  L++ P  IK
Sbjct: 417 KPKLIVAMG--AIALFSLTDRKDRLEDVR--SRPIVMDDTRHLFVTVHPSYLLRIPDEIK 472

Query: 245 KN 246
           +N
Sbjct: 473 RN 474


>gi|298707566|emb|CBJ30150.1| conserved unknown protein [Ectocarpus siliculosus]
          Length = 342

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 58/110 (52%), Gaps = 1/110 (0%)

Query: 110 LMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEI-MRTQIHISMISPWHPPGNRNLSN 168
           LM+IG  P   ++  G PF G++G +LD ML+++      ++++S I    P  NR  + 
Sbjct: 172 LMLIGEAPGAEEDRLGVPFVGRSGQLLDDMLRAVGFDPEREVYVSNIVRRRPIDNRTPTP 231

Query: 169 IEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSN 218
            EM+   P ++ +I L+ P +++ +G  +       + +   +  G+W++
Sbjct: 232 EEMDFYLPFLLEEIGLVDPHVIVLLGASSTKALLPYETRGITRARGQWAD 281


>gi|209550293|ref|YP_002282210.1| phage SPO1 DNA polymerase-related protein [Rhizobium leguminosarum
           bv. trifolii WSM2304]
 gi|209536049|gb|ACI55984.1| phage SPO1 DNA polymerase-related protein [Rhizobium leguminosarum
           bv. trifolii WSM2304]
          Length = 484

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 50/223 (22%), Positives = 101/223 (45%), Gaps = 21/223 (9%)

Query: 31  PNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSI----AQKACSLHELKSLLRS 86
           P   A+ ESQ +  +   A Q +      H  L + A ++       A +L  L +   +
Sbjct: 244 PGLIASAESQVRAMAAREATQSLP----FHDRLQEAARNLPIEPEAPAGTLEALSAEAGA 299

Query: 87  FHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIM 146
              C L + +  T+        ++M +G  P D ++I+G+PF G  G +LD+++  + I 
Sbjct: 300 CTRCPLHAKATQTVFGEGPRDAEVMFVGEQPGDQEDIAGRPFVGPAGKLLDQVIADVGID 359

Query: 147 RTQIHISMIS---PWHPPGNRNLSNI----EMEICRPIIMRQIELISPKILLFIGNKTKN 199
           R+ ++++       + P G R +       E++ CR  +  ++ L+ PK+++ +G     
Sbjct: 360 RSALYVTNAVKHFKYEPRGKRRIHQKPNMGEVKHCRWWLDLELALVKPKLIVAMGATALA 419

Query: 200 FFFNNDAQKTYQNL-GKWSNLCTPHSIIPTLATVHPQELIQYP 241
                D ++  Q++ GK   +    ++     TVHP  L++ P
Sbjct: 420 AL--TDVKERLQDVRGKAMAIEGGRTL---FVTVHPSYLLRIP 457


>gi|114705234|ref|ZP_01438142.1| Uracil-DNA glycosylase:Phage SPO1 DNA polymerase-related protein
           [Fulvimarina pelagi HTCC2506]
 gi|114540019|gb|EAU43139.1| Uracil-DNA glycosylase:Phage SPO1 DNA polymerase-related protein
           [Fulvimarina pelagi HTCC2506]
          Length = 501

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/212 (23%), Positives = 94/212 (44%), Gaps = 19/212 (8%)

Query: 39  SQRKEK--SIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTS 96
           ++R+E    +DSA +P+  +         +A++ +    ++ + +    S   C L   +
Sbjct: 270 TERREAVMGLDSADEPMLGLDG------DEANTGSNLPKTIEDARRAAASCQACPLWEPA 323

Query: 97  LSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMIS 156
             T+     E   ++ +G  P D ++I+G+PF G  G + D+ L S  + R Q +++   
Sbjct: 324 TQTVFGKGPEDAPVIFVGEQPGDQEDIAGEPFVGPAGKVFDEALLSAGVDRKQAYVTNAV 383

Query: 157 ---PWHPPGNRNL---SNI-EMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKT 209
               + P G R +    N+ E++ CR  +  + EL+ PK+++ +G             KT
Sbjct: 384 KHFKFTPRGKRRIHAKPNMGEIKTCRWWLDLERELVKPKLIVALGATAAQAVLG----KT 439

Query: 210 YQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
                  S L      I  L TVHP  +++ P
Sbjct: 440 VTIRDSRSKLINLTDEIRFLVTVHPSYILRLP 471


>gi|166713584|ref|ZP_02244791.1| DNA polymerase related protein [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 481

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/173 (22%), Positives = 72/173 (41%), Gaps = 11/173 (6%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           SL +L+S  R    C L   +  T+     +   +M+IG  P D +++SG+PF G  G +
Sbjct: 279 SLAQLRSAARDCRRCELWQPATQTVFGEGPDDASVMVIGEQPGDEEDLSGRPFVGPAGRL 338

Query: 136 LDKMLQSIEIMRTQIHISMISP---WHPPGNRNL----SNIEMEICRPIIMRQIELISPK 188
               L  + + R + +++       +   G R L        ++ C   +  +   + P 
Sbjct: 339 FTMALGELGVDRQRFYVTNAVKHFRFEQRGKRRLHRNPERAHVQACSGWLQAERTQLRPA 398

Query: 189 ILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
            ++ +G         +   +  Q  G+W  L       P LATVHP  +++ P
Sbjct: 399 QIVCLGATAAQAVLGS-GFRLMQERGQWQRL---DDGTPILATVHPSWVLRQP 447


>gi|254526412|ref|ZP_05138464.1| uracil-DNA glycosylase [Prochlorococcus marinus str. MIT 9202]
 gi|221537836|gb|EEE40289.1| uracil-DNA glycosylase [Prochlorococcus marinus str. MIT 9202]
          Length = 167

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 67/135 (49%), Gaps = 8/135 (5%)

Query: 109 DLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEI-MRTQIHISMISPWHPPGNRNLS 167
           DL+IIG  P   +++ GKP+ GK+G +L+++L    I     ++   +    PP NR  +
Sbjct: 14  DLLIIGEAPGAQEDLEGKPYVGKSGKLLNELLIQAGIDYEKDVYFCNVIKCRPPNNRKPT 73

Query: 168 NIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNL-GKWSNLCTPHSII 226
             E+ I +P +++QI+L+ PK +L  G+         + +    NL G+W          
Sbjct: 74  VREINIHKPWLLQQIKLVDPKFILLTGSTAMRAIL--EVKDPISNLRGQWIKKDGRE--- 128

Query: 227 PTLATVHPQELIQYP 241
             +   HP  L+++P
Sbjct: 129 -IMVIFHPSYLLRFP 142


>gi|13474291|ref|NP_105859.1| hypothetical protein mll5147 [Mesorhizobium loti MAFF303099]
 gi|14025043|dbj|BAB51645.1| mll5147 [Mesorhizobium loti MAFF303099]
          Length = 223

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 62/126 (49%), Gaps = 7/126 (5%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           S+ EL+   +    C L   +  T+     +   ++ +G  P D ++++GKPF G  G +
Sbjct: 30  SISELREAAKGCRRCPLWRDATQTVFGEGPDNAKVIFVGEQPGDQEDLAGKPFVGPAGKV 89

Query: 136 LDKMLQSIEIMRTQIHISMIS---PWHPPGNRNLSNI----EMEICRPIIMRQIELISPK 188
            D +L   E+ R +++++       + P G R + +     E++ CR  + R+  LI P+
Sbjct: 90  FDAILDEAEVDRLKVYVTNAVKHFKFEPRGKRRIHSKPNAGEVQACRWWLDREFALIKPE 149

Query: 189 ILLFIG 194
           + + +G
Sbjct: 150 LAVALG 155


>gi|94271666|ref|ZP_01291994.1| DNA polymerase bacteriophage-type [delta proteobacterium MLMS-1]
 gi|93450382|gb|EAT01594.1| DNA polymerase bacteriophage-type [delta proteobacterium MLMS-1]
          Length = 125

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 65/126 (51%), Gaps = 5/126 (3%)

Query: 133 GNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLF 192
           G +LDKML +I + R+ ++++ +    PP  R  +  E   CRP ++ QI  I P +L  
Sbjct: 1   GALLDKMLAAIGLARSTVYLTTVVKCAPPDCRPPTPEESRQCRPWLLEQIAAIRPTLLCT 60

Query: 193 IGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALI 252
           +G +       + ++   Q  G++ + C   +++PTLA   P  L+  P +KK  WH L 
Sbjct: 61  MGQEAAQSLLKS-SRNLLQLRGRFHD-CQGIALMPTLA---PDFLLPNPEMKKAAWHDLQ 115

Query: 253 TLKKAL 258
            + K L
Sbjct: 116 LIAKRL 121


>gi|258542770|ref|YP_003188203.1| phage SPO1 DNA polymerase-related protein [Acetobacter pasteurianus
           IFO 3283-01]
 gi|256633848|dbj|BAH99823.1| phage SPO1 DNA polymerase-related protein [Acetobacter pasteurianus
           IFO 3283-01]
 gi|256636907|dbj|BAI02876.1| phage SPO1 DNA polymerase-related protein [Acetobacter pasteurianus
           IFO 3283-03]
 gi|256639960|dbj|BAI05922.1| phage SPO1 DNA polymerase-related protein [Acetobacter pasteurianus
           IFO 3283-07]
 gi|256643016|dbj|BAI08971.1| phage SPO1 DNA polymerase-related protein [Acetobacter pasteurianus
           IFO 3283-22]
 gi|256646071|dbj|BAI12019.1| phage SPO1 DNA polymerase-related protein [Acetobacter pasteurianus
           IFO 3283-26]
 gi|256649124|dbj|BAI15065.1| phage SPO1 DNA polymerase-related protein [Acetobacter pasteurianus
           IFO 3283-32]
 gi|256652111|dbj|BAI18045.1| phage SPO1 DNA polymerase-related protein [Acetobacter pasteurianus
           IFO 3283-01-42C]
 gi|256655168|dbj|BAI21095.1| phage SPO1 DNA polymerase-related protein [Acetobacter pasteurianus
           IFO 3283-12]
          Length = 417

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/188 (23%), Positives = 78/188 (41%), Gaps = 16/188 (8%)

Query: 63  LVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDN 122
           LV   + +AQ A SL  L +       C L   +  T+     E   LM +G  P D ++
Sbjct: 212 LVPTLEDVAQ-ASSLASLSAEAMDCRACSLWQPANRTVFGEGVENTPLMFVGEQPGDQED 270

Query: 123 ISGKPFSGKTGNMLDKMLQSIEIMRTQIHIS-----MISPWHPPGNRNL----SNIEMEI 173
           ++G+PF G  G + D+ L+   I+R  ++++         W    NR L        +E 
Sbjct: 271 LAGRPFVGPAGQVFDRALEEAGILRNHVYVTNAVKHFRFTWK--NNRRLHQKPDQESVEA 328

Query: 174 CRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVH 233
           CR  +  + +L+ PK+++ +G              + +     S +         L TVH
Sbjct: 329 CRIWLDAERKLVHPKLIVMLGVTAAQSLLKRPVTISRER----SRIFQLDEQCSGLVTVH 384

Query: 234 PQELIQYP 241
           P  L++ P
Sbjct: 385 PSYLLRLP 392


>gi|159903330|ref|YP_001550674.1| Uracil-DNA glycosylase [Prochlorococcus marinus str. MIT 9211]
 gi|159888506|gb|ABX08720.1| Uracil-DNA glycosylase [Prochlorococcus marinus str. MIT 9211]
          Length = 191

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 66/153 (43%), Gaps = 6/153 (3%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEI-MRT 148
           C+        +         LM++G  P   + + GKPF G++G +LD +L+ + I  + 
Sbjct: 16  CNCLEPCSKVVVGRGNPSAHLMLVGEAPGAKEELLGKPFVGRSGKVLDNLLEVVGIDHQK 75

Query: 149 QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQK 208
            I+I  +    PP NR  +  E+    P ++ QI+L+ P +++  G      F     + 
Sbjct: 76  DIYICNVMKSRPPNNRRPTRAEIAKHLPWLVHQIKLVKPFVIVLAGATALETFLEIKTKI 135

Query: 209 TYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
           T    G W N       I  +   HP  L++ P
Sbjct: 136 TVLR-GTWQNW----RGIAVMPIFHPSYLLRNP 163


>gi|296169122|ref|ZP_06850781.1| family 4 uracil-DNA glycosylase [Mycobacterium parascrofulaceum
           ATCC BAA-614]
 gi|295896242|gb|EFG75904.1| family 4 uracil-DNA glycosylase [Mycobacterium parascrofulaceum
           ATCC BAA-614]
          Length = 220

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/177 (22%), Positives = 75/177 (42%), Gaps = 15/177 (8%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
            L  L++       C L + +  T+      G  +M++G  P D ++ +G+PF G  G +
Sbjct: 18  GLDALRAAAECCRGCQLFADATQTVFGRGRAGAPIMLVGEQPGDREDRAGEPFVGPAGRL 77

Query: 136 LDKMLQSIEIMRTQIH----ISMISPWHPPGNRNL----SNIEMEICRPIIMRQIELISP 187
           LD+ L+   I     +    +         G R +       E+  CRP ++ +IE + P
Sbjct: 78  LDRALEEAGIDPACTYETNAVKHFKFTRKGGKRRIHQKPGRTEVVACRPWLIAEIEAVRP 137

Query: 188 KILLFIGNKTKNFF----FNNDAQKTYQ-NLGKWSNLCTPHSIIPTLATVHPQELIQ 239
           ++++ +G           F   A++  Q  L        P  ++  +ATVHP  +++
Sbjct: 138 RVIVCLGATAAQSLLGAAFRVSAERGRQLRLPAALADVEPEPVV--VATVHPSAVLR 192


>gi|170734559|ref|YP_001773673.1| phage SPO1 DNA polymerase-related protein [Burkholderia cenocepacia
           MC0-3]
 gi|169820597|gb|ACA95178.1| phage SPO1 DNA polymerase-related protein [Burkholderia cenocepacia
           MC0-3]
          Length = 223

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 54/105 (51%), Gaps = 8/105 (7%)

Query: 110 LMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMIS---PWHPPGNRNL 166
           +M++G  P D ++ +G PF G  G MLD+ L    I R Q++++       W P G R L
Sbjct: 50  IMLVGEQPGDQEDRAGLPFVGAAGRMLDRALDEAGIERAQVYLTNAVKHFKWEPRGKRRL 109

Query: 167 ----SNIEMEICRPIIMRQIELISPKILLFIGNKT-KNFFFNNDA 206
               +  E+  C   + R+++ + P++++ +G    +    +NDA
Sbjct: 110 HKTPAQREVAACHYWLERELQAVQPRLVVALGATALRAVLQDNDA 154


>gi|319943628|ref|ZP_08017909.1| arginine biosynthesis ArgJ [Lautropia mirabilis ATCC 51599]
 gi|319742861|gb|EFV95267.1| arginine biosynthesis ArgJ [Lautropia mirabilis ATCC 51599]
          Length = 409

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 77/188 (40%), Gaps = 15/188 (7%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEGQ-DLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           L+  +     C L  T  +T+       Q   M+IG  P   ++  G+ F G+ G +LD 
Sbjct: 220 LREDVDGCRRCRLAETRTNTVFGRGRPQQARWMLIGEGPGAEEDKQGEAFVGQAGKLLDA 279

Query: 139 MLQSIEI-MRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT 197
           ML +  I     + I+ +    PP NRN    E+  C   +  QI L+ P  +L +G   
Sbjct: 280 MLDAAGIDPSADVFIANVLKCRPPNNRNPEPDEVAACEGYLYEQIRLVQPDCILLLGRFA 339

Query: 198 KNFFFNNDAQKTYQNLGKWSNLCTPHSI------IPTLATVHPQELIQYPLIKKNTWHAL 251
                +++ Q     +G+  N    H I      +P + T HP  L++    K   W  L
Sbjct: 340 AQSVLHSELQ-----IGRLRNKL--HHITLDGRQVPVVVTYHPAYLLRNQRDKLKGWEDL 392

Query: 252 ITLKKALK 259
                A++
Sbjct: 393 CLALSAME 400


>gi|300787076|ref|YP_003767367.1| uracil-DNA glycosylase [Amycolatopsis mediterranei U32]
 gi|299796590|gb|ADJ46965.1| uracil-DNA glycosylase [Amycolatopsis mediterranei U32]
          Length = 210

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/178 (20%), Positives = 75/178 (42%), Gaps = 16/178 (8%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L  L+S       C L   +  T+    T    ++++G  P D ++++G+PF G  G +L
Sbjct: 15  LDRLRSAASGCQACPLYQDATQTVFGEGTARAKVLVVGEQPGDKEDLAGEPFVGPAGKLL 74

Query: 137 DKMLQSIEIMRTQIHIS-----MISPWHPPGNRNL----SNIEMEICRPIIMRQIELISP 187
           D+  +     R  ++++             G R +       E+  CRP ++ ++  + P
Sbjct: 75  DRAFEEAGFDRRSLYVTNAVKHFKFKRDERGKRRIHQKPGRTEVVACRPWLLAELRSVRP 134

Query: 188 KILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPH---SIIP-TLATVHPQELIQYP 241
           +++L +G            + T     +   L  P     ++P  +ATVHP  +++ P
Sbjct: 135 ELVLLLGATAAQSLLGPKFRLTAH---RGEPLEPPEELAGLVPAAMATVHPSAVLRAP 189


>gi|116253162|ref|YP_769000.1| helicase/glycosylase [Rhizobium leguminosarum bv. viciae 3841]
 gi|115257810|emb|CAK08908.1| putative helicase/glycosylase [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 484

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 51/222 (22%), Positives = 99/222 (44%), Gaps = 19/222 (8%)

Query: 31  PNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQK----ACSLHELKSLLRS 86
           P   A+ ES+ +  +   A Q +      H  L + A  I  +    A +L  L++    
Sbjct: 244 PGLIASAESKVRAMAAREATQSLP----FHDRLQEAARGIPAEPEAPAGTLEALRAEAAG 299

Query: 87  FHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIM 146
              C L + +  T+        ++M++G  P D ++I+G+PF G  G +LD+++    I 
Sbjct: 300 CTRCPLHAKATQTVFGEGPLDAEVMLVGEQPGDQEDIAGRPFVGPAGRLLDQVITEAGID 359

Query: 147 RTQIHISMIS---PWHPPGNRNLSNI----EMEICRPIIMRQIELISPKILLFIGNKTKN 199
           R+ ++++       + P G R +       E++ CR  +  ++ LI PK+++ +G  T  
Sbjct: 360 RSMLYVTNAVKHFKYEPRGKRRIHQKPNMGEVKHCRWWLNLEMALIKPKLVVAMGA-TAL 418

Query: 200 FFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
               +  Q+     GK   +    ++     TVHP  L++ P
Sbjct: 419 AALTDTKQRLQDVRGKAIAIDERRTL---FVTVHPSYLLRIP 457


>gi|254168174|ref|ZP_04875021.1| uracil-DNA glycosylase, family 4, putative [Aciduliprofundum boonei
           T469]
 gi|197622940|gb|EDY35508.1| uracil-DNA glycosylase, family 4, putative [Aciduliprofundum boonei
           T469]
          Length = 252

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/140 (24%), Positives = 67/140 (47%), Gaps = 3/140 (2%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           + EL   +R    C L +T  + +         LM+I   P + ++ +GK F G +G +L
Sbjct: 10  MKELNEEIRKCERCKLYATRKNAVVGEGNLDAKLMLIAQAPGEKEDETGKMFVGPSGKIL 69

