PSIBLAST alignment of GI: 254780743 and protein with PDB id: 1l9g

gi|31615491|pdb|1L9G|A Chain A, Crystal Structure Of Uracil-Dna Glycosylase From T. Maritima Length = 192
 Score =  162 bits (409), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 35/181 (19%), Positives = 75/181 (41%), Gaps = 5/181 (2%)

Query: 82  SLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQ 141
             ++    C L     + +         ++ +G  P + ++ +G+PF G+ G +L ++L+
Sbjct: 13  ERVKKCTACPLHLNRTNVVVGEGNLDTRIVFVGEGPGEEEDKTGRPFVGRAGMLLTELLR 72

Query: 142 SIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFF 201
              I R  ++I  +    PP NR  +  E   C   ++ QIE+I+P +++ +G    +FF
Sbjct: 73  ESGIRREDVYICNVVKCRPPNNRTPTPEEQAACGHFLLAQIEIINPDVIVALGATALSFF 132

Query: 202 FNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLI--KKNTWHALITLKKALK 259
            +       +  G   +          + T HP  L++      ++     +   K  +K
Sbjct: 133 VDGKKVSITKVRGNPIDWL---GGKKVIPTFHPSYLLRNRSNELRRIVLEDIEKAKSFIK 189

Query: 260 N 260
            
Sbjct: 190 K 190