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
           D++L+   + R +++++ +     P  R     E+  C   + ++IE+++P+IL+ +G  
Sbjct: 70  DELLEIAGLKREEVYMTNLIKCFLPNCRKRREGEISACSYFLDKEIEIVNPEILVPLGYF 129

Query: 197 TKNFFF---NNDAQKTYQNL 213
              + F   N D    Y  L
Sbjct: 130 ATRYIFQKYNIDTSLIYGKL 149


>gi|254167986|ref|ZP_04874834.1| uracil-DNA glycosylase, family 4, putative [Aciduliprofundum boonei
           T469]
 gi|289595947|ref|YP_003482643.1| phage SPO1 DNA polymerase-related protein [Aciduliprofundum boonei
           T469]
 gi|197623029|gb|EDY35596.1| uracil-DNA glycosylase, family 4, putative [Aciduliprofundum boonei
           T469]
 gi|289533734|gb|ADD08081.1| phage SPO1 DNA polymerase-related protein [Aciduliprofundum boonei
           T469]
          Length = 249

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 63/126 (50%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           + EL   +R    C L +T  + +         LM+I   P + ++ +GK F G +G +L
Sbjct: 7   MKELNEEIRKCERCKLYATRKNAVVGEGNLDAKLMLIAQAPGEKEDETGKMFVGPSGKIL 66

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
           D++L+   + R +++++ +     P  R     E+  C   + ++IE+++P+IL+ +G  
Sbjct: 67  DELLEIAGLKREEVYMTNLIKCFLPNYRKPKEGEISACSYFLDKEIEIVNPEILVPLGYF 126

Query: 197 TKNFFF 202
              + F
Sbjct: 127 ATRYIF 132


>gi|186476068|ref|YP_001857538.1| phage SPO1 DNA polymerase-like protein [Burkholderia phymatum
           STM815]
 gi|184192527|gb|ACC70492.1| phage SPO1 DNA polymerase-related protein [Burkholderia phymatum
           STM815]
          Length = 490

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/176 (23%), Positives = 75/176 (42%), Gaps = 15/176 (8%)

Query: 69  SIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQD---LMIIGYTPSDSDNISG 125
           S++  A S   ++  L +   C  C        A    G D   +M+IG  P D ++++G
Sbjct: 279 SVSVDAHSAQPMRQHLSTLDACRHCELWQHATQAVDGIGPDDARIMLIGEQPGDHEDLAG 338

Query: 126 KPFSGKTGNMLDKMLQSIEIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRPII 178
           KPF G  G +LD  LQ   + R  ++++       W   G R L    +  E++ C   +
Sbjct: 339 KPFVGPAGRLLDVALQRAGLSRDGLYLTNAVKHFKWTLRGKRRLHKTAAQQEIDACGYWL 398

Query: 179 MRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHP 234
            R+++ + P +++ +G    +   +        NL  W+        +  +AT HP
Sbjct: 399 ERELQRVRPAVVVTLGATALSALLHEKV-----NLSDWTGRTLNVDDMRVVATYHP 449


>gi|124025440|ref|YP_001014556.1| Uracil-DNA glycosylase [Prochlorococcus marinus str. NATL1A]
 gi|123960508|gb|ABM75291.1| Uracil-DNA glycosylase [Prochlorococcus marinus str. NATL1A]
          Length = 187

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 52/86 (60%), Gaps = 1/86 (1%)

Query: 110 LMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEI-MRTQIHISMISPWHPPGNRNLSN 168
           LMIIG  P   +   G+PF G++G +LDK+LQ+  I +   ++   +    PP NR  + 
Sbjct: 35  LMIIGEAPGAKEEEIGEPFVGRSGKLLDKLLQNAGIDINQDVYFCNVVKCRPPKNRRPTK 94

Query: 169 IEMEICRPIIMRQIELISPKILLFIG 194
           IE++   P + +QI+L++P +++ +G
Sbjct: 95  IEIQENLPWLYQQIKLVNPSVIVLVG 120


>gi|289662533|ref|ZP_06484114.1| uracil DNA glycosylase superfamily protein [Xanthomonas campestris
           pv. vasculorum NCPPB702]
          Length = 481

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/173 (21%), Positives = 73/173 (42%), Gaps = 11/173 (6%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L +L+S  R    C L   +  T+     +   +M+IG  P D +++SG+PF G  G +
Sbjct: 279 NLAQLRSAARDCRRCELWQPATQTVFGEGPDDASVMVIGEQPGDEEDLSGRPFVGPAGRL 338

Query: 136 LDKMLQSIEIMRTQIHISMISP---WHPPGNRNL----SNIEMEICRPIIMRQIELISPK 188
            +  L  + + R + +++       +   G R L        ++ C   +  +   + P 
Sbjct: 339 FNMALGELGVDRERFYVTNAVKHFRFEQRGKRRLHRNPERTHVQACSGWLQAERAQLRPA 398

Query: 189 ILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
            ++ +G         + + +  Q  G+W  L       P L TVHP  +++ P
Sbjct: 399 QIICLGATAAQAVLGS-SFRLMQERGQWQRL---EDGTPVLTTVHPSWVLRQP 447


>gi|289669765|ref|ZP_06490840.1| uracil DNA glycosylase superfamily protein [Xanthomonas campestris
           pv. musacearum NCPPB4381]
          Length = 481

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/173 (21%), Positives = 73/173 (42%), Gaps = 11/173 (6%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L +L+S  R    C L   +  T+     +   +M+IG  P D +++SG+PF G  G +
Sbjct: 279 NLAQLRSAARDCRRCELWQPATQTVFGEGPDDASVMVIGEQPGDEEDLSGRPFVGPAGRL 338

Query: 136 LDKMLQSIEIMRTQIHISMISP---WHPPGNRNL----SNIEMEICRPIIMRQIELISPK 188
            +  L  + + R + +++       +   G R L        ++ C   +  +   + P 
Sbjct: 339 FNMALGELGVDRERFYVTNAVKHFRFEQRGKRRLHRNPERTHVQACSGWLQAERAQLRPA 398

Query: 189 ILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
            ++ +G         + + +  Q  G+W  L       P L TVHP  +++ P
Sbjct: 399 QIICLGATAAQAVLGS-SFRLMQERGQWQRL---EDGTPVLTTVHPSWVLRQP 447


>gi|241205676|ref|YP_002976772.1| phage SPO1 DNA polymerase-related protein [Rhizobium leguminosarum
           bv. trifolii WSM1325]
 gi|240859566|gb|ACS57233.1| phage SPO1 DNA polymerase-related protein [Rhizobium leguminosarum
           bv. trifolii WSM1325]
          Length = 484

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 78/160 (48%), Gaps = 13/160 (8%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C L + +  T+        ++M +G  P D ++ISG+PF G  G +LD+++    I R+ 
Sbjct: 303 CPLHAKATQTVFGEGPRDAEVMFVGEQPGDQEDISGRPFVGPAGRLLDQVISEAGIDRST 362

Query: 150 IHISMIS---PWHPPGNRNLSNI----EMEICRPIIMRQIELISPKILLFIGNKTKNFFF 202
           ++++       + P G R +       E++ CR  +  ++ LI PK+++ +G    +   
Sbjct: 363 LYVTNAVKHFKYEPRGKRRIHQKPNMGEVKHCRWWLNLEMALIKPKLVVAMGATALSAL- 421

Query: 203 NNDAQKTYQNL-GKWSNLCTPHSIIPTLATVHPQELIQYP 241
             D ++  Q++ GK   +    ++     TVHP  L++ P
Sbjct: 422 -TDTKQRLQDVRGKAIAIDERRTL---FVTVHPSYLLRIP 457


>gi|220917884|ref|YP_002493188.1| phage SPO1 DNA polymerase-related protein [Anaeromyxobacter
           dehalogenans 2CP-1]
 gi|219955738|gb|ACL66122.1| phage SPO1 DNA polymerase-related protein [Anaeromyxobacter
           dehalogenans 2CP-1]
          Length = 224

 Score = 60.5 bits (145), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/172 (20%), Positives = 75/172 (43%), Gaps = 14/172 (8%)

Query: 80  LKSLLRSFHDCHLC---STSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L +L R+   C  C        T+         +M++G  P + ++ +G+PF G  G +L
Sbjct: 21  LPALRRAAAGCTACPLWERGTQTVFGAGRTRATVMLVGEQPGNDEDRAGEPFVGPAGRLL 80

Query: 137 DKMLQSIEIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELISPKI 189
           D+ L +  + R   +++       W P G R +    +  E+  C P +  +I  + P+ 
Sbjct: 81  DRALAAAGLDRRDAYVTNAVKHFKWEPRGKRRIHQKPNAAEVRACLPWLEAEIAAVRPRA 140

Query: 190 LLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
           L+ +G            + T +   +   + +P + +  +AT+HP  +++ P
Sbjct: 141 LVCLGATAAQALLGRGFRLTER---RGQPVPSPLAEV-VIATLHPSAVLRAP 188


>gi|169236672|ref|YP_001689872.1| uracil-DNA glycosylase-like protein [Halobacterium salinarum R1]
 gi|167727738|emb|CAP14526.1| uracil-DNA glycosylase homolog [Halobacterium salinarum R1]
          Length = 193

 Score = 60.5 bits (145), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 50/86 (58%)

Query: 109 DLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSN 168
           D++ IG  P  +++ +G PF G++G++LD  L +  + R  + I+      PP NR+  +
Sbjct: 33  DVLFIGEAPGATEDDTGVPFVGRSGDVLDDELAAAGLAREDVRITNCVRCRPPDNRDPHS 92

Query: 169 IEMEICRPIIMRQIELISPKILLFIG 194
            E+  CR  ++ +++ + P +++ +G
Sbjct: 93  EELANCRSHLVAEVDSVDPAVIVTLG 118


>gi|15790926|ref|NP_280750.1| DNA polymerase bacteriophage-type [Halobacterium sp. NRC-1]
 gi|10581499|gb|AAG20230.1| DNA polymerase bacteriophage-type [Halobacterium sp. NRC-1]
          Length = 203

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 50/86 (58%)

Query: 109 DLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSN 168
           D++ IG  P  +++ +G PF G++G++LD  L +  + R  + I+      PP NR+  +
Sbjct: 43  DVLFIGEAPGATEDDTGVPFVGRSGDVLDDELAAAGLAREDVRITNCVRCRPPDNRDPHS 102

Query: 169 IEMEICRPIIMRQIELISPKILLFIG 194
            E+  CR  ++ +++ + P +++ +G
Sbjct: 103 EELANCRSHLVAEVDSVDPAVIVTLG 128


>gi|221211852|ref|ZP_03584830.1| uracil-DNA glycosylase, family 4 [Burkholderia multivorans CGD1]
 gi|221167937|gb|EEE00406.1| uracil-DNA glycosylase, family 4 [Burkholderia multivorans CGD1]
          Length = 258

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 61/125 (48%), Gaps = 8/125 (6%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C L   +   +  T      ++++G  P D ++ +G PF G  G++LD+ L +  I R  
Sbjct: 67  CGLWEHATQPVPGTGPRHASIVLVGEQPGDQEDRTGVPFVGAAGHVLDRALDAAGIDRRS 126

Query: 150 IHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELISPKILLFIGNKT-KNFF 201
           ++++       W P G R L    +  E+  CR  + R++E + P++++ +G    +   
Sbjct: 127 VYLTNAVKHFKWEPRGKRRLHKTPAQREITACRYWLDRELESVHPRVIVALGGTALRAVL 186

Query: 202 FNNDA 206
            +NDA
Sbjct: 187 QDNDA 191


>gi|160902797|ref|YP_001568378.1| phage SPO1 DNA polymerase-related protein [Petrotoga mobilis SJ95]
 gi|160360441|gb|ABX32055.1| phage SPO1 DNA polymerase-related protein [Petrotoga mobilis SJ95]
          Length = 226

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 88/171 (51%), Gaps = 8/171 (4%)

Query: 88  HDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSI-EIM 146
             C L  T  +T+  +      +M +G  P   ++  G+PF G+ G +L+KML+   ++ 
Sbjct: 24  EKCPLNLTRTNTVPGSGNVDSPIMFVGEGPGADEDALGEPFVGRAGQLLEKMLKEYAKLE 83

Query: 147 RTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDA 206
           R  + I+ I    PP NR  +  E++ C+  +  QI +I PKI++ +GN T  ++F  ++
Sbjct: 84  RNDVFITNIVKCRPPQNRVPTQEEVKSCQSYLDGQIIVIKPKIIVTLGN-TPLYYFTGES 142

Query: 207 QKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNT--WHALITLK 255
           + T Q+ G++ N      I PT    HP  L++     K +  W+A + ++
Sbjct: 143 KIT-QSRGRFFNWYGDIKIFPTF---HPSYLLRNQSSTKGSPKWYAYLDMR 189


>gi|309790323|ref|ZP_07684890.1| phage SPO1 DNA polymerase-related protein [Oscillochloris
           trichoides DG6]
 gi|308227657|gb|EFO81318.1| phage SPO1 DNA polymerase-related protein [Oscillochloris
           trichoides DG6]
          Length = 210

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 61/134 (45%), Gaps = 4/134 (2%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEG---QDLMIIGYTPSDSDNISGKPFSGKT 132
           S   ++ + +    C LC  +     A   EG     +M+IG  P   ++  G+PF G +
Sbjct: 2   SAETIQLIAQEVRTCTLCGLANGRTRAVPGEGPADARIMVIGEGPGFHEDRQGRPFVGPS 61

Query: 133 GNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRP-IIMRQIELISPKILL 191
           G  LD +L    + R  + I+ +    PP NR+    E+ IC    + RQI  I P +++
Sbjct: 62  GKFLDDLLAMAGLSRETVFIANVVKCRPPQNRDPQPDEIAICTEHYLYRQIVAIDPPVIV 121

Query: 192 FIGNKTKNFFFNND 205
            +G  + + F   +
Sbjct: 122 TLGRFSMSLFMPGE 135


>gi|219849325|ref|YP_002463758.1| phage SPO1 DNA polymerase-related protein [Chloroflexus aggregans
           DSM 9485]
 gi|219543584|gb|ACL25322.1| phage SPO1 DNA polymerase-related protein [Chloroflexus aggregans
           DSM 9485]
          Length = 210

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 59/130 (45%), Gaps = 4/130 (3%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEG---QDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L ++      C  C+       A   EG     +M IG  P   ++  G+PF G +G  L
Sbjct: 7   LFTIAEEVQRCTACNLHRGRTRAVPGEGPANARVMFIGEGPGYHEDRQGRPFVGPSGQFL 66

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEIC-RPIIMRQIELISPKILLFIGN 195
           + +L    + R +++I+ +    PP NR+    E+  C R  +MRQI  I P +++ +G 
Sbjct: 67  NDLLALAGLRRDEVYIANVVKCRPPQNRDPEPDEIATCTRLFLMRQIAAIDPIVIVTLGR 126

Query: 196 KTKNFFFNND 205
            +   F   +
Sbjct: 127 FSMGLFLPGE 136


>gi|91976376|ref|YP_569035.1| phage SPO1 DNA polymerase-related protein [Rhodopseudomonas
           palustris BisB5]
 gi|91682832|gb|ABE39134.1| phage SPO1 DNA polymerase-related protein [Rhodopseudomonas
           palustris BisB5]
          Length = 480

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 41/172 (23%), Positives = 72/172 (41%), Gaps = 11/172 (6%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L  L+   R    C L   +  T+         +M++G  P D ++++G PF G  G ML
Sbjct: 285 LETLREQARDCRACDLWKDATQTVFGEGPPHASVMLVGEQPGDKEDLAGHPFVGPAGQML 344

Query: 137 DKMLQSIEIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELISPKI 189
           D+ L    I R + +++       + P G   L    +  E++ CRP   R++  + P++
Sbjct: 345 DRALAEAGIDRAETYVTNAVKHFKFVPRGKIRLHQKPAMPEIKACRPWYERELAAVRPQL 404

Query: 190 LLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
           ++ +G                +N G   +L         L TVHP  L++ P
Sbjct: 405 VVAMGATAAQSVLGR-ITPINKNRG---HLIDRDGGPQVLVTVHPSYLLRLP 452


>gi|294666301|ref|ZP_06731551.1| uracil DNA glycosylase superfamily protein [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 10535]
 gi|292603952|gb|EFF47353.1| uracil DNA glycosylase superfamily protein [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 10535]
          Length = 478

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/173 (21%), Positives = 72/173 (41%), Gaps = 11/173 (6%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           SL +L++  R    C L   +  T+     +   +M+IG  P D +++SG+PF G  G +
Sbjct: 279 SLAQLRTAARDCRRCELWQPATQTVFGEGPDDASVMVIGEQPGDEEDLSGRPFVGPAGRL 338

Query: 136 LDKMLQSIEIMRTQIHISMISP---WHPPGNRNL----SNIEMEICRPIIMRQIELISPK 188
            +  L  + + R + +++       +   G R L        ++ C   +  +   + P 
Sbjct: 339 FNMALGELGVDREKFYVTNAVKHFRFEQRGKRRLHRNPERTHVQACSGWLQAERAQLRPA 398

Query: 189 ILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
            ++ +G         +   +  Q  G+W  L       P L TVHP  +++ P
Sbjct: 399 QIVCLGATAAQAVLGSRF-RLMQQRGQWQRL---DDGTPVLTTVHPSWVLRQP 447


>gi|72381948|ref|YP_291303.1| phage SPO1 DNA polymerase-related protein [Prochlorococcus marinus
           str. NATL2A]
 gi|72001798|gb|AAZ57600.1| phage SPO1 DNA polymerase-related protein [Prochlorococcus marinus
           str. NATL2A]
          Length = 187

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 52/86 (60%), Gaps = 1/86 (1%)

Query: 110 LMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEI-MRTQIHISMISPWHPPGNRNLSN 168
           LMIIG  P   +   G+PF G++G +LDK+LQ+  I +   ++   +    PP NR  + 
Sbjct: 35  LMIIGEAPGAKEEEIGEPFVGRSGKLLDKLLQNAGIDINQDVYFCNVIKCRPPKNRRPTK 94

Query: 169 IEMEICRPIIMRQIELISPKILLFIG 194
           IE++   P + +QI+L++P +++ +G
Sbjct: 95  IEIQENLPWLYQQIKLVNPSVIVLVG 120


>gi|85373904|ref|YP_457966.1| Uracil-DNA glycosylase:Phage SPO1 DNA polymerase-related protein
           [Erythrobacter litoralis HTCC2594]
 gi|84786987|gb|ABC63169.1| Uracil-DNA glycosylase:Phage SPO1 DNA polymerase-related protein
           [Erythrobacter litoralis HTCC2594]
          Length = 476

 Score = 59.7 bits (143), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 60/125 (48%), Gaps = 10/125 (8%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEGQD---LMIIGYTPSDSDNISGKPFSGKTGNML 136
           L+++ R+ H C  C        A   EG     LMI+G  P D ++ +G+PF G  G +L
Sbjct: 283 LEAIDRAIHACRQCPIGELDNQAVMGEGPQAAALMIVGEQPGDQEDKAGRPFVGPAGQLL 342

Query: 137 DKMLQSIEIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELISPKI 189
           D+ L+   I R   +++       +   G R L    +  E++ CR  I  +  L+ PKI
Sbjct: 343 DRHLEKAGIERRGAYVTNTVKHFKFAQRGKRRLHQSPTAKEIDTCRWWIESERALVKPKI 402

Query: 190 LLFIG 194
           +L +G
Sbjct: 403 VLALG 407


>gi|123965983|ref|YP_001011064.1| Uracil-DNA glycosylase [Prochlorococcus marinus str. MIT 9515]
 gi|123200349|gb|ABM71957.1| Uracil-DNA glycosylase [Prochlorococcus marinus str. MIT 9515]
          Length = 167

 Score = 59.7 bits (143), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 53/88 (60%), Gaps = 1/88 (1%)

Query: 109 DLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEI-MRTQIHISMISPWHPPGNRNLS 167
           +L+IIG  P   +++ GKP+ GK+G +L+++L    I  +   +   +    PP NR  +
Sbjct: 14  NLLIIGEAPGAQEDLEGKPYVGKSGKLLNELLIEAGIDFQNDAYFCNVIKCRPPNNRKPT 73

Query: 168 NIEMEICRPIIMRQIELISPKILLFIGN 195
           N E+ I +P +++QI+++ PK ++  G+
Sbjct: 74  NTEINIHKPWLLQQIKIVDPKFIILTGS 101


>gi|190895487|ref|YP_001985779.1| DNA-directed DNA polymerase protein [Rhizobium etli CIAT 652]
 gi|190699432|gb|ACE93516.1| probable DNA-directed DNA polymerase protein [Rhizobium etli CIAT
           652]
          Length = 213

 Score = 59.7 bits (143), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 39/173 (22%), Positives = 79/173 (45%), Gaps = 11/173 (6%)

Query: 74  ACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTG 133
           A S+ EL+        C L   +  T+        +++I+G  P D ++I+G+PF G  G
Sbjct: 18  ADSIDELRHQAEGCTRCDLYRNATQTVFGEGPNKAEIVIVGEQPGDREDITGRPFVGPAG 77

Query: 134 NMLDKMLQSIEIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELIS 186
           ++LD  L+   + R + +++       + P G R L    +  E+  C   +  ++ ++ 
Sbjct: 78  HLLDHCLEEAGVDRQRCYVTNAVKHFKFTPRGKRRLHAKPNAGEIRRCAWWLGAELNILQ 137

Query: 187 PKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ 239
           PK+++ +G           A+ T +      ++  P +  P L T+HP  L++
Sbjct: 138 PKLIVTLGASALYALLGPKAKLTPER----GHILQPRNHPPILVTIHPSFLLR 186


>gi|107022916|ref|YP_621243.1| phage SPO1 DNA polymerase-related protein [Burkholderia cenocepacia
           AU 1054]
 gi|116686841|ref|YP_840088.1| phage SPO1 DNA polymerase-related protein [Burkholderia cenocepacia
           HI2424]
 gi|105893105|gb|ABF76270.1| phage SPO1 DNA polymerase-related protein [Burkholderia cenocepacia
           AU 1054]
 gi|116652556|gb|ABK13195.1| phage SPO1 DNA polymerase-related protein [Burkholderia cenocepacia
           HI2424]
          Length = 223

 Score = 59.7 bits (143), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 53/105 (50%), Gaps = 8/105 (7%)

Query: 110 LMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMIS---PWHPPGNRNL 166
           +M++G  P D ++ +G PF G  G MLD+ L    I R  ++++       W P G R L
Sbjct: 50  IMLVGEQPGDQEDRAGLPFVGAAGRMLDRALDEAGIERAHVYLTNAVKHFKWEPRGKRRL 109

Query: 167 ----SNIEMEICRPIIMRQIELISPKILLFIGNKT-KNFFFNNDA 206
               +  E+  C   + R+++ + P++++ +G    +    +NDA
Sbjct: 110 HKTPAQREVAACHYWLERELQAVQPRVVVALGATALRAVLQDNDA 154


>gi|312602706|ref|YP_004022551.1| uracil DNA glycosylase superfamily protein [Burkholderia
           rhizoxinica HKI 454]
 gi|312170020|emb|CBW77032.1| Uracil DNA glycosylase superfamily protein [Burkholderia
           rhizoxinica HKI 454]
          Length = 274

 Score = 59.7 bits (143), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 37/166 (22%), Positives = 70/166 (42%), Gaps = 14/166 (8%)

Query: 86  SFHDCHLCSTSLSTICATQTEG---QDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQS 142
              DC  C+           EG     +M++G  P D ++  G+PF G  G +LD  L+ 
Sbjct: 83  GLDDCRRCALWHDASQPVPGEGPAHAPIMMVGEQPGDQEDRQGRPFVGPAGVLLDDALRE 142

Query: 143 IEIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELISPKILLFIGN 195
             + R  ++++       W P G R +    +  E+E C   + R+ + ++P +++ +G 
Sbjct: 143 AGVARDDVYVTNAVKHFKWEPRGKRRMHKTPAQREIEACHYWLDREFDTVAPAVVVALGA 202

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
                   +      ++LG+       H +IPT    HP   ++ P
Sbjct: 203 TALKAVLQDRTVTLQRSLGQTIEYGG-HFVIPTY---HPSFALRAP 244


>gi|21244429|ref|NP_644011.1| DNA polymerase-like protein [Xanthomonas axonopodis pv. citri str.
           306]
 gi|21110092|gb|AAM38547.1| DNA polymerase related protein [Xanthomonas axonopodis pv. citri
           str. 306]
          Length = 478

 Score = 59.3 bits (142), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 37/173 (21%), Positives = 72/173 (41%), Gaps = 11/173 (6%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           SL +L++  R    C L   +  T+    ++   +M+IG  P D +++SG+PF G  G +
Sbjct: 279 SLAQLRTAARDCRRCELWQPATQTVFGEGSDDASVMVIGEQPGDEEDLSGRPFVGPAGRL 338

Query: 136 LDKMLQSIEIMRTQIHISMISP---WHPPGNRNL----SNIEMEICRPIIMRQIELISPK 188
            +  L  + + R   +++       +   G R L        ++ C   +  +   + P 
Sbjct: 339 FNMALGELGVDRETFYVTNAVKHFRFEQRGKRRLHRNPERTHVQACSGWLQAERAHLRPA 398

Query: 189 ILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
            ++ +G         +   +  Q  G+W  L       P L TVHP  +++ P
Sbjct: 399 QIVCLGATAAQAVLGSRF-RLMQQRGQWQRL---DDGTPVLTTVHPSWVLRQP 447


>gi|187924320|ref|YP_001895962.1| phage SPO1 DNA polymerase-related protein [Burkholderia
           phytofirmans PsJN]
 gi|187715514|gb|ACD16738.1| phage SPO1 DNA polymerase-related protein [Burkholderia
           phytofirmans PsJN]
          Length = 491

 Score = 59.3 bits (142), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 60/131 (45%), Gaps = 7/131 (5%)

Query: 71  AQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSG 130
           A  A    E  S L +   C L   +   + ++      +M+IG  P D +++SG+PF G
Sbjct: 284 ADMAQPAREQPSSLDTCRRCDLWRNATQAVGSSGPSDARIMLIGEQPGDQEDLSGQPFVG 343

Query: 131 KTGNMLDKMLQSIEIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIE 183
             G +L+  +    + R Q++++       W P G R L       E+E C   + R++ 
Sbjct: 344 PAGQLLETAITRAGLSREQVYLTNAVKHFKWEPRGKRRLHKTPGQREIEACSYWLERELH 403

Query: 184 LISPKILLFIG 194
            + P +++ +G
Sbjct: 404 TVRPVVIVTLG 414


>gi|218681720|ref|ZP_03529521.1| phage SPO1 DNA polymerase-related protein [Rhizobium etli CIAT 894]
          Length = 410

 Score = 59.3 bits (142), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 83/176 (47%), Gaps = 17/176 (9%)

Query: 31  PNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQA-----DSIAQKACSLHELKSLLR 85
           P   A+ ES+ +  +   A  P+     +H  L Q A     D+ A  A +L  L +   
Sbjct: 228 PGLIASAESKVRAMAAREATHPLA----LHDRLQQAARNHPADAEAL-AGTLEALSAEAA 282

Query: 86  SFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEI 145
               C L   +  T+        ++M +G  P D ++I+G+PF G  G +LD+++    I
Sbjct: 283 VCTRCPLHEKATQTVFGEGPRDAEVMFVGEQPGDQEDIAGRPFVGPAGRLLDQVIAEAGI 342

Query: 146 MRTQIHISMIS---PWHPPGNRNLSNI----EMEICRPIIMRQIELISPKILLFIG 194
            R++++++       + P G R +       E++ CR  +  ++EL+ PK+++ +G
Sbjct: 343 DRSRLYVTNAVKHFKYEPRGKRRIHQKPNMGEVKHCRWWLDLEMELVKPKLIVAMG 398


>gi|188993245|ref|YP_001905255.1| Uracil DNA glycosylase superfamily protein,probable [Xanthomonas
           campestris pv. campestris str. B100]
 gi|167735005|emb|CAP53217.1| Uracil DNA glycosylase superfamily protein,probable [Xanthomonas
           campestris pv. campestris]
          Length = 472

 Score = 59.3 bits (142), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 42/176 (23%), Positives = 75/176 (42%), Gaps = 11/176 (6%)

Query: 71  AQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSG 130
           A  A SL +L+   R    C L   +  T+     +   +M+IG  P D +++SG+PF G
Sbjct: 274 AVAAQSLAQLRVAARDCRRCDLWQPATQTVFGEGPDDAAVMVIGEQPGDEEDLSGRPFVG 333

Query: 131 KTGNMLDKMLQSIEIMRTQIHISMISP---WHPPGNRNL-SNIE---MEICRPIIMRQIE 183
             G + ++ L  + I R + +++       +   G R L  N E   ++ C   +  +  
Sbjct: 334 PAGRLFNQALGELGIDRQRFYVTNAVKHFRFEQRGKRRLHRNPERSHVQACNGWLQAERA 393

Query: 184 LISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ 239
            + P  ++ +G             +  Q  G+W  L       P LATVHP  +++
Sbjct: 394 QLRPAQIVCLGATAAQAVL-GPGFRLMQERGQWQRL---DDGTPVLATVHPSWVLR 445


>gi|254822543|ref|ZP_05227544.1| hypothetical protein MintA_21619 [Mycobacterium intracellulare ATCC
           13950]
          Length = 219

 Score = 59.3 bits (142), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 42/188 (22%), Positives = 79/188 (42%), Gaps = 18/188 (9%)

Query: 67  ADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGK 126
           AD    +   +  L+S   + H C L   +  T+      G  +M++G  P D ++ +G+
Sbjct: 10  ADRYLPEERDIDALRSAAETCHGCALFEDATQTVFGNGHPGAPIMLVGEQPGDQEDRAGE 69

Query: 127 PFSGKTGNMLDKMLQSIEIMRTQIH----ISMISPWHPPGNRNL----SNIEMEICRPII 178
           PF G  G +L + L+   I     +    +         G R +       E+  CRP +
Sbjct: 70  PFVGPAGRLLARALEDAGIDPVLTYQTNAVKHFKFTRKGGKRRIHQKPGRTEVVACRPWL 129

Query: 179 MRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLC-------TPHSIIPTLAT 231
           + +IE + P++++ +G            + + Q  G+   L        TP  I+  +AT
Sbjct: 130 IAEIEAVQPEVIVCLGATAAQSLLGTTFRVSEQR-GRELKLPESVDIARTPEPIV--VAT 186

Query: 232 VHPQELIQ 239
           VHP  +++
Sbjct: 187 VHPSSVLR 194


>gi|114328194|ref|YP_745351.1| uracil DNA glycosylase superfamily protein [Granulibacter
           bethesdensis CGDNIH1]
 gi|114316368|gb|ABI62428.1| uracil DNA glycosylase superfamily protein [Granulibacter
           bethesdensis CGDNIH1]
          Length = 488

 Score = 59.3 bits (142), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 34/148 (22%), Positives = 60/148 (40%), Gaps = 15/148 (10%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L E +        C LC  +  T+      G  LMI+G  P D +++ G+PF G  G +
Sbjct: 284 TLDEARQAALQCRRCSLCEAATRTVWGEGDVGASLMIVGEQPGDREDLEGRPFVGPAGQV 343

Query: 136 LDKMLQSIEIMRTQI-------HISMISPWHPPGNRNL----SNIEMEICRPIIMRQIEL 184
           L  ++  + +   ++       H   +    P G   L       E+E CR  +  ++ L
Sbjct: 344 LRDLMGKVGMAAAEVWLTNAVKHFKFL----PRGRHRLHQSPDRKEIEACRWWLDLELSL 399

Query: 185 ISPKILLFIGNKTKNFFFNNDAQKTYQN 212
           + P++ L +G         N A  T + 
Sbjct: 400 VRPRLTLALGASATFALTGNRAAMTRRR 427


>gi|58616410|ref|YP_195540.1| N-terminus of phage DNA or Uracil-DNA glycosylase polymerase
           [Azoarcus sp. EbN1]
 gi|56315872|emb|CAI10516.1| probable N-terminus of phage DNA or Uracil-DNA glycosylase
           polymerase [Aromatoleum aromaticum EbN1]
          Length = 200

 Score = 59.3 bits (142), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 61/145 (42%), Gaps = 5/145 (3%)

Query: 92  LCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIH 151
           LC++    + +T      L+ IG  P + ++  G  F+G+ G  LD++L    I R    
Sbjct: 10  LCASRSQIVMSTPAPLGGLLAIGEAPGEKEDEMGIGFTGQAGKTLDRLLAEHGIGREGYG 69

Query: 152 ISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDA----- 206
            + I    PP NR  +  E++ C P +   IE   P++LL +G           +     
Sbjct: 70  RANICRCRPPENRKPTRAEVDACMPYLAEFIEQTRPRVLLLVGGTAAAHIVGTGSLARRI 129

Query: 207 QKTYQNLGKWSNLCTPHSIIPTLAT 231
           + +    G W +    H  + +LA 
Sbjct: 130 EMSRSPGGTWVDPAMCHPALRSLAA 154


>gi|163746768|ref|ZP_02154125.1| uracil-DNA glycosylase, putative [Oceanibulbus indolifex HEL-45]
 gi|161379882|gb|EDQ04294.1| uracil-DNA glycosylase, putative [Oceanibulbus indolifex HEL-45]
          Length = 476

 Score = 59.3 bits (142), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 38/172 (22%), Positives = 74/172 (43%), Gaps = 11/172 (6%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           + EL + +R+   C L   +   +        DLM++G  P D ++++G+PF G  G M 
Sbjct: 282 MEELPAAIRACTRCPLHCHATQAVPGEGPTRADLMVVGEQPGDQEDLAGRPFVGPAGQMF 341

Query: 137 DKMLQSIEIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELISPKI 189
           D++     + R   +++       +   G R +       E++ CR  +  ++  + PK+
Sbjct: 342 DRVASEAGLDREAAYVTNAVKHFKFTARGKRRIHQRPETSEIDQCRWWVNAEVAQVQPKL 401

Query: 190 LLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
           +L +G         + A      L +   +      IP L T+HP  L++ P
Sbjct: 402 ILAMGATAAQSLTGSGA----GILKRRGTIEAGPEGIPVLITLHPSYLLRVP 449


>gi|294625714|ref|ZP_06704335.1| DNA polymerase related protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292600018|gb|EFF44134.1| DNA polymerase related protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
          Length = 478

 Score = 59.3 bits (142), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 37/173 (21%), Positives = 72/173 (41%), Gaps = 11/173 (6%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           SL +L++  R    C L   +  T+     +   +M+IG  P D +++SG+PF G  G +
Sbjct: 279 SLAQLRTAARDCRRCELWQPATQTVFGEGPDDASVMVIGEQPGDEEDLSGRPFVGPAGRL 338

Query: 136 LDKMLQSIEIMRTQIHISMISP---WHPPGNRNL----SNIEMEICRPIIMRQIELISPK 188
            +  L  + + R + +++       +   G R L        ++ C   +  +   + P 
Sbjct: 339 FNMALGELGVDREKFYVTNAVKHFRFEQRGKRRLHRNPERTHVQACSGWLQAERAQLRPA 398

Query: 189 ILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
            ++ +G         +   +  Q  G+W  L       P L TVHP  +++ P
Sbjct: 399 QVVCLGATAAQAVLGSRF-RLMQQRGQWQRL---DDGTPVLITVHPSWVLRQP 447


>gi|269839729|ref|YP_003324421.1| uracil-DNA glycosylase [Thermobaculum terrenum ATCC BAA-798]
 gi|269791459|gb|ACZ43599.1| Uracil-DNA glycosylase superfamily [Thermobaculum terrenum ATCC
           BAA-798]
          Length = 198

 Score = 59.3 bits (142), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 62/132 (46%), Gaps = 16/132 (12%)

Query: 107 GQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQS----IEIMRTQIHISMISPWHP-- 160
           G  +M+IG  P     I+G+PFSG  G +L   +      +E    +++ + ++  +P  
Sbjct: 35  GARVMVIGQAPGVRTMIAGRPFSGPGGKLLRGWIARAGIPLEEQDRRVYFTSLTRCYPGK 94

Query: 161 ----PGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNN-----DAQKTYQ 211
                G+R  S  E+E+C P + R+IELI P ++L +G+     F           + + 
Sbjct: 95  APKGKGDRKPSAREVELCSPFLQREIELIDPVLVLLVGSMAIERFLGRMPLAEAVGQLFS 154

Query: 212 NLGKWSNLCTPH 223
             G+W  L  PH
Sbjct: 155 RDGRWW-LPLPH 165


>gi|110667342|ref|YP_657153.1| uracil-DNA glycosylase-like protein [Haloquadratum walsbyi DSM
           16790]
 gi|109625089|emb|CAJ51508.1| uracil-DNA glycosylase homolog [Haloquadratum walsbyi DSM 16790]
          Length = 232

 Score = 58.9 bits (141), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 48/86 (55%)

Query: 109 DLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSN 168
           +L+ IG  P  +++  G+PF G++G++LD  L    + R  I I+      PP NRN + 
Sbjct: 59  ELVFIGEAPGANEDEYGEPFVGRSGDVLDDALNEAGVSRDSIRITNCVRCRPPENRNPTT 118

Query: 169 IEMEICRPIIMRQIELISPKILLFIG 194
            E+  CR  +  ++  ++P +++ +G
Sbjct: 119 EELSNCRRYLEHELSALNPAVIVTLG 144


>gi|284163459|ref|YP_003401738.1| phage SPO1 DNA polymerase-related protein [Haloterrigena turkmenica
           DSM 5511]
 gi|284013114|gb|ADB59065.1| phage SPO1 DNA polymerase-related protein [Haloterrigena turkmenica
           DSM 5511]
          Length = 213

 Score = 58.9 bits (141), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 51/87 (58%)

Query: 109 DLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSN 168
           D+M++G  P   +   G+PF G+ G  LD+ L+SI   R +++I+ +    PP NR+   
Sbjct: 42  DVMLVGEAPGGQEVEQGEPFVGQAGQQLDRALESIGHDRRELYITNLVKVRPPENRDPHV 101

Query: 169 IEMEICRPIIMRQIELISPKILLFIGN 195
            E+E   P++  ++E + P +++ +G+
Sbjct: 102 DEIEAWWPVLEAELERVDPVVVVPMGS 128


>gi|209967194|ref|YP_002300109.1| Uracil DNA glycosylase superfamily [Rhodospirillum centenum SW]
 gi|209960660|gb|ACJ01297.1| Uracil DNA glycosylase superfamily [Rhodospirillum centenum SW]
          Length = 230

 Score = 58.9 bits (141), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 42/157 (26%), Positives = 71/157 (45%), Gaps = 11/157 (7%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C L  T   T+     E   L+++G  P D ++  G+PF G  G ++D  L +  I RT 
Sbjct: 33  CPLHETGTRTVFGEGPERARLVLVGEQPGDREDAQGRPFVGPAGQLMDLALNAAGIDRTG 92

Query: 150 IHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFF 202
           I+++       W   G+R L      +E+  C P +  +I  I+P+ ++ +G        
Sbjct: 93  IYVTNAVKHFKWVQRGHRRLHEKPGRLEILACLPWLENEIAAIAPEGIVCLGATAAQALI 152

Query: 203 NNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ 239
               + T +   +   L TP +   T ATVHP  L++
Sbjct: 153 GRTFKVTEE---RGQFLRTPLAGWIT-ATVHPSSLLR 185


>gi|332701477|ref|ZP_08421565.1| phage SPO1 DNA polymerase-related protein [Desulfovibrio africanus
           str. Walvis Bay]
 gi|332551626|gb|EGJ48670.1| phage SPO1 DNA polymerase-related protein [Desulfovibrio africanus
           str. Walvis Bay]
          Length = 219

 Score = 58.9 bits (141), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 37/180 (20%), Positives = 76/180 (42%), Gaps = 13/180 (7%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C L   +  T+         LM++G  P D ++  G+PF G  G +LD+ L+   + R+ 
Sbjct: 42  CDLYKAATRTVFGEGPVEARLMLVGEIPGDMEDRRGRPFVGPAGRLLDRALEEAGVDRST 101

Query: 150 I-------HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFF 202
           +       H           +R  S  E+  C   + R++ L+ P+ ++ +G       F
Sbjct: 102 VYLTNSVKHFKFELTGRRRQHRAPSVSEINACHYWLDRELALVKPRTVVALGGTAARAVF 161

Query: 203 NNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP--LIKKNTWHALITLKKALKN 260
                +  Q  GK+++L         + T+HP  +++ P   ++   +   ++  + L+N
Sbjct: 162 GKPV-RVLQVRGKFADLEPGRQ---AMVTIHPSAILRMPEESMRHQAFETFVSELRLLRN 217


>gi|218673831|ref|ZP_03523500.1| probable DNA-directed DNA polymerase protein [Rhizobium etli GR56]
          Length = 213

 Score = 58.9 bits (141), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 41/183 (22%), Positives = 84/183 (45%), Gaps = 18/183 (9%)

Query: 64  VQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNI 123
           V  ADSIA+     H+ +   R    C L   +   +    ++  +++++G  P D ++I
Sbjct: 15  VADADSIAK---LRHQAEGCTR----CDLYRNATQIVFGEGSDKAEIVLVGEQPGDREDI 67

Query: 124 SGKPFSGKTGNMLDKMLQSIEIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRP 176
           +G+PF G  G +LD  L+   + R + +++       + P G R L    +  E+  C  
Sbjct: 68  AGRPFVGPAGRLLDHCLEEAGLDRGRCYVTNAVKHFKFTPRGKRRLHAKPNAGEIRRCAW 127

Query: 177 IIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQE 236
            +  ++ ++ PK+++ +G           A+ T +      ++  P +  P L T+HP  
Sbjct: 128 WLGAELNILQPKLVVALGASALYALLGPKAKLTPER----GHILQPRNHPPVLVTIHPSF 183

Query: 237 LIQ 239
           L++
Sbjct: 184 LLR 186


>gi|192290395|ref|YP_001991000.1| phage SPO1 DNA polymerase-related protein [Rhodopseudomonas
           palustris TIE-1]
 gi|192284144|gb|ACF00525.1| phage SPO1 DNA polymerase-related protein [Rhodopseudomonas
           palustris TIE-1]
          Length = 495

 Score = 58.9 bits (141), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 42/190 (22%), Positives = 77/190 (40%), Gaps = 39/190 (20%)

Query: 73  KACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKT 132
           KA +L  L+   +    C L   +  T+     +   +M++G  P D ++++GKPF G  
Sbjct: 295 KADTLAHLREEAKDCRACDLWKDATQTVFGEGPQHATVMLVGEQPGDKEDLAGKPFVGPA 354

Query: 133 GNMLDKMLQSIEIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELI 185
           G MLD+ L    + R++ +++       + P G   L    +  E++ CR    R++  +
Sbjct: 355 GQMLDRALAEAGVDRSKTYVTNAVKHFKFVPRGKIRLHQKPATPEIKACRQWYERELAAV 414

Query: 186 SPKILLFIG--------------NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLAT 231
            P +++ +G              NKT+    + D                       L T
Sbjct: 415 QPLLVVAMGATAAQSVLGRITPINKTRGRLIDRDDGPQ------------------VLVT 456

Query: 232 VHPQELIQYP 241
           VHP  L++ P
Sbjct: 457 VHPSYLLRLP 466


>gi|149184846|ref|ZP_01863164.1| Uracil-DNA glycosylase:Phage SPO1 DNA polymerase-related protein
           [Erythrobacter sp. SD-21]
 gi|148832166|gb|EDL50599.1| Uracil-DNA glycosylase:Phage SPO1 DNA polymerase-related protein
           [Erythrobacter sp. SD-21]
          Length = 478

 Score = 58.9 bits (141), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 68/144 (47%), Gaps = 14/144 (9%)

Query: 65  QQADSIAQKACSLHE----LKSLLRSFHDCHLCSTSLSTICATQTEG-QD--LMIIGYTP 117
           ++A  + + A    E    L ++ ++ H C  C        A   EG QD  LMI+G  P
Sbjct: 266 REAKMVEKGALEFEERPDTLAAIDKAIHGCRKCPIGQLDNHAVMGEGPQDAALMIVGEQP 325

Query: 118 SDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMIS---PWHPPGNRNL----SNIE 170
            D ++ +G+PF G  G +LD  L+ + I R   +++       +   G R L       E
Sbjct: 326 GDQEDQTGRPFVGPAGQLLDAHLEKVGIDRRAAYVTNAVKHFKYVQRGKRRLHQNPGAKE 385

Query: 171 MEICRPIIMRQIELISPKILLFIG 194
           ++ CR  I  + E++ PK++L +G
Sbjct: 386 IDTCRWWIESEREIVKPKLVLAMG 409


>gi|304393847|ref|ZP_07375772.1| uracil-DNA glycosylase:Phage SPO1 DNA polymerase-related protein
           [Ahrensia sp. R2A130]
 gi|303294046|gb|EFL88421.1| uracil-DNA glycosylase:Phage SPO1 DNA polymerase-related protein
           [Ahrensia sp. R2A130]
          Length = 516

 Score = 58.9 bits (141), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 62/125 (49%), Gaps = 7/125 (5%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L  L  +L++   C L   +  T+C   T+   +M++G  P D++++ G+ F G  G +L
Sbjct: 302 LGSLNDMLKNCRACPLWQPATQTVCGAGTQRASIMLVGEQPGDNEDLQGQAFIGPAGKIL 361

Query: 137 DKMLQSIEIMRTQIHISMIS---PWHPPGNR----NLSNIEMEICRPIIMRQIELISPKI 189
           +   + + I R    ++       + P G R    N S  E++ C   + R++ L+ P++
Sbjct: 362 EAAFEEVGIDRADTWLTNAVKHFKFEPRGKRRIHQNPSVGEIDHCSWWLQRELALVQPRV 421

Query: 190 LLFIG 194
           ++ +G
Sbjct: 422 VVALG 426


>gi|124023137|ref|YP_001017444.1| uracil-DNA glycosylase [Prochlorococcus marinus str. MIT 9303]
 gi|123963423|gb|ABM78179.1| Uracil-DNA glycosylase [Prochlorococcus marinus str. MIT 9303]
          Length = 183

 Score = 58.9 bits (141), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 65/133 (48%), Gaps = 6/133 (4%)

Query: 110 LMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEI-MRTQIHISMISPWHPPGNRNLSN 168
           LM+IG  P   ++  GKPF G++G +LD++++S+ +      +I  +    PP NR  + 
Sbjct: 30  LMVIGEAPGAREDELGKPFVGRSGQLLDRLMESVGLDPVVDAYICNVVKCRPPKNRRPTL 89

Query: 169 IEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPT 228
            E+   RP + +QIEL+ P ++   G+             T    G+W +    H  +  
Sbjct: 90  AEIASYRPWLEQQIELVDPYVIALAGSTAVEAILGFKGGITKLR-GQWQHW---HGRL-L 144

Query: 229 LATVHPQELIQYP 241
           +  +HP  L++ P
Sbjct: 145 MPLLHPAYLLRNP 157


>gi|325109833|ref|YP_004270901.1| phage SPO1 DNA polymerase-related protein [Planctomyces
           brasiliensis DSM 5305]
 gi|324970101|gb|ADY60879.1| phage SPO1 DNA polymerase-related protein [Planctomyces
           brasiliensis DSM 5305]
          Length = 461

 Score = 58.5 bits (140), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 35/159 (22%), Positives = 72/159 (45%), Gaps = 11/159 (6%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C L   +  T+    +E   L  +G  P D ++++G+PF G  G +L +M+Q   +  ++
Sbjct: 281 CELHGPATQTVFGMGSEHARLAFVGEQPGDEEDLAGEPFVGPAGRLLREMMQQTNVDPSE 340

Query: 150 IHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFF 202
           ++++       +   G R L     + E+  C+P +  +++ + P  LL +G  +     
Sbjct: 341 VYLTNTVKHFKYVQTGPRRLHKKPGSREITACKPWLEAELQYLKPAGLLLLGATSAQAVL 400

Query: 203 NNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
             D + + Q      +    H    T+AT HP  +++ P
Sbjct: 401 GRDFRLSDQRGKTVESRWCRH----TIATWHPAAILRAP 435


>gi|90420004|ref|ZP_01227913.1| uracil-DNA glycosylase [Aurantimonas manganoxydans SI85-9A1]
 gi|90336045|gb|EAS49793.1| uracil-DNA glycosylase [Aurantimonas manganoxydans SI85-9A1]
          Length = 487

 Score = 58.5 bits (140), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 39/164 (23%), Positives = 72/164 (43%), Gaps = 21/164 (12%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C L   +  T+     E   ++ +G  P D ++I+G+PF G  G + D  L    I R++
Sbjct: 305 CPLWEPATQTVFGRGPEDAPVIFVGEQPGDQEDIAGEPFIGPAGKVFDAALGEAGIDRSR 364

Query: 150 IHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFF 202
            +++       + P G R +    +  E+  CR  +  + ELI PK+++ +G    +   
Sbjct: 365 AYVTNAVKHFKFAPRGKRRIHAKPNGGEVRACRWWLDIERELIRPKLIVALGATAASAVL 424

Query: 203 N-----NDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
                  DA+ T  +L + +           L TVHP  +++ P
Sbjct: 425 GKTVTIRDARSTLIDLDEGTR---------ALVTVHPSYILRLP 459


>gi|260654357|ref|ZP_05859847.1| uracil-DNA glycosylase [Jonquetella anthropi E3_33 E1]
 gi|260630990|gb|EEX49184.1| uracil-DNA glycosylase [Jonquetella anthropi E3_33 E1]
          Length = 195

 Score = 58.5 bits (140), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 57/116 (49%), Gaps = 3/116 (2%)

Query: 83  LLRSFHDCHLC---STSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKM 139
           L R    C  C   + + + +  +      ++++G  P  +++ SG PF G +G +L ++
Sbjct: 2   LARELAGCSRCGLRAGAKAPVFGSGPRESRVVLVGEAPGAAEDESGIPFVGASGRLLSQL 61

Query: 140 LQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           L+   + R ++ I+      PP NR     E+  C   + RQ+E+I P  ++ +GN
Sbjct: 62  LEESGLRRDELFITNAVKCRPPDNRTPQKDELSCCLCWLRRQLEMIRPDGIITVGN 117


>gi|325915940|ref|ZP_08178236.1| uracil-DNA glycosylase, family 4 [Xanthomonas vesicatoria ATCC
           35937]
 gi|325537907|gb|EGD09607.1| uracil-DNA glycosylase, family 4 [Xanthomonas vesicatoria ATCC
           35937]
          Length = 479

 Score = 58.5 bits (140), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 37/171 (21%), Positives = 70/171 (40%), Gaps = 11/171 (6%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           SL +L++  R    C L   +  T+     +   +M+IG  P D +++SG+PF G  G +
Sbjct: 279 SLAQLRTAARDCRRCELWQPATQTVFGEGPDDASVMVIGEQPGDEEDLSGRPFVGPAGRL 338

Query: 136 LDKMLQSIEIMRTQIHISMISP---WHPPGNRNL----SNIEMEICRPIIMRQIELISPK 188
               L  + + R   +++       +   G R L        ++ C   +  +   + P 
Sbjct: 339 FTMALGELGVDRQAFYVTNAVKHFRFEQRGKRRLHRNPERAHVQACSGWLQAERAQLRPA 398

Query: 189 ILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ 239
            ++ +G         +   +  Q  G+W  L       P LATVHP  +++
Sbjct: 399 QIVCLGATAAQAVLGS-GFRLMQQRGQWQRL---DDGTPVLATVHPSWVLR 445


>gi|78049381|ref|YP_365556.1| uracil DNA glycosylase superfamily protein [Xanthomonas campestris
           pv. vesicatoria str. 85-10]
 gi|78037811|emb|CAJ25556.1| uracil DNA glycosylase superfamily protein [Xanthomonas campestris
           pv. vesicatoria str. 85-10]
          Length = 478

 Score = 58.5 bits (140), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 36/173 (20%), Positives = 73/173 (42%), Gaps = 11/173 (6%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           SL +L++  R    C L   +  T+     +   +M+IG  P D +++SG+PF G  G +
Sbjct: 279 SLAQLRTAARDCRRCELWQPATQTVFGEGPDDASVMVIGEQPGDEEDLSGRPFVGPAGRL 338

Query: 136 LDKMLQSIEIMRTQIHISMISP---WHPPGNRNL----SNIEMEICRPIIMRQIELISPK 188
            +  L  + + R + +++       +   G R L        ++ C   +  +   + P 
Sbjct: 339 FNMALGELGVDREKFYVTNAVKHFRFEQRGKRRLHRNPERTHVQACSGWLQAERAQLRPA 398

Query: 189 ILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
            ++ +G         + + +  +  G+W  L       P L TVHP  +++ P
Sbjct: 399 QIVCLGATAAQAVLGS-SFRLMRERGQWQRL---DDGTPVLTTVHPSWVLRQP 447


>gi|330821073|ref|YP_004349935.1| phage SPO1 DNA polymerase-related protein [Burkholderia gladioli
           BSR3]
 gi|327373068|gb|AEA64423.1| phage SPO1 DNA polymerase-related protein [Burkholderia gladioli
           BSR3]
          Length = 215

 Score = 58.5 bits (140), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 27/122 (22%), Positives = 58/122 (47%), Gaps = 7/122 (5%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C L + +   +         +M++G  P D D+  G PFSG  G +L++ L+   + R  
Sbjct: 31  CPLWARATQPVDGRGPATAAIMLVGEQPGDHDDRRGAPFSGTAGGILERALREASLARAT 90

Query: 150 IHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFF 202
           ++++ +     W   G R L    +  E+  CR  + R+I+ ++P++++ +G        
Sbjct: 91  VYLTHVVKHFKWEARGKRRLPVEPALEEVAACRYWLDREIDAVAPRVIVALGALAWRAVL 150

Query: 203 NN 204
           ++
Sbjct: 151 DD 152


>gi|190892718|ref|YP_001979260.1| uracil DNA glycosylase [Rhizobium etli CIAT 652]
 gi|190697997|gb|ACE92082.1| putative uracil DNA glycosylase protein [Rhizobium etli CIAT 652]
          Length = 484

 Score = 58.5 bits (140), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 49/223 (21%), Positives = 100/223 (44%), Gaps = 21/223 (9%)

Query: 31  PNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQK----ACSLHELKSLLRS 86
           P   A+ ES+ +E +   A + +      H  L Q A ++  +    A +L  L++    
Sbjct: 244 PGLIASAESKVREMAAREATRSLP----FHDRLQQAARNLPTEPEAPAGTLEALRAQASV 299

Query: 87  FHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIM 146
              C L + +  T+         +M +G  P D ++I+G+PF G  G + D+++    I 
Sbjct: 300 CTRCPLHANATQTVFGEGPRDAAVMFVGEQPGDQEDIAGRPFVGPAGRLFDQVMAEAGID 359

Query: 147 RTQIHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELISPKILLFIGNKTKN 199
           R+ ++++       + P G R +    +  E++ CR  +  ++ L+ PK+++ +G     
Sbjct: 360 RSMVYVTNSVKHFKYEPRGKRRIHQKPTMGEVKHCRWWLDLELALVEPKLIVAMGATALA 419

Query: 200 FFFNNDAQKTYQNL-GKWSNLCTPHSIIPTLATVHPQELIQYP 241
                D +   Q++ GK   +    ++     TVHP  L++ P
Sbjct: 420 AL--TDVKGRLQDVRGKAMAIEGGRTL---FVTVHPSYLLRIP 457


>gi|299134859|ref|ZP_07028051.1| phage SPO1 DNA polymerase-related protein [Afipia sp. 1NLS2]
 gi|298590669|gb|EFI50872.1| phage SPO1 DNA polymerase-related protein [Afipia sp. 1NLS2]
          Length = 217

 Score = 58.5 bits (140), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 39/173 (22%), Positives = 72/173 (41%), Gaps = 11/173 (6%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           SL +L+        CHL   +  T+         +M++G  P D ++++GKPF G  G +
Sbjct: 19  SLADLREEAAHCRACHLYKDATQTVFGEGAAHAPIMLVGEQPGDKEDLAGKPFVGPAGQV 78

Query: 136 LDKMLQSIEIMRTQI-------HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPK 188
           L + L   +I R ++       H   +       ++  +  E+  CR    R++  + P 
Sbjct: 79  LARGLDEAKIPRNKVYITNAVKHFKFVLRGKVRLHQKPNTSEIRACRQWYERELLAVKPA 138

Query: 189 ILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
           +++ +G       F        +N G + +L         L TVHP  L++ P
Sbjct: 139 LVVAMGATAAQCVFGK-ITPIGKNRGHFLDLTED---TKALVTVHPSYLLRLP 187


>gi|21233093|ref|NP_639010.1| DNA polymerase related protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66770033|ref|YP_244795.1| DNA polymerase related protein [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|21114947|gb|AAM42934.1| DNA polymerase related protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66575365|gb|AAY50775.1| DNA polymerase related protein [Xanthomonas campestris pv.
           campestris str. 8004]
          Length = 425

 Score = 58.5 bits (140), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 73/171 (42%), Gaps = 11/171 (6%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           SL +L+   R    C L   +  T+     +   +M+IG  P D +++SG+PF G  G +
Sbjct: 232 SLAQLRVAARDCRRCDLWQPATQTVFGEGPDDAAVMVIGEQPGDEEDLSGRPFVGPAGRL 291

Query: 136 LDKMLQSIEIMRTQIHISMISP---WHPPGNRNL-SNIE---MEICRPIIMRQIELISPK 188
            ++ L  + I R + +++       +   G R L  N E   ++ C   +  +   + P 
Sbjct: 292 FNQALGELGIDRQRFYVTNAVKHFRFEQRGKRRLHRNPERSHVQACNGWLQAERAQLRPA 351

Query: 189 ILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ 239
            ++ +G             +  Q  G+W  L       P LATVHP  +++
Sbjct: 352 QIVCLGATAAQAVL-GPGFRLMQERGQWQRL---DDGTPVLATVHPSWVLR 398


>gi|116255511|ref|YP_771344.1| putative uracil-DNA glycosylase [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115260159|emb|CAK03262.1| putative uracil-DNA glycosylase [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 213

 Score = 58.5 bits (140), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 40/183 (21%), Positives = 82/183 (44%), Gaps = 18/183 (9%)

Query: 64  VQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNI 123
           V  ADSIA       EL+        C L   +   +        +++++G  P D +++
Sbjct: 15  VADADSIA-------ELRHQAEGCTRCDLFRNATQVVFGEGLVKSEIVLVGEQPGDQEDL 67

Query: 124 SGKPFSGKTGNMLDKMLQSIEIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRP 176
           +G+PF G  G +LD+ L+   + R + +++       + P G R L    +  E+  C  
Sbjct: 68  TGRPFVGPAGRLLDRCLEEAGLDRQRCYVTNAVKHFKFTPRGKRRLHAKPNAGEIRRCAW 127

Query: 177 IIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQE 236
            +  ++ ++ PK+++ +G          +A+ T +      ++  P +  P L T+HP  
Sbjct: 128 WLGAELNILQPKLVVALGASALYALLGPNAKLTPER----GHILHPTNRPPVLVTIHPSY 183

Query: 237 LIQ 239
           L++
Sbjct: 184 LLR 186


>gi|317407476|gb|EFV87432.1| uracil-DNA glycosylase, family 4 [Achromobacter xylosoxidans C54]
          Length = 220

 Score = 58.5 bits (140), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/167 (22%), Positives = 68/167 (40%), Gaps = 14/167 (8%)

Query: 85  RSFHDCHLCSTSLSTICATQTEGQD---LMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQ 141
           R   DC  C    +   A   EG+    +M++G  P D ++++G PF G  G +LDK L 
Sbjct: 22  RKLADCRRCGLWRNATQAVGGEGKRRATIMLVGEQPGDKEDLAGHPFVGPAGALLDKALA 81

Query: 142 SIEIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELISPKILLFIG 194
              + R  ++I+       W   G R +    +  E+  C   + ++++ I P++++ +G
Sbjct: 82  RAGVSRDAVYITNAVKHFKWQLRGKRRMHKSPAQAEIAACGYWLEQELDDIRPRVIIALG 141

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
                    +        LG+           P L   HP   ++ P
Sbjct: 142 ATALGALVPDRKLTLKAALGQ----SLRRGNTPVLVAYHPSFALRSP 184


>gi|307721220|ref|YP_003892360.1| Uracil-DNA glycosylase superfamily [Sulfurimonas autotrophica DSM
           16294]
 gi|306979313|gb|ADN09348.1| Uracil-DNA glycosylase superfamily [Sulfurimonas autotrophica DSM
           16294]
          Length = 223

 Score = 58.5 bits (140), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 91/185 (49%), Gaps = 10/185 (5%)

Query: 80  LKSLLRSFHDCHLCSTSLS---TICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L++L ++   CHLC  S S   ++    ++   L+II Y+ S + + S   ++G++G  L
Sbjct: 45  LEALAQNIASCHLCDLSKSRTQSMSGYGSKDAKLVIIDYSVSQAQDSSNSYYAGRSGETL 104

Query: 137 DKMLQSI-EIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
             M++ +  +    I+++      P  +   S  E   C+  +  Q++ I PK+++ +G 
Sbjct: 105 KNMIEKVLHLSIDDIYLTHAVKCKPLQSNKPSPSEYNSCKNYLFSQLDFIKPKVIVTLG- 163

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
             ++ + +      ++N+         + +IP     HPQ L++ P +KK T + L T+K
Sbjct: 164 --EDAYTHITGDTNFENVRGHVIDYKEYKLIPIY---HPQYLLRNPHLKKITLNDLKTIK 218

Query: 256 KALKN 260
             L++
Sbjct: 219 SCLQD 223


>gi|307725694|ref|YP_003908907.1| Uracil-DNA glycosylase superfamily [Burkholderia sp. CCGE1003]
 gi|307586219|gb|ADN59616.1| Uracil-DNA glycosylase superfamily [Burkholderia sp. CCGE1003]
          Length = 221

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/189 (19%), Positives = 80/189 (42%), Gaps = 13/189 (6%)

Query: 82  SLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQ 141
           + L +   C L   +   +     +   +M++G  P D ++++G PF G  G +LD  L 
Sbjct: 31  ATLDACRRCALWVNATQGVPGAGPKRAPIMMVGEQPGDKEDLAGLPFVGPAGALLDDALA 90

Query: 142 SIEIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELISPKILLFIG 194
              + R +++++       W P G R +    +  E++ CR  + R++E +   +++ +G
Sbjct: 91  EAGVARKEVYVTNAVKHFKWTPRGKRRMHKTPAQREVDACRYWLERELENVGAHVIVALG 150

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQY--PLIKKNTWHALI 252
                    +   +   ++G        H     +AT HP   ++   P  ++  + A++
Sbjct: 151 ATALKAVLEDPKSRLQDSIG----TVIEHGDRLVVATYHPSFALRAPDPETRQRAYAAIV 206

Query: 253 TLKKALKNL 261
              +  K L
Sbjct: 207 AALQDAKKL 215


>gi|316935046|ref|YP_004110028.1| phage SPO1 DNA polymerase-like protein [Rhodopseudomonas palustris
           DX-1]
 gi|315602760|gb|ADU45295.1| phage SPO1 DNA polymerase-related protein [Rhodopseudomonas
           palustris DX-1]
          Length = 517

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/176 (23%), Positives = 77/176 (43%), Gaps = 11/176 (6%)

Query: 73  KACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKT 132
           KA +L  L+   +    C L   +  T+     +   +M++G  P D ++++GKPF G  
Sbjct: 317 KADTLAHLREEAKDCRACDLWKDATQTVFGEGPQHATVMLVGEQPGDKEDLAGKPFVGPA 376

Query: 133 GNMLDKMLQSIEIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELI 185
           G MLD+ L    + R++ +++       + P G   L    +  E++ CR    R++  +
Sbjct: 377 GQMLDRALAEAGVDRSKTYVTNAVKHFKFVPRGKIRLHQKPNTPEIKACRQWYERELAAV 436

Query: 186 SPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
            P +++ +G            + T  N  +  +L         L TVHP  L++ P
Sbjct: 437 QPLLVVAMGATAAQSVLG---KVTPINANR-GHLIDRDDGPQVLVTVHPSYLLRLP 488


>gi|325926412|ref|ZP_08187737.1| uracil-DNA glycosylase, family 4 [Xanthomonas perforans 91-118]
 gi|325543201|gb|EGD14639.1| uracil-DNA glycosylase, family 4 [Xanthomonas perforans 91-118]
          Length = 478

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/173 (20%), Positives = 73/173 (42%), Gaps = 11/173 (6%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           SL +L++  R    C L   +  T+     +   +M+IG  P D +++SG+PF G  G +
Sbjct: 279 SLAQLRTAARDCRRCELWQPATQTVFGEGPDDASVMVIGEQPGDEEDLSGRPFVGPAGRL 338

Query: 136 LDKMLQSIEIMRTQIHISMISP---WHPPGNRNL----SNIEMEICRPIIMRQIELISPK 188
            +  L  + + R + +++       +   G R L        ++ C   +  +   + P 
Sbjct: 339 FNMALGELGVDREKFYVTNAVKHFRFEQRGKRRLHRNPERTHVQACSGWLQAERAQLRPA 398

Query: 189 ILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
            ++ +G         + + +  +  G+W  L       P L TVHP  +++ P
Sbjct: 399 QIVCLGATAAQAILGS-SFRLMRERGQWHRL---DDGTPVLTTVHPSWVLRQP 447


>gi|290559866|gb|EFD93189.1| uracil DNA glycosylase superfamily protein [Candidatus Parvarchaeum
           acidophilus ARMAN-5]
          Length = 97

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 46/93 (49%), Gaps = 3/93 (3%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQD---LMIIGYTPSDSDNISGKPFSGKTG 133
           + EL+++      C LC        A   EG D   ++++G  P  ++++ G+PF G +G
Sbjct: 1   MEELEAIANEIKRCTLCDLCNKRNNAVPGEGYDKARIVLLGEAPGKNEDLQGRPFIGMSG 60

Query: 134 NMLDKMLQSIEIMRTQIHISMISPWHPPGNRNL 166
             L K L+ + I R  + I+      PP NRNL
Sbjct: 61  RFLTKYLEKVGIKREAVFITNAVKCRPPNNRNL 93


>gi|56552010|ref|YP_162849.1| phage SPO1 DNA polymerase-related protein [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|241761912|ref|ZP_04759997.1| phage SPO1 DNA polymerase-related protein [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|56543584|gb|AAV89738.1| phage SPO1 DNA polymerase-related protein [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|241373592|gb|EER63164.1| phage SPO1 DNA polymerase-related protein [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
          Length = 206

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/181 (21%), Positives = 79/181 (43%), Gaps = 12/181 (6%)

Query: 67  ADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGK 126
           +++  +KA S  +L   L     C L   +   +C   +    ++ +G  P D ++++G+
Sbjct: 2   SEAAVKKAPSWEDLTEALHHCTRCALYQKATQVVCGEGSHTSPVIFVGEQPGDQEDLAGR 61

Query: 127 PFSGKTGNMLDKMLQSIEIMRTQIHIS----MISPWHPPGNRNLSNI----EMEICRPII 178
           PF G  G + D+++ SI   R +I+++        W   G R +       E++ CR  +
Sbjct: 62  PFVGPAGQVFDEVMASIGWPREEIYLTNAVKHFKFWL-KGERRIHQTPAPEEVDCCRYWL 120

Query: 179 MRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELI 238
            ++  L+ P++ + +G  T         Q      GK   L    +  P + T HP  ++
Sbjct: 121 RQEWRLLKPRLTIALGG-TAVLALTGKKQTLGSLRGK--ILTLGKAAAPFIVTYHPSYIL 177

Query: 239 Q 239
           +
Sbjct: 178 R 178


>gi|241666692|ref|YP_002984776.1| phage SPO1 DNA polymerase-related protein [Rhizobium leguminosarum
           bv. trifolii WSM1325]
 gi|240862149|gb|ACS59814.1| phage SPO1 DNA polymerase-related protein [Rhizobium leguminosarum
           bv. trifolii WSM1325]
          Length = 213

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/183 (22%), Positives = 84/183 (45%), Gaps = 18/183 (9%)

Query: 64  VQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNI 123
           V  ADSIA+     H+ +   R    C L   +   +    +   ++++IG  P D +++
Sbjct: 15  VANADSIAE---LWHQAEDCTR----CDLYRNATQIVFGEGSGKAEIVLIGEQPGDQEDL 67

Query: 124 SGKPFSGKTGNMLDKMLQSIEIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRP 176
           +G+PF G  G +LD+ L+   + R + +++       + P G R L    +  E+  C  
Sbjct: 68  TGRPFVGPAGRLLDRCLEEAGLDRQRCYVTNAVKHFKFTPRGKRRLHAKPNAGEIRRCAW 127

Query: 177 IIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQE 236
            +  ++ ++ PK+++ +G           A+ T +      ++  P +  P L T+HP  
Sbjct: 128 WLGAELNILQPKLVVTLGASALYALLGPKAKLTPER----GHILHPTNHPPVLVTIHPSY 183

Query: 237 LIQ 239
           L++
Sbjct: 184 LLR 186


>gi|307293602|ref|ZP_07573446.1| phage SPO1 DNA polymerase-related protein [Sphingobium
           chlorophenolicum L-1]
 gi|306879753|gb|EFN10970.1| phage SPO1 DNA polymerase-related protein [Sphingobium
           chlorophenolicum L-1]
          Length = 465

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 53/112 (47%), Gaps = 7/112 (6%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C L   +  T+         LM IG  P D ++++G+PF G  G + D+ L+   I R Q
Sbjct: 284 CPLYRDTTQTVFGEGPVDAPLMFIGEQPGDQEDLAGRPFVGPAGQLFDRALEEAGIDRRQ 343

Query: 150 IHISMISPWHPPGNRNLSNI-------EMEICRPIIMRQIELISPKILLFIG 194
            +++          R    I       E++ CR  + +++ELI P+I++ +G
Sbjct: 344 AYVTNAVKHFKHERRGKRRIHQTPETPEIQACRWWLTQELELIRPRIIVALG 395


>gi|39934868|ref|NP_947144.1| Uracil-DNA glycosylase:Phage SPO1 DNA polymerase-like protein
           [Rhodopseudomonas palustris CGA009]
 gi|39648718|emb|CAE27240.1| Uracil-DNA glycosylase:Phage SPO1 DNA polymerase-related protein
           [Rhodopseudomonas palustris CGA009]
          Length = 495

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/190 (21%), Positives = 77/190 (40%), Gaps = 39/190 (20%)

Query: 73  KACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKT 132
           KA +L  L+   +    C L   +  T+     +   +M++G  P D ++++G+PF G  
Sbjct: 295 KADTLAHLREEAKDCRACDLWKDATQTVFGEGPQHATVMLVGEQPGDKEDLAGQPFVGPA 354

Query: 133 GNMLDKMLQSIEIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELI 185
           G MLD+ L    + R++ +++       + P G   L    +  E++ CR    R++  +
Sbjct: 355 GQMLDRALAEAGVDRSKTYVTNAVKHFKFVPRGKIRLHQKPATPEIKACRQWYERELAAV 414

Query: 186 SPKILLFIG--------------NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLAT 231
            P +++ +G              NKT+    + D                       L T
Sbjct: 415 QPLLVVAMGATAAQSVLGRITPINKTRGHLIDRDDGPQ------------------VLVT 456

Query: 232 VHPQELIQYP 241
           VHP  L++ P
Sbjct: 457 VHPSYLLRLP 466


>gi|54024698|ref|YP_118940.1| hypothetical protein nfa27290 [Nocardia farcinica IFM 10152]
 gi|54016206|dbj|BAD57576.1| hypothetical protein [Nocardia farcinica IFM 10152]
          Length = 211

 Score = 57.8 bits (138), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/173 (21%), Positives = 74/173 (42%), Gaps = 15/173 (8%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEG---QDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L +L  +   C  C        A   EG     + ++G  P D ++++G PF G  G +
Sbjct: 18  DLDTLRTAVQGCRGCELYRGATQAVFGEGPAHAPVFVVGEQPGDREDVAGHPFVGPAGRL 77

Query: 136 LDKMLQSIEIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELISPK 188
           LDK L   +I R  ++++       +   G R +       E+  C P +  +++ + P+
Sbjct: 78  LDKALTEADIDREAVYLTNAVKHFKFEERGKRRIHKQPGRTEVVACSPWLTAELDAVRPQ 137

Query: 189 ILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
           +++ +G           + K  +  G+       H +I   ATVHP  +++ P
Sbjct: 138 LVVCLGAVAAKAVLGP-SFKVSERRGEVVE-AGEHRVI---ATVHPSSVLRAP 185


>gi|83954916|ref|ZP_00963594.1| putative uracil-DNA glycosylase [Sulfitobacter sp. NAS-14.1]
 gi|83840642|gb|EAP79814.1| putative uracil-DNA glycosylase [Sulfitobacter sp. NAS-14.1]
          Length = 473

 Score = 57.8 bits (138), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/171 (25%), Positives = 75/171 (43%), Gaps = 16/171 (9%)

Query: 82  SLLRSFHDCHLCSTSLSTICATQTEG---QDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           +L +    C  C    +   A   EG    +LMI+G  P D +++SG+PF G  G + D+
Sbjct: 284 ALAKDIAACARCPLHCNATQAVPGEGPMDAELMIVGEQPGDQEDLSGRPFIGPAGQLFDQ 343

Query: 139 MLQSIEIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELISPKILL 191
           +     + R +  ++       + P G R L    +  E++ CR  +  +I  + PK++L
Sbjct: 344 IAGRAGLARDKAFVTNAVKHFKFTPRGKRRLHQRPNASEVQHCRWWLDAEIAQVKPKLIL 403

Query: 192 FIG-NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
            +G    +      DA    +   + S   T     P L T+HP  L++ P
Sbjct: 404 GMGATAAEGLTGRRDAITARRGTVEQSPSGT-----PVLLTLHPSYLLRLP 449


>gi|322435429|ref|YP_004217641.1| phage SPO1 DNA polymerase-related protein [Acidobacterium sp.
           MP5ACTX9]
 gi|321163156|gb|ADW68861.1| phage SPO1 DNA polymerase-related protein [Acidobacterium sp.
           MP5ACTX9]
          Length = 521

 Score = 57.8 bits (138), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/172 (20%), Positives = 72/172 (41%), Gaps = 14/172 (8%)

Query: 78  HELKSLLRSFHDCHLCSTSLSTICATQTEG---QDLMIIGYTPSDSDNISGKPFSGKTGN 134
           H ++++  +   C  C             G     LM++G  P D +++ G+PF G  G 
Sbjct: 326 HTIRAIAEALPTCKGCELYCHATQVVPGRGPATAALMLVGEQPGDQEDLQGEPFIGPAGA 385

Query: 135 MLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNI-------EMEICRPIIMRQIELISP 187
           +LD +L+ + I R +++++          R    +       E+  CRP ++ +I+ I P
Sbjct: 386 VLDHILEDLRIPRKEVYVTNAVKHFKFVQRGKLRLHQSPRMSEIMACRPWLLAEIDAIKP 445

Query: 188 KILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ 239
           K++L +G              T+  +     L +        AT+HP  +++
Sbjct: 446 KVVLCLGASASKSLLGG----TFALMKDHGKLNSTPFADKVFATIHPSAVLR 493


>gi|254776520|ref|ZP_05218036.1| hypothetical protein MaviaA2_17874 [Mycobacterium avium subsp.
           avium ATCC 25291]
          Length = 221

 Score = 57.8 bits (138), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/188 (22%), Positives = 76/188 (40%), Gaps = 16/188 (8%)

Query: 67  ADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGK 126
           AD    +   +  LK    +   C L + +  T+      G  +M++G  P D ++ +G 
Sbjct: 10  ADRYLPEQRDIEALKHAAETCRGCSLFADATQTVFGNGHPGAPIMLVGEQPGDQEDRAGA 69

Query: 127 PFSGKTGNMLDKMLQSIEIMRTQIH----ISMISPWHPPGNRNL----SNIEMEICRPII 178
           PF G  G +L + LQ   I     +    +         G R +       E+  CRP +
Sbjct: 70  PFVGPAGRLLARALQDAGIDPGLTYQTNAVKHFKFTRKDGKRRIHQKPGRTEIVACRPWL 129

Query: 179 MRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPT-------LAT 231
           + +IE + P+I++ +G            + + Q  G+   L     +IP        +AT
Sbjct: 130 ITEIEAVHPRIIVCLGATAAQSLLGTSFRVSTQR-GQPLKLPASPEVIPDVSPEPVLVAT 188

Query: 232 VHPQELIQ 239
           VHP  +++
Sbjct: 189 VHPSSVLR 196


>gi|260463163|ref|ZP_05811365.1| phage SPO1 DNA polymerase-related protein [Mesorhizobium
           opportunistum WSM2075]
 gi|259031013|gb|EEW32287.1| phage SPO1 DNA polymerase-related protein [Mesorhizobium
           opportunistum WSM2075]
          Length = 226

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/128 (22%), Positives = 62/128 (48%), Gaps = 7/128 (5%)

Query: 74  ACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTG 133
           A S+ EL+        C L   +  T+     +   ++ +G  P D ++++GKPF G  G
Sbjct: 31  ANSIPELRDAAEGCRRCPLWRNATQTVFGEGPDNAKVIFVGEQPGDQEDLAGKPFVGPAG 90

Query: 134 NMLDKMLQSIEIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELIS 186
            + D +L   ++ R +++++       + P G R +    +  E++ CR  + ++ +LI 
Sbjct: 91  RVFDAILVDADVDRQKVYVTNAVKHFKFEPRGKRRIHSKPNAGEVQACRWWLDQEFDLIK 150

Query: 187 PKILLFIG 194
           P + + +G
Sbjct: 151 PNLAVALG 158


>gi|325919263|ref|ZP_08181307.1| uracil-DNA glycosylase, family 4 [Xanthomonas gardneri ATCC 19865]
 gi|325550268|gb|EGD21078.1| uracil-DNA glycosylase, family 4 [Xanthomonas gardneri ATCC 19865]
          Length = 479

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/173 (21%), Positives = 70/173 (40%), Gaps = 11/173 (6%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           SL +L+   R    C L   +  T+         +M+IG  P D +++SG+PF G  G +
Sbjct: 279 SLAQLRVAARDCRRCALWQPATQTVFGEGPNDASVMVIGEQPGDEEDLSGRPFVGPAGRL 338

Query: 136 LDKMLQSIEIMRTQIHISMISP---WHPPGNRNL----SNIEMEICRPIIMRQIELISPK 188
            +  L  I I R  ++++       +   G R L        ++ C   +  +   + P 
Sbjct: 339 FNMALGEIGIDRATVYVTNAVKHFRFEQRGKRRLHRNPERAHVQACSGWLHAERAQLRPA 398

Query: 189 ILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
            ++ +G         +   +  +  G+W  L       P L TVHP  +++ P
Sbjct: 399 QIVCLGATAAQAVLGS-GFRLMRERGQWQRL---DDGTPVLTTVHPSWVLRQP 447


>gi|58038622|ref|YP_190586.1| DNA polymerase related protein [Gluconobacter oxydans 621H]
 gi|58001036|gb|AAW59930.1| DNA polymerase related protein [Gluconobacter oxydans 621H]
          Length = 421

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 71/173 (41%), Gaps = 11/173 (6%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           SL  L+        C LC+ +  T+         ++ +G  P D +++ G+PF G  G +
Sbjct: 228 SLASLRGKAIDCRMCDLCAPATRTVSGEGNPEARIIFVGEQPGDQEDLQGRPFVGPAGQL 287

Query: 136 LDKMLQSIEIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELISPK 188
            D+ L+     R Q  I+       + P GNR +       E+  C P +  + ++++PK
Sbjct: 288 FDRALKEAGGNRAQAWITNAVKHFKFVPRGNRRIHQKPDAAEITACSPWLATERKVLAPK 347

Query: 189 ILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
           + + +G    +       Q T              SI   L TVHP  L++ P
Sbjct: 348 VTVMLGVTGASAVLGR--QVTVSRERSRPIPLADGSI--GLVTVHPSYLLRLP 396


>gi|58039251|ref|YP_191215.1| DNA polymerase related protein [Gluconobacter oxydans 621H]
 gi|58001665|gb|AAW60559.1| DNA polymerase related protein [Gluconobacter oxydans 621H]
          Length = 499

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/185 (21%), Positives = 81/185 (43%), Gaps = 18/185 (9%)

Query: 67  ADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGK 126
           A+ +   A +L +L + +R+   C L  ++   +         +M++G  P D ++++G+
Sbjct: 291 AEPMPDVAENLEDLAAQVRTCTACPLHCSATQAVVGEGPADARIMVVGEQPGDQEDLAGR 350

Query: 127 PFSGKTGNMLDKMLQSIEIMRTQIHISMISP---WHPPGNR----NLSNIEMEICRPIIM 179
           PF G  G +L + L    + R  ++++       +   G R    N     +  CRP + 
Sbjct: 351 PFVGPAGQLLHEALGEAGVDRGALYLTNAVKHFRFRLQGRRRIHQNPDAGHVAACRPWLE 410

Query: 180 RQIELISPKILLFIGNKTKNFFFN-----NDAQKTYQNLGKWSNLCTPHSIIPTLATVHP 234
           ++I LI PK+++ +G              +D + T   +G+  N       +  LA  HP
Sbjct: 411 QEIALIRPKLIVSLGATALRALDGPGMAMSDVRGTSWTVGRGEN------AVRRLALAHP 464

Query: 235 QELIQ 239
             L++
Sbjct: 465 SWLLR 469


>gi|114766766|ref|ZP_01445703.1| putative uracil-DNA glycosylase [Pelagibaca bermudensis HTCC2601]
 gi|114541023|gb|EAU44080.1| putative uracil-DNA glycosylase [Roseovarius sp. HTCC2601]
          Length = 316

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/218 (20%), Positives = 91/218 (41%), Gaps = 17/218 (7%)

Query: 34  EATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLC 93
           E   E+Q + +++  A   +  IR   +  + +     +    + + ++LL     C  C
Sbjct: 77  ELIAEAQSRAQAMADAAPSLPPIR---AERITERLRAPEAPAPVGDREALLTGLAGCRRC 133

Query: 94  STSLSTICATQTEG---QDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQI 150
               +       EG     LMI+G  P D ++++G+PF G  G + D + +   + R + 
Sbjct: 134 PLWQNATQPVAGEGPLDAALMIVGEQPGDQEDLAGRPFVGPAGQLFDAVAERAGLARDRA 193

Query: 151 HISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFN 203
           +++       + P G R L    ++ E+  CR  +  + +L+ PK+++ +G         
Sbjct: 194 YVTNAVKHFKFAPRGKRRLHQSPNSGEIAHCRWWLDMERQLVRPKLIVAMGASAAE-SLT 252

Query: 204 NDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
            D ++     G    L       P + T HP  L++ P
Sbjct: 253 GDGRRIGTRRG---TLEQAPDGTPVMVTWHPSYLLRLP 287


>gi|110635173|ref|YP_675381.1| phage SPO1 DNA polymerase-related protein [Mesorhizobium sp. BNC1]
 gi|110286157|gb|ABG64216.1| phage SPO1 DNA polymerase-related protein [Chelativorans sp. BNC1]
          Length = 206

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/179 (21%), Positives = 72/179 (40%), Gaps = 14/179 (7%)

Query: 73  KACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQD---LMIIGYTPSDSDNISGKPFS 129
           K   L  L ++     DC  C    +       EG +   ++ +G  P D +++ G+PF 
Sbjct: 7   KHVKLKTLDAVREDAQDCTRCDLYKNATQTVFGEGGNQARVVFVGEQPGDKEDVEGRPFV 66

Query: 130 GKTGNMLDKMLQSIEIMRTQIHISMIS---PWHPPGNRNLSNI----EMEICRPIIMRQI 182
           G  G M D +L+ + I R + +++       +   G R + +     E+  CR  + +++
Sbjct: 67  GPAGRMFDAILEEVGIDRKKTYVTNAVKHFKFELRGKRRIHSKPNAGEIRACRWWLDQEL 126

Query: 183 ELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
            LI P + + +G             K    +     +      +P   TVHP  L++ P
Sbjct: 127 TLIQPDVAVALGATAARALVG----KAVPVMTLRGTITESAEGVPVFITVHPSSLLRVP 181


>gi|239834563|ref|ZP_04682891.1| uracil-DNA glycosylase, family 4 [Ochrobactrum intermedium LMG
           3301]
 gi|239822626|gb|EEQ94195.1| uracil-DNA glycosylase, family 4 [Ochrobactrum intermedium LMG
           3301]
          Length = 209

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/180 (21%), Positives = 76/180 (42%), Gaps = 12/180 (6%)

Query: 67  ADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGK 126
           A +I+ +  +L ++ +  ++   C L   +  T+      G  +  +   P D ++I G+
Sbjct: 5   APAISHRQPTLEQVCAEAQTCRRCELYKDATQTVFGEGPVGAGIFFVAEQPGDKEDIEGR 64

Query: 127 PFSGKTGNMLDKMLQSIEIMRTQIHIS-MISPWH--PPGNRNL----SNIEMEICRPIIM 179
           P  G  G + D  L  + I R + +I+  +  +     G R L    S   +E CR  + 
Sbjct: 65  PLIGPAGQVFDACLAEVGIKRERCYITNAVKHFRHIQRGKRRLHQRPSTSHIEACRWWLE 124

Query: 180 RQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ 239
           ++IE +SP I++ +G       F+   +     +      C  H       T+HP  L++
Sbjct: 125 QEIEQVSPHIIVALGAVAARAVFDKPVK-----IAAVRGRCLQHENRHVFVTIHPSYLLR 179


>gi|78777161|ref|YP_393476.1| uracil-DNA glycosylase superfamily protein [Sulfurimonas
           denitrificans DSM 1251]
 gi|78497701|gb|ABB44241.1| Uracil-DNA glycosylase superfamily [Sulfurimonas denitrificans DSM
           1251]
          Length = 219

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/188 (21%), Positives = 88/188 (46%), Gaps = 6/188 (3%)

Query: 73  KACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKT 132
           K  +++EL   + + + C L  +   ++        D+MII Y+ S  ++ +   + G++
Sbjct: 37  KPLTINELSKEVSTCYLCDLSKSRTQSMSGYGNSNADVMIIDYSVSLGEDNTNSYYCGRS 96

Query: 133 GNMLDKMLQSI-EIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILL 191
           G++L  M++++ E+    ++ +      P  ++  S  E + C+  +  QIE + PK+++
Sbjct: 97  GDILKNMIENVLELKIEDVYFTHAIKCKPLNSKTPSESEWDSCKNYLFSQIEFVKPKVVV 156

Query: 192 FIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
            +G     +         +QN+         + ++P     HP  L++ P  KK  ++ L
Sbjct: 157 TLGKDA--YAKVTSENDNFQNVRGHVIDFKSYKLVPIY---HPNYLLRNPDDKKIAFNDL 211

Query: 252 ITLKKALK 259
            T+K  LK
Sbjct: 212 KTIKSLLK 219


>gi|115523840|ref|YP_780751.1| phage SPO1 DNA polymerase-related protein [Rhodopseudomonas
           palustris BisA53]
 gi|115517787|gb|ABJ05771.1| phage SPO1 DNA polymerase-related protein [Rhodopseudomonas
           palustris BisA53]
          Length = 480

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 73/173 (42%), Gaps = 11/173 (6%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           SL  L++       C L   +  T+         +M++G  P D ++++G PF G  G M
Sbjct: 283 SLTTLRAEAAECRACPLWKDATQTVFGEGPSHASVMLVGEQPGDKEDLAGHPFVGPAGQM 342

Query: 136 LDKMLQSIEIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELISPK 188
           LD+ L    I R +++++       + P G   L    +  E++ CR    R++ L+ P 
Sbjct: 343 LDRALAEAGIDRGKVYVTNAVKHFKFVPRGKIRLHQKPTTPEIKTCRQWYERELALVRPT 402

Query: 189 ILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
           +++ +G            + T  N  +   L         L TVHP  L++ P
Sbjct: 403 LVVALGATAAQSVLG---RITPINKSR-GRLIEKEGEAQVLVTVHPSYLLRLP 451


>gi|76817668|ref|YP_336521.1| putative DNA glycosylase [Burkholderia pseudomallei 1710b]
 gi|254264522|ref|ZP_04955387.1| uracil-DNA glycosylase, family 4 [Burkholderia pseudomallei 1710a]
 gi|76582141|gb|ABA51615.1| putative DNA glycosylase [Burkholderia pseudomallei 1710b]
 gi|254215524|gb|EET04909.1| uracil-DNA glycosylase, family 4 [Burkholderia pseudomallei 1710a]
          Length = 218

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/178 (18%), Positives = 78/178 (43%), Gaps = 13/178 (7%)

Query: 84  LRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSI 143
           L +   C L   +   +         +M++G  P + ++  G PF G  G +L++ L + 
Sbjct: 26  LDACRRCGLWEHATQAVPGAGPPRAAIMLVGEQPGNQEDREGAPFVGPAGRVLERALAAA 85

Query: 144 EIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELISPKILLFIGNK 196
            + R  ++++       W P G R +    +  E++ CR  + R+++ + P++++ +G  
Sbjct: 86  GLDRASVYVTNAVKHFKWAPRGKRRMHKTPAQQEIDACRYWLERELDALGPRVVVALGAI 145

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQY--PLIKKNTWHALI 252
                 ++   +    +G    +  P      +AT HP  +++   P  +K  + A++
Sbjct: 146 ALKAVLDDRHARLQPAMG----VVQPAGGRYVIATYHPSFVLRVPDPDARKRAYAAIV 199


>gi|83943534|ref|ZP_00955993.1| putative uracil-DNA glycosylase [Sulfitobacter sp. EE-36]
 gi|83845766|gb|EAP83644.1| putative uracil-DNA glycosylase [Sulfitobacter sp. EE-36]
          Length = 473

 Score = 57.0 bits (136), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 74/170 (43%), Gaps = 14/170 (8%)

Query: 82  SLLRSFHDCHLCSTSLSTICATQTEG---QDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           +L +    C  C    +   A   EG    DLMI+G  P D +++SG+PF G  G + D 
Sbjct: 284 ALAKDIAACTRCPLHCNATQAVPGEGPMDADLMIVGEQPGDQEDLSGRPFVGPAGQLFDH 343

Query: 139 MLQSIEIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELISPKILL 191
           +     + R +  ++       + P G R +    +  E++ CR  +  +I  + PK++L
Sbjct: 344 IAGRAGLQRDKAFVTNAVKHFKFTPRGKRRMHQRPNASEIQHCRWWLDAEIAQVKPKLIL 403

Query: 192 FIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
            +G              T +   + +   TP S  P L T+HP  L++ P
Sbjct: 404 GMGATAAEGLTGRRDTITAR---RGTVEQTP-SGTPVLLTLHPSYLLRLP 449


>gi|254486783|ref|ZP_05099988.1| putative DNA polymerase related protein [Roseobacter sp. GAI101]
 gi|214043652|gb|EEB84290.1| putative DNA polymerase related protein [Roseobacter sp. GAI101]
          Length = 473

 Score = 57.0 bits (136), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/160 (23%), Positives = 72/160 (45%), Gaps = 13/160 (8%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C L  T+   +        DLMI+G  P D +++SG+PF G  G + D++     + R++
Sbjct: 295 CPLHCTATQAVVGEGPMDADLMIVGEQPGDQEDLSGRPFVGPAGQLFDQIAVQAGLDRSR 354

Query: 150 IHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELISPKILLFIG-NKTKNFF 201
            +++       + P G + +    +  E++ CR  +  ++  + PK++L +G    +   
Sbjct: 355 AYVTNAVKHFKFTPRGKKRIHQRPNTSEIDHCRWWLDAEVAQVKPKLILGMGATAAEGLT 414

Query: 202 FNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
              DA      L +   +       P L T+HP  L++ P
Sbjct: 415 GRRDA-----ILARRGKVEEAPDGTPVLLTLHPSYLLRLP 449


>gi|86157607|ref|YP_464392.1| phage SPO1 DNA polymerase-like protein [Anaeromyxobacter
           dehalogenans 2CP-C]
 gi|85774118|gb|ABC80955.1| phage SPO1 DNA polymerase-related protein [Anaeromyxobacter
           dehalogenans 2CP-C]
          Length = 224

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/169 (20%), Positives = 73/169 (43%), Gaps = 14/169 (8%)

Query: 80  LKSLLRSFHDCHLC---STSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L +L R+   C  C        T+         +M++G  P + ++ +G+PF G  G +L
Sbjct: 21  LPALRRAAAGCTACPLWERGTQTVFGAGAPRATVMLVGEQPGNDEDRAGEPFVGPAGRLL 80

Query: 137 DKMLQSIEIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELISPKI 189
           D+ L +  + R   +++       W P G R +    S  E+  C P +  ++  + P+ 
Sbjct: 81  DRALAAAGLDRRDAYVTNAVKHFKWEPRGKRRIHQKPSAGEVRACLPWLEAELAAVRPRA 140

Query: 190 LLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELI 238
           ++ +G            + T +   +   + +P + I  +AT+HP  ++
Sbjct: 141 VVCLGATAAQALLGRGFRLTER---RGQPVPSPLAEI-VVATLHPSAVL 185


>gi|115360375|ref|YP_777512.1| phage SPO1 DNA polymerase-related protein [Burkholderia ambifaria
           AMMD]
 gi|115285703|gb|ABI91178.1| phage SPO1 DNA polymerase-related protein [Burkholderia ambifaria
           AMMD]
          Length = 217

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 38/179 (21%), Positives = 79/179 (44%), Gaps = 17/179 (9%)

Query: 71  AQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSG 130
           A+ A    +  + L +   C L   +   +         +M++G  P D ++ +G PF G
Sbjct: 7   AKPAAPHDQAPATLDACRRCGLWEHATQPVPGAGPTDARIMLVGEQPGDQEDRTGIPFVG 66

Query: 131 KTGNMLDKMLQSIEIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIE 183
             G MLD+ L    I R  ++++       W P G R +    +  E+  C   + R++ 
Sbjct: 67  AAGRMLDRALDEAGIERASVYVTNAVKHFKWEPRGKRRMHKTPAQREVAACHYWLERELA 126

Query: 184 LISPKILLFIGNKT-KNFFFNNDA--QKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ 239
            + P++++ +G    +    +N+A  ++T Q + +  + C        +AT HP  +++
Sbjct: 127 ALGPRVIVALGATALRAVLQDNNATLERTRQPV-RSPDGCL------VVATYHPSYVLR 178


>gi|85716683|ref|ZP_01047652.1| phage SPO1 DNA polymerase-related protein [Nitrobacter sp. Nb-311A]
 gi|85696523|gb|EAQ34412.1| phage SPO1 DNA polymerase-related protein [Nitrobacter sp. Nb-311A]
          Length = 236

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 76/173 (43%), Gaps = 11/173 (6%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           SL  L++       C L   +   +         +M++G  P D ++++GKPF G  G M
Sbjct: 39  SLAGLRAQAAGCRACPLWKDATQIVFGEGPAHAQIMLMGEQPGDREDLAGKPFVGPAGQM 98

Query: 136 LDKMLQSIEIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELISPK 188
           LD+ L+   I R +++++       + P G   L    +  E+  CR    R++  I+P 
Sbjct: 99  LDRALKEAGIDRKKVYVTNAVKHFKFVPRGKIRLHQKPNTPEIRACRQWYERELATINPA 158

Query: 189 ILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
           +++ +G+      F    + T  N  +  +L         L TVHP  L++ P
Sbjct: 159 LVVAMGSTAAQSVFG---KITPINKSR-GHLIDMKDGRKALVTVHPSYLLRLP 207


>gi|323527938|ref|YP_004230090.1| phage SPO1 DNA polymerase-like protein [Burkholderia sp. CCGE1001]
 gi|323384940|gb|ADX57030.1| phage SPO1 DNA polymerase-related protein [Burkholderia sp.
           CCGE1001]
          Length = 228

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/166 (19%), Positives = 69/166 (41%), Gaps = 14/166 (8%)

Query: 86  SFHDCHLC---STSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQS 142
           +  DC  C   + +   +         +M++G  P D +++ G PF G  G +LD  L  
Sbjct: 40  TLDDCRRCPLWANATQGVPGAGPRRAPIMMVGEQPGDKEDLQGLPFVGPAGALLDDALVE 99

Query: 143 IEIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELISPKILLFIGN 195
             + R  ++++       W P G R +    +  E++ CR  + +++E +  ++++ +G 
Sbjct: 100 AGVGRKDVYVTNAVKHFKWTPRGKRRMHKTPAQREVDACRYWLDQELESVGAQVIVALGA 159

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
                   +   +    +GK       H     +AT HP   ++ P
Sbjct: 160 TALKAVLEDPKSRLQDAIGK----VIEHGDRLVVATYHPSFALRAP 201


>gi|326333079|ref|ZP_08199329.1| uracil-DNA glycosylase, family 4 [Nocardioidaceae bacterium
           Broad-1]
 gi|325949131|gb|EGD41221.1| uracil-DNA glycosylase, family 4 [Nocardioidaceae bacterium
           Broad-1]
          Length = 210

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 42/197 (21%), Positives = 83/197 (42%), Gaps = 11/197 (5%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L EL+S ++    C L   +   +         LM++G  P D ++  G+PF G  G +
Sbjct: 12  TLAELRSAVQDCRGCELYRDATQGVMGEGPTPAPLMLLGEQPGDREDREGEPFVGPAGGI 71

Query: 136 LDKMLQSIEIMRTQIHISMISP---WHPPGNRNL----SNIEMEICRPIIMRQIELISPK 188
           L + L    I     + + +         G R +    ++ ++  C P +  +++L+ P 
Sbjct: 72  LHEALADAGIDPEATYTTNVVKHFRHRLSGKRRIHQSPTSKQVGACAPWLAAELDLVRPT 131

Query: 189 ILLFIGNKTKNFFFNND--AQKTYQNLGKWSNLCTPHSIIP-TLATVHPQELIQYPLIKK 245
            ++ +G       F +     +   +L  W    T  ++ P  LAT HP  +++    ++
Sbjct: 132 GVVLLGGTAGKALFGSSFRVGEARGHLLDWPEAITTATLDPWVLATTHPSAVLRAEDERQ 191

Query: 246 NTWHALIT-LKKALKNL 261
            T+  L+  LK A   L
Sbjct: 192 ATYDGLVADLKVAAAAL 208


>gi|169245921|gb|ACA50942.1| glycosylase [Mycobacterium marinum DL240490]
          Length = 209

 Score = 56.6 bits (135), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 41/73 (56%)

Query: 127 PFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELIS 186
           PF+G +G  LD       I + Q+ I+ +   HPP NR   + E+E C P + R++E++ 
Sbjct: 63  PFTGGSGRFLDAAFNLAGIAKKQVFITNVVHCHPPDNRPSHSHEIENCSPYLHRELEIVD 122

Query: 187 PKILLFIGNKTKN 199
           P++++ +G   K 
Sbjct: 123 PRLIIGLGRDAKG 135


>gi|158421875|ref|YP_001523167.1| phage SPO1 DNA polymerase-related protein [Azorhizobium caulinodans
           ORS 571]
 gi|158328764|dbj|BAF86249.1| phage SPO1 DNA polymerase-related protein [Azorhizobium caulinodans
           ORS 571]
          Length = 197

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 35/159 (22%), Positives = 68/159 (42%), Gaps = 11/159 (6%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C L   +  T+         LM++G  P D ++  G PF G  G +LD+ L++  I R  
Sbjct: 20  CPLYRDATQTVFGEGAADAPLMLVGEQPGDQEDRKGHPFVGPAGGVLDRALEAAGIARGA 79

Query: 150 IHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFF 202
           ++++       +   G R L    +  E+  CR  + R++ L+ P +++ +G    +   
Sbjct: 80  VYVTNAVKHFKFERRGKRRLHKGPNAGEIAACRWWLDRELALVRPSLVVALGASAAHALL 139

Query: 203 NNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
              A    +  G+   +      +  L T HP  +++ P
Sbjct: 140 GR-AVTISRTRGR---VMEASGDVRLLVTTHPSAILRVP 174


>gi|307328601|ref|ZP_07607774.1| phage SPO1 DNA polymerase-related protein [Streptomyces
           violaceusniger Tu 4113]
 gi|306885713|gb|EFN16726.1| phage SPO1 DNA polymerase-related protein [Streptomyces
           violaceusniger Tu 4113]
          Length = 219

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 41/182 (22%), Positives = 70/182 (38%), Gaps = 21/182 (11%)

Query: 74  ACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTG 133
              L  L+        C L   +  T+          M++G  P D ++  GKPF G  G
Sbjct: 20  GADLGALREAAAGCRGCPLHRDATQTVFGAGDPDARAMLVGEQPGDQEDRQGKPFVGPAG 79

Query: 134 NMLDKMLQSIEIMRTQIHIS--------MISPWHPPGNRNL----SNIEMEICRPIIMRQ 181
            +LD+ L    I   + +I+           P    G R +    S  E+  C P +  +
Sbjct: 80  KVLDRALDEAGIDPDETYITNAVKHFKFTYVPER--GKRRIHKPPSLRELAACGPWLAAE 137

Query: 182 IELISPKILLFIGNKTKNFFFNNDAQKTYQNL----GKWSNLCTPHSIIPTLATVHPQEL 237
           +ELI P++++ +G         +  + T Q      G  S       I+P   T+HP  +
Sbjct: 138 VELIGPEVIVALGATAGKALLGSSFRVTQQRGTRLEGDASGPARGALIVP---TIHPSAV 194

Query: 238 IQ 239
           ++
Sbjct: 195 LR 196


>gi|269837406|ref|YP_003319634.1| phage SPO1 DNA polymerase-like protein [Sphaerobacter thermophilus
           DSM 20745]
 gi|269786669|gb|ACZ38812.1| phage SPO1 DNA polymerase-related protein [Sphaerobacter
           thermophilus DSM 20745]
          Length = 209

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 66/139 (47%), Gaps = 12/139 (8%)

Query: 109 DLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPP------- 161
           DL++IG  P   +   G PF G  G +L + L    I R  + I+ +    P        
Sbjct: 46  DLVLIGEAPGGCEERLGHPFVGPAGQVLTEALAQAGIDREDLWITNVVKCRPTMEGVGGR 105

Query: 162 -GNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLC 220
             NR  +  E+E  RP ++R++++I P+ ++ +G    +   +  A +  +  G W +  
Sbjct: 106 LRNRTPTPAEVEWFRPWLLRELDVIDPRAIVCLGATAGSAVLHR-ALRITRERGIWFD-- 162

Query: 221 TPHSIIPTLATVHPQELIQ 239
            P+  +PTL T HP  L++
Sbjct: 163 GPNG-LPTLVTYHPAYLLR 180


>gi|260752452|ref|YP_003225345.1| phage SPO1 DNA polymerase-related protein [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
 gi|258551815|gb|ACV74761.1| phage SPO1 DNA polymerase-related protein [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
          Length = 206

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 38/181 (20%), Positives = 79/181 (43%), Gaps = 12/181 (6%)

Query: 67  ADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGK 126
           +++  +KA S  +L   L     C L   +   +C   +    ++ +G  P D ++++G+
Sbjct: 2   SEAAVKKAPSWEDLTEALHHCTRCALYQKATQVVCGEGSHTSPVIFVGEQPGDQEDLAGR 61

Query: 127 PFSGKTGNMLDKMLQSIEIMRTQIHIS----MISPWHPPGNRNLSNI----EMEICRPII 178
           PF G  G + D+++ SI   + +I+++        W   G R +       E++ CR  +
Sbjct: 62  PFVGPAGQVFDEVMASIGWPKEEIYLTNAVKHFKFWL-KGERRIHQTPAPEEVDCCRYWL 120

Query: 179 MRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELI 238
            ++  L+ P++ + +G  T         Q      GK   L    +  P + T HP  ++
Sbjct: 121 RQEWRLLKPRLTIALGG-TAVLALTGKKQTLGSLRGK--ILTLGKAAAPFIVTYHPSYIL 177

Query: 239 Q 239
           +
Sbjct: 178 R 178


>gi|167851239|ref|ZP_02476747.1| uracil-DNA glycosylase, family 4 [Burkholderia pseudomallei B7210]
          Length = 177

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 33/178 (18%), Positives = 78/178 (43%), Gaps = 13/178 (7%)

Query: 84  LRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSI 143
           L +   C L   +   +         +M++G  P + ++  G PF G  G +L++ L + 
Sbjct: 3   LDACRRCGLWEHATQAVPGAGPPRAAIMLVGEQPGNQEDREGAPFVGPAGRVLERALAAA 62

Query: 144 EIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELISPKILLFIGNK 196
            + R  ++++       W P G R +    +  E++ CR  + R+++ + P++++ +G  
Sbjct: 63  GLDRASVYVTNAVKHFKWAPRGKRRMHKTPAQQEIDACRYWLERELDALGPRVVVALGAI 122

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQY--PLIKKNTWHALI 252
                 ++   +    +G   +    + I    AT HP  +++   P  +K  + A++
Sbjct: 123 ALKAVLDDRHARLQSAMGVVQSAGGRYVI----ATYHPSFVLRVPDPDARKRAYAAIV 176


>gi|170690548|ref|ZP_02881715.1| phage SPO1 DNA polymerase-related protein [Burkholderia graminis
           C4D1M]
 gi|170144983|gb|EDT13144.1| phage SPO1 DNA polymerase-related protein [Burkholderia graminis
           C4D1M]
          Length = 224

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 33/166 (19%), Positives = 69/166 (41%), Gaps = 14/166 (8%)

Query: 86  SFHDCHLC---STSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQS 142
           +  DC  C   + +   +         +M++G  P D +++ G PF G  G +LD  L  
Sbjct: 36  TLDDCRRCPLWANATQGVPGAGPRRAPIMMVGEQPGDKEDLQGLPFVGPAGALLDDALVE 95

Query: 143 IEIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELISPKILLFIGN 195
             + R +++++       W P G R +       E++ CR  + +++E +   +++ +G 
Sbjct: 96  AGVGRKEVYVTNAVKHFKWTPRGKRRMHKTPGQREVDACRYWLDQELESVGAHVIVALGA 155

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
                   +   +   ++GK       H     +AT HP   ++ P
Sbjct: 156 TALKAVLEDPKSRLQDSIGK----VIEHGDRLVVATYHPSFALRAP 197


>gi|327192707|gb|EGE59644.1| putative uracil DNA glycosylase protein [Rhizobium etli CNPAF512]
          Length = 484

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 49/223 (21%), Positives = 100/223 (44%), Gaps = 21/223 (9%)

Query: 31  PNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQK----ACSLHELKSLLRS 86
           P   A+ ES+ +E +   A Q +      H  L Q + +  ++    A +L  L++    
Sbjct: 244 PGLIASAESKVREMAAREATQSLP----FHDRLQQASHNRTREPEAPAGTLEALRAEAAV 299

Query: 87  FHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIM 146
              C L + +  T+         +M +G  P D ++I+G+PF G  G + D+++    I 
Sbjct: 300 CTRCPLHAKATQTVFGEGPRDAAVMFVGEQPGDQEDIAGRPFVGPAGKLFDQVIAEAGID 359

Query: 147 RTQIHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELISPKILLFIGNKTKN 199
           R+ ++++       + P G R +    +  E++ CR  +  ++ L+ PK+++ +G     
Sbjct: 360 RSTLYVTNSVKHFKYEPRGKRRIHQKPTMGEVKHCRWWLDLELTLVEPKLIVAMGATALA 419

Query: 200 FFFNNDAQKTYQNL-GKWSNLCTPHSIIPTLATVHPQELIQYP 241
                D +   Q++ GK   +    ++     TVHP  L++ P
Sbjct: 420 AL--TDMKDRLQDVRGKAMAIEGGRTL---FVTVHPSYLLRIP 457


>gi|258405319|ref|YP_003198061.1| phage SPO1 DNA polymerase-like protein [Desulfohalobium retbaense
           DSM 5692]
 gi|257797546|gb|ACV68483.1| phage SPO1 DNA polymerase-related protein [Desulfohalobium
           retbaense DSM 5692]
          Length = 258

 Score = 56.2 bits (134), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 27/118 (22%), Positives = 55/118 (46%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L  L+  + +   C L  T  + +         LMI+   P D ++  G+ F G +G + 
Sbjct: 5   LERLRDQITACRRCDLAETRTNALPGAGNIHARLMIVAQAPGDQEDREGRHFIGPSGRVF 64

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           D++L    + R ++ ++ +     P NR     E+  C P + ++I+++   IL+ +G
Sbjct: 65  DRLLDQAGVARAELFLTNLLKCRLPKNRRPKQREIIACLPFLEQEIDIVEADILVPLG 122


>gi|156743997|ref|YP_001434126.1| phage SPO1 DNA polymerase-like protein [Roseiflexus castenholzii
           DSM 13941]
 gi|156235325|gb|ABU60108.1| phage SPO1 DNA polymerase-related protein [Roseiflexus castenholzii
           DSM 13941]
          Length = 212

 Score = 56.2 bits (134), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 36/165 (21%), Positives = 72/165 (43%), Gaps = 6/165 (3%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L ++   +R+   C L  +++  +         +M IG  P   ++  G+PF G  G  L
Sbjct: 7   LQQIADEVRACTACRLHQSAMRAVPGEGPADAKVMFIGEAPGFHEDRQGRPFVGAAGQFL 66

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
           +++L    + R+++ I+ +    PP NR+    E+  C   + RQI  ++P +++ +G  
Sbjct: 67  EELLGLAGLRRSEVFIANVIKHRPPDNRDPLPDEIAACSQFLERQIAALNPLVIVTLGRF 126

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
           +   +F  +         +W        IIP +   HP   +  P
Sbjct: 127 SMARWFPGEKISRIHGQPRW---IEGRMIIPMM---HPAAALHQP 165


>gi|254255279|ref|ZP_04948595.1| Uracil-DNA glycosylase [Burkholderia dolosa AUO158]
 gi|124901016|gb|EAY71766.1| Uracil-DNA glycosylase [Burkholderia dolosa AUO158]
          Length = 220

 Score = 55.8 bits (133), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 44/217 (20%), Positives = 84/217 (38%), Gaps = 21/217 (9%)

Query: 54  TNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMII 113
           T+     SP V   D   Q A         L +   C L + +   +         +M++
Sbjct: 11  TSAAERESPRVPDVDPDQQPAT--------LDACRRCPLWANATQGVPGVGPRHAPIMMV 62

Query: 114 GYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMIS---PWHPPGNRNL---- 166
           G  P D +++ G PF G  G +LD  L    I R  ++++       W P G R L    
Sbjct: 63  GEQPGDKEDLQGLPFVGPAGALLDDALAEAGIGRGDVYVTNAVKHFKWTPRGKRRLHKTP 122

Query: 167 SNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSII 226
           +  E++ CR  + ++++ +   +++ +G         +   +    +GK       H   
Sbjct: 123 AQREVDACRYWLDKELDGVGAHVVVALGATALKAVLEDPKSRLQDAIGK----VVRHGDR 178

Query: 227 PTLATVHPQELIQYP--LIKKNTWHALITLKKALKNL 261
             +AT HP   ++ P    +   + A++   +  K L
Sbjct: 179 FVVATYHPSFALRAPDADTRDRAYAAIVAALRDAKKL 215


>gi|255261284|ref|ZP_05340626.1| uracil-DNA glycosylase superfamily protein [Thalassiobium sp.
           R2A62]
 gi|255103619|gb|EET46293.1| uracil-DNA glycosylase superfamily protein [Thalassiobium sp.
           R2A62]
          Length = 475

 Score = 55.8 bits (133), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 34/168 (20%), Positives = 77/168 (45%), Gaps = 13/168 (7%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKM 139
           L + +R+   C L   +   +     +   LMI+G  P D +++ G+PF G  G + D++
Sbjct: 279 LPAAIRNCARCELACHATQAVLGEGPKTAPLMIVGEQPGDKEDLQGRPFVGPAGQLFDEI 338

Query: 140 LQSIEIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELISPKILLF 192
            + + + R+Q +++       +   G R +    +  E++ CR  +  ++  ++P++++ 
Sbjct: 339 AEEVGLDRSQAYVTNAVKHFKFKAQGRRRIHQRPNRSEIDQCRWWLDAEVRRVAPRLIVA 398

Query: 193 IG-NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ 239
           +G    +    N DA      L +   +       P L T+HP  +++
Sbjct: 399 MGATAAEALTGNGDA-----ILKRRGTVQIADGHPPVLITLHPSYILR 441


>gi|167924391|ref|ZP_02511482.1| uracil-DNA glycosylase, family 4 [Burkholderia pseudomallei BCC215]
          Length = 218

 Score = 55.8 bits (133), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 33/178 (18%), Positives = 78/178 (43%), Gaps = 13/178 (7%)

Query: 84  LRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSI 143
           L +   C L   +   +         +M++G  P + ++  G PF G  G +L++ L + 
Sbjct: 26  LDACRRCGLWEHATQAVPGAGPPRAAIMLVGEQPGNQEDREGAPFVGPAGRVLERALAAA 85

Query: 144 EIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELISPKILLFIGNK 196
            + R  ++++       W P G R +    +  E++ CR  + R+++ + P++++ +G  
Sbjct: 86  GLDRASVYVTNAVKHFKWAPRGKRRMHKTPAQQEIDACRYWLERELDALGPRVVVALGAI 145

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQY--PLIKKNTWHALI 252
                 ++   +    +G   +    + I    AT HP  +++   P  +K  + A++
Sbjct: 146 ALKAVLDDRHARLQSAMGVVQSAGGRYVI----ATYHPSFVLRVPDPDARKRAYAAIV 199


>gi|331696452|ref|YP_004332691.1| phage SPO1 DNA polymerase-like protein [Pseudonocardia
           dioxanivorans CB1190]
 gi|326951141|gb|AEA24838.1| phage SPO1 DNA polymerase-related protein [Pseudonocardia
           dioxanivorans CB1190]
          Length = 194

 Score = 55.8 bits (133), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 33/173 (19%), Positives = 73/173 (42%), Gaps = 16/173 (9%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
            L  L+  +    DC L + +   +         LM++G  P D ++  G PF G  G +
Sbjct: 4   DLDALRDAVTRCTDCELHADATHAVFGAGPASAWLMLVGEQPGDREDREGAPFVGPAGRL 63

Query: 136 LDKMLQSIEIMRTQIHISMISP---WHPPGNRNLSNI----EMEICRPIIMRQIELISPK 188
           LD  L+   + R +++++ +     +   G R L        +  CR     ++ ++ P+
Sbjct: 64  LDTALERAGVDRDEVYVTNVVKHFRFEREGKRRLHKTPAVRHVRACRHWFDDELAVVGPR 123

Query: 189 ILLFIGNKTKNFFFNNDAQKTYQN--LGKWSNLCTPHSIIPTLATVHPQELIQ 239
           +++ +G          D + + +   + +W       S++P   T+HP  +++
Sbjct: 124 VVVTLGATAAKALVGPDVRISEERGEVREWQG----RSLVP---TIHPSAILR 169


>gi|332187341|ref|ZP_08389079.1| uracil-DNA glycosylase, 4 family protein [Sphingomonas sp. S17]
 gi|332012502|gb|EGI54569.1| uracil-DNA glycosylase, 4 family protein [Sphingomonas sp. S17]
          Length = 465

 Score = 55.8 bits (133), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 38/159 (23%), Positives = 67/159 (42%), Gaps = 11/159 (6%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C L + +  T+         LM +G  P D ++++G+PF G  G + D+ +    I R  
Sbjct: 287 CPLHAPATQTVFGEGPVDASLMFVGEQPGDQEDLAGRPFVGPAGQVFDRAVAEAGIDRAT 346

Query: 150 IHISMIS---PWHPPGNRNLSNI----EMEICRPIIMRQIELISPKILLFIGNKTKNFFF 202
            +++       + P G R + +     E++ CR  + ++  LI PK+ + +G       F
Sbjct: 347 AYVTNAVKHFKFEPRGKRRIHSSPNAGEIQACRWWVEQERLLIQPKVTVALGATAARSLF 406

Query: 203 NNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
                   +  GK   L  P        TVHP  L++ P
Sbjct: 407 GK-VMTIGRERGK--ALTLPDGGT-AFITVHPSYLLRLP 441


>gi|197104365|ref|YP_002129742.1| phage SPO1 DNA polymerase-related protein [Phenylobacterium
           zucineum HLK1]
 gi|196477785|gb|ACG77313.1| phage SPO1 DNA polymerase-related protein [Phenylobacterium
           zucineum HLK1]
          Length = 477

 Score = 55.8 bits (133), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 30/131 (22%), Positives = 57/131 (43%), Gaps = 7/131 (5%)

Query: 71  AQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSG 130
            Q   +L E+ + ++    C L   +   +         LM +G  P D ++++G+PF G
Sbjct: 280 GQPPATLEEVAAGVQVCRRCDLYRDATQGVPGEGPRQARLMFVGEQPGDQEDLAGRPFVG 339

Query: 131 KTGNMLDKMLQSIEIMRTQIHISMIS---PWHPPGNRNLSNI----EMEICRPIIMRQIE 183
             G +LDK L    I R +  ++         P G R L       E+  CR  +  +  
Sbjct: 340 PAGGVLDKALAEAGIPRAETFVTNAVKHFKHEPRGKRRLHKTPDAGEVSACRWWLDAERR 399

Query: 184 LISPKILLFIG 194
           ++ P++++ +G
Sbjct: 400 IVQPRVVVALG 410


>gi|167821429|ref|ZP_02453109.1| uracil-DNA glycosylase, family 4 [Burkholderia pseudomallei 91]
          Length = 206

 Score = 55.8 bits (133), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 33/178 (18%), Positives = 78/178 (43%), Gaps = 13/178 (7%)

Query: 84  LRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSI 143
           L +   C L   +   +         +M++G  P + ++  G PF G  G +L++ L + 
Sbjct: 14  LDACRRCGLWEHATQAVPGAGPPRAAIMLVGEQPGNQEDREGAPFVGPAGRVLERALAAA 73

Query: 144 EIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELISPKILLFIGNK 196
            + R  ++++       W P G R +    +  E++ CR  + R+++ + P++++ +G  
Sbjct: 74  GLDRASVYVTNAVKHFKWAPRGKRRMHKTPAQQEIDACRYWLERELDALGPRVVVALGAI 133

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQY--PLIKKNTWHALI 252
                 ++   +    +G   +    + I    AT HP  +++   P  +K  + A++
Sbjct: 134 ALKAVLDDRHARLQSAMGVVQSAGGRYVI----ATYHPSFVLRVPDPDARKRAYAAIV 187


>gi|33240466|ref|NP_875408.1| Uracil-DNA glycosylase [Prochlorococcus marinus subsp. marinus str.
           CCMP1375]
 gi|33237994|gb|AAQ00061.1| Uracil-DNA glycosylase [Prochlorococcus marinus subsp. marinus str.
           CCMP1375]
          Length = 202

 Score = 55.8 bits (133), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 77/171 (45%), Gaps = 21/171 (12%)

Query: 82  SLLRSFHD--CHLCSTSLSTICATQTEGQ---DLMIIGYTPSDSDNISGKPFSGKTGNML 136
           +L  S HD  CH C     T     + G    +LM+IG  P   ++ +G PF G++G +L
Sbjct: 2   NLSNSLHDTRCHSCGLDKDTCRIVVSRGDPTSNLMLIGEAPGAKEDETGIPFVGRSGKLL 61

Query: 137 DKMLQSIEI-MRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           + +L++        + I  +    PP NR  +  E++   P + +QI+L+ P I++ IG+
Sbjct: 62  NILLENEGFDYEKDVFICNLLKSRPPNNRTPTRQEIQNHIPWLYQQIKLVDPLIIVLIGS 121

Query: 196 KTKNFFFN-----NDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
                        +D + T+ N   W+        I  +   HP  L++ P
Sbjct: 122 SALRAILGIKSKISDLRGTWHN---WNG-------IYAMPIFHPSYLLRNP 162


>gi|53723251|ref|YP_112236.1| DNA glycosylase [Burkholderia pseudomallei K96243]
 gi|126442562|ref|YP_001064135.1| uracil-DNA glycosylase [Burkholderia pseudomallei 668]
 gi|237507691|ref|ZP_04520406.1| uracil-DNA glycosylase, family 4 [Burkholderia pseudomallei
           MSHR346]
 gi|52213665|emb|CAH39719.1| putative DNA glycosylase [Burkholderia pseudomallei K96243]
 gi|126222053|gb|ABN85558.1| uracil-DNA glycosylase, family 4 [Burkholderia pseudomallei 668]
 gi|234999896|gb|EEP49320.1| uracil-DNA glycosylase, family 4 [Burkholderia pseudomallei
           MSHR346]
          Length = 218

 Score = 55.8 bits (133), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 33/178 (18%), Positives = 78/178 (43%), Gaps = 13/178 (7%)

Query: 84  LRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSI 143
           L +   C L   +   +         +M++G  P + ++  G PF G  G +L++ L + 
Sbjct: 26  LDACRRCGLWEHATQAVPGAGPPRAAIMLVGEQPGNQEDREGAPFVGPAGRVLERALAAA 85

Query: 144 EIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELISPKILLFIGNK 196
            + R  ++++       W P G R +    +  E++ CR  + R+++ + P++++ +G  
Sbjct: 86  GLDRASVYVTNAVKHFKWAPRGKRRMHKTPAQQEIDACRYWLERELDALGPRVVVALGAI 145

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQY--PLIKKNTWHALI 252
                 ++   +    +G   +    + I    AT HP  +++   P  +K  + A++
Sbjct: 146 ALKAVLDDRHARLQSAMGVVQSAGGRYVI----ATYHPSFVLRVPDPDARKRAYAAIV 199


>gi|239834976|ref|ZP_04683304.1| Uracil-DNA glycosylase superfamily [Ochrobactrum intermedium LMG
           3301]
 gi|239823039|gb|EEQ94608.1| Uracil-DNA glycosylase superfamily [Ochrobactrum intermedium LMG
           3301]
          Length = 477

 Score = 55.8 bits (133), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 60/131 (45%), Gaps = 15/131 (11%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKML--QSIEIMR 147
           C LC  +  T+     E  +LMI+G  P D +++ G+PF G  G++L + +     E+ +
Sbjct: 297 CGLCEAATQTVWGEGPEDAELMIVGEQPGDREDLEGRPFVGPAGHLLREAMVAAGAEVRQ 356

Query: 148 TQI-----HISMISPWHPPGNRNL----SNIEMEICRPIIMRQIELISPKILLFIGNKTK 198
           T +     H   +    P G R L       E+  CR  +  ++  I P++++ +G    
Sbjct: 357 TWLTNAVKHFKFM----PRGKRRLHQNPDRQEILHCRWWLGLELAFIRPRMVVALGASAA 412

Query: 199 NFFFNNDAQKT 209
               +N+A  T
Sbjct: 413 FALTDNNAPLT 423


>gi|86358569|ref|YP_470461.1| putative uracil DNA glycosylase protein [Rhizobium etli CFN 42]
 gi|86282671|gb|ABC91734.1| putative uracil DNA glycosylase protein [Rhizobium etli CFN 42]
          Length = 484

 Score = 55.5 bits (132), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 39/175 (22%), Positives = 81/175 (46%), Gaps = 15/175 (8%)

Query: 31  PNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQK----ACSLHELKSLLRS 86
           P   A+ ES+ +  +   A Q +      H  L Q A ++  +    A +L  L++    
Sbjct: 244 PGLIASAESKVRAMAAREATQSLP----FHERLQQAARNLPAEPELPAGTLEALRAEAAV 299

Query: 87  FHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIM 146
              C L + +  T+         +M +G  P D ++I+G+PF G  G + D+++    I 
Sbjct: 300 CMRCPLHANATQTVFGEGPRDAAVMFVGEQPGDQEDIAGRPFVGPAGKLFDQVIAEAGID 359

Query: 147 RTQIHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELISPKILLFIG 194
           R+ ++++       + P G R +    +  E++ CR  +  ++ L+ PK+++ +G
Sbjct: 360 RSMLYVTNAVKHFKYEPRGKRRIHQKPTMGEVKQCRWWLDLELALVKPKLIVAMG 414


>gi|118463844|ref|YP_883243.1| uracil DNA glycosylase superfamily protein [Mycobacterium avium
           104]
 gi|118165131|gb|ABK66028.1| uracil DNA glycosylase superfamily protein [Mycobacterium avium
           104]
          Length = 221

 Score = 55.5 bits (132), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 40/188 (21%), Positives = 75/188 (39%), Gaps = 16/188 (8%)

Query: 67  ADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGK 126
           AD    +   +  LK    +   C L + +  T+      G  +M++G  P D ++ +G 
Sbjct: 10  ADRYLPEQRDIEALKHAAETCRGCSLFADATQTVFGNGHPGAPIMLVGEQPGDQEDRAGA 69

Query: 127 PFSGKTGNMLDKMLQSIEIMRTQIH----ISMISPWHPPGNRNL----SNIEMEICRPII 178
           PF G  G +L + L    I     +    +         G R +       E+  CRP +
Sbjct: 70  PFVGPAGRLLARALHDAGIDPGLTYQTNAVKHFKFTRKDGKRRIHQKPGRTEIVACRPWL 129

Query: 179 MRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPT-------LAT 231
           + +IE + P++++ +G            + + Q  G+   L     +IP        +AT
Sbjct: 130 IAEIEAVHPRVIVCLGATAAQSLLGTSFRVSAQR-GQPLKLPASPEVIPDVAPEPVLVAT 188

Query: 232 VHPQELIQ 239
           VHP  +++
Sbjct: 189 VHPSSVLR 196


>gi|48477991|ref|YP_023697.1| DNA polymerase [Picrophilus torridus DSM 9790]
 gi|48430639|gb|AAT43504.1| DNA polymerase, bacteriophage-type [Picrophilus torridus DSM 9790]
          Length = 326

 Score = 55.5 bits (132), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 26/111 (23%), Positives = 62/111 (55%)

Query: 91  HLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQI 150
           H  S S + +        +++ IG +P  +++ + +PF+G+ G  L+ +L+   + R ++
Sbjct: 159 HNWSMSRNYVPGEGNLNSEVIFIGQSPGFNEDETRRPFTGRAGLFLNSLLKMAGLERNRV 218

Query: 151 HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFF 201
           +++ +  +    NR  +  E+E   P ++R+I++I PK+++ +G+   N F
Sbjct: 219 YLTNVLKFMTYKNRPPNKHEIENAMPYLLREIDIIRPKLIVLMGSTAVNAF 269


>gi|221638650|ref|YP_002524912.1| Phage SPO1 DNA polymerase-related protein [Rhodobacter sphaeroides
           KD131]
 gi|221159431|gb|ACM00411.1| Phage SPO1 DNA polymerase-related protein [Rhodobacter sphaeroides
           KD131]
          Length = 485

 Score = 55.5 bits (132), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 36/173 (20%), Positives = 71/173 (41%), Gaps = 11/173 (6%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           SL E K+       C L + +   +         +MI+G  P D ++++G+PF G  G +
Sbjct: 290 SLAEAKTAAEGCRRCGLWANATQVVFGEGPATARMMIVGEQPGDREDLAGRPFVGPAGQL 349

Query: 136 LDKMLQSIEIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELISPK 188
            D+   +  + R  ++++       + P G R +       E+  CR  +  + +L+ P+
Sbjct: 350 FDEEAAAAGLDRQAVYVTNAVKHFKFAPRGKRRIHQKPDAGEVTACRWWLDLERDLVRPR 409

Query: 189 ILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
           +++ +G  T             +  G    L       P   TVHP  +++ P
Sbjct: 410 LIVAMG-ATALASLTGSGAGILKRRGSVERL---DDGTPLFVTVHPSYILRLP 458


>gi|163742352|ref|ZP_02149739.1| Uracil-DNA glycosylase superfamily protein [Phaeobacter
           gallaeciensis 2.10]
 gi|161384302|gb|EDQ08684.1| Uracil-DNA glycosylase superfamily protein [Phaeobacter
           gallaeciensis 2.10]
          Length = 481

 Score = 55.5 bits (132), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 38/166 (22%), Positives = 70/166 (42%), Gaps = 14/166 (8%)

Query: 86  SFHDCHLCSTSLSTICATQTEG---QDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQS 142
           + + C LC        A   EG    DLMI+G  P D +++ G+PF G  G + D++   
Sbjct: 288 AINSCTLCPLYGPATQAVPGEGPTDADLMIVGEQPGDQEDLVGRPFVGPAGQLFDQLATE 347

Query: 143 IEIMRTQIHISMIS---PWHPPGNRNL----SNIEMEICRPIIMRQIELISPKILLFIGN 195
             + R   +++       + P G + L    +  E+  C+  +  +++ + PK++L +G 
Sbjct: 348 AGLPREAAYVTNAVKHFKFLPRGRKRLHQQPNGSEIRHCQVWLRAELDQVRPKLILALGA 407

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
                   +  +   Q  G            P L T+HP  L++ P
Sbjct: 408 TAAEALLGS-GKHILQRRGTIERRV---DGTPVLITLHPSYLLRVP 449


>gi|323141535|ref|ZP_08076421.1| putative uracil-DNA glycosylase A [Phascolarctobacterium sp. YIT
           12067]
 gi|322413994|gb|EFY04827.1| putative uracil-DNA glycosylase A [Phascolarctobacterium sp. YIT
           12067]
          Length = 217

 Score = 55.5 bits (132), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 75/165 (45%), Gaps = 5/165 (3%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
            L EL+  L +   C L   +++ +         ++ +G  P   ++  G P  G +G +
Sbjct: 7   DLSELEGELANCQACPLRQDAIAPVSWYGNPESPIVFVGEGPGQVEDDYGCPLIGPSGQL 66

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEIC-RPIIMRQIELISPKILLFIG 194
           LDK L + ++ R ++  + +    P  NR     E + C +  + R++E+I PK+++ +G
Sbjct: 67  LDKALWAAKMTRDRVLTTNVIKCRPKNNRTPDIAEADFCAKQWLQRELEIIQPKVIVALG 126

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ 239
           +   +     D + T ++ G W            +AT HP  L++
Sbjct: 127 SVALHCLGRPDMRIT-RDRGMWFRT---EQGFDCIATYHPAYLLR 167


>gi|320107090|ref|YP_004182680.1| phage SPO1 DNA polymerase-like protein [Terriglobus saanensis
           SP1PR4]
 gi|319925611|gb|ADV82686.1| phage SPO1 DNA polymerase-related protein [Terriglobus saanensis
           SP1PR4]
          Length = 215

 Score = 55.5 bits (132), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 75/175 (42%), Gaps = 20/175 (11%)

Query: 78  HELKSLLRSFHDCHLCSTSLSTICATQT---EGQ---DLMIIGYTPSDSDNISGKPFSGK 131
           H L ++  +   C  C       CATQ     G+    +M++G  P D +++ GKPF   
Sbjct: 19  HNLTAIREALPHCRGCELYR---CATQVVPGAGRATVSIMLVGEQPGDQEDLQGKPFVDP 75

Query: 132 TGNMLDKMLQSIEIMRTQI-------HISMISPWHPPGNRNLSNIEMEICRPIIMRQIEL 184
            G +L + L  I +   QI       H   +       ++N    E+  CRP ++ + + 
Sbjct: 76  AGEVLHRALAEISLDPAQIYVTNAVKHFKFVRNGKRRLHKNPRMSEITACRPWLLAEFDA 135

Query: 185 ISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ 239
           I PKI+L +G                ++ GK   L TP +    +ATVHP  +++
Sbjct: 136 IKPKIVLCLGASAAKSILGG-TFGLMRDRGKI--LSTPFA-EHVMATVHPSAVLR 186


>gi|41409354|ref|NP_962190.1| hypothetical protein MAP3256c [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|41398174|gb|AAS05804.1| hypothetical protein MAP_3256c [Mycobacterium avium subsp.
           paratuberculosis K-10]
          Length = 221

 Score = 55.5 bits (132), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 40/188 (21%), Positives = 75/188 (39%), Gaps = 16/188 (8%)

Query: 67  ADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGK 126
           AD    +   +  LK    +   C L + +  T+      G  +M++G  P D ++ +G 
Sbjct: 10  ADRYLPEQRDIEALKHAAETCRGCSLFADATQTVFGNGHPGAPIMLVGEQPGDQEDRAGA 69

Query: 127 PFSGKTGNMLDKMLQSIEIMRTQIH----ISMISPWHPPGNRNL----SNIEMEICRPII 178
           PF G  G +L + L    I     +    +         G R +       E+  CRP +
Sbjct: 70  PFVGPAGRLLARALHDAGIDPGLTYQTNAVKHFKFTRKDGKRRIHQKPGRTEIVACRPWL 129

Query: 179 MRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPT-------LAT 231
           + +IE + P++++ +G            + + Q  G+   L     +IP        +AT
Sbjct: 130 IAEIEAVHPRVIVCLGATAAQSLLGTSFRVSTQR-GQPLKLPASPEVIPDVAPEPVLVAT 188

Query: 232 VHPQELIQ 239
           VHP  +++
Sbjct: 189 VHPSSVLR 196


>gi|282862962|ref|ZP_06272022.1| Uracil-DNA glycosylase superfamily [Streptomyces sp. ACTE]
 gi|282561944|gb|EFB67486.1| Uracil-DNA glycosylase superfamily [Streptomyces sp. ACTE]
          Length = 225

 Score = 55.5 bits (132), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 39/185 (21%), Positives = 78/185 (42%), Gaps = 27/185 (14%)

Query: 80  LKSLLRSFHDCHLC---STSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           + +L R+   CH C   + +  T+  T       +++G  P D ++ SG+PF G  G +L
Sbjct: 20  IAALRRAAAGCHGCPLYADATQTVFGTGPVPARALLVGEQPGDQEDRSGEPFVGPAGGLL 79

Query: 137 DKMLQSIEIMRTQIHIS------MISPWHPPGNRNLSNI----EMEICRPIIMRQIELIS 186
            + L +  +    ++++        +P      R +       E+  CRP +  ++  + 
Sbjct: 80  RRALAAAGVDDRDVYLTNAVKHFKFAPVAEGRRRRIHKAPDLRELAACRPWLAAELRRVD 139

Query: 187 PKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPT------------LATVHP 234
           P++++ +G         N A K  ++ G   +L  P   +P             LATVHP
Sbjct: 140 PELVVALGATAGKSVLGN-AFKVSESRGALLSL-PPDEDLPLTAGEERPGGRRFLATVHP 197

Query: 235 QELIQ 239
             +++
Sbjct: 1