BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780743|ref|YP_003065156.1| putative uracil-DNA
glycosylase [Candidatus Liberibacter asiaticus str. psy62]
         (261 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|209886081|ref|YP_002289938.1| uracil-DNA glycosylase, family 4 [Oligotropha carboxidovorans OM5]
 gi|209874277|gb|ACI94073.1| uracil-DNA glycosylase, family 4 [Oligotropha carboxidovorans OM5]
          Length = 275

 Score =  245 bits (624), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 80/270 (29%), Positives = 130/270 (48%), Gaps = 13/270 (4%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVF-DEPNNEATYESQRKEK--------SIDSAIQ 51
           M S+R  +Q ++L    FY ++GV     +EP N  +                       
Sbjct: 4   MMSERPPTQHELLA---FYLEAGVDCALAEEPVNRLSETEAEPAPMRATPVRERPAPLPV 60

Query: 52  PITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLM 111
           P T++       ++ A  +A +A +L EL+ LL  F  C L  T+   +         +M
Sbjct: 61  PRTDVAPAPDVAIESARELAPQAKTLDELRGLLEVFDGCALKMTATRLVFGDGNPQARVM 120

Query: 112 IIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEM 171
            +G  P   +++ G PF G++G +LD ML SI + RT  +I+ + PW PPGNR  S  E 
Sbjct: 121 FVGEAPGRDEDLQGIPFIGRSGKLLDLMLASIGLDRTSAYIANVIPWRPPGNREPSPHET 180

Query: 172 EICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLAT 231
           ++C P I RQIEL+ P +L+ +G  +             ++ G+W +  T   +I  +AT
Sbjct: 181 QMCLPFIRRQIELVDPDVLVCLGKPSSQAVLELKDGIV-KSRGRWFDYNTGTRMIRAMAT 239

Query: 232 VHPQELIQYPLIKKNTWHALITLKKALKNL 261
            HP  L++ P+ K+ TW  L  +++AL  L
Sbjct: 240 FHPAYLLRQPIYKRMTWKDLRMIRRALAAL 269


>gi|115526415|ref|YP_783326.1| phage SPO1 DNA polymerase-related protein [Rhodopseudomonas
           palustris BisA53]
 gi|115520362|gb|ABJ08346.1| phage SPO1 DNA polymerase-related protein [Rhodopseudomonas
           palustris BisA53]
          Length = 273

 Score =  241 bits (615), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 85/274 (31%), Positives = 131/274 (47%), Gaps = 17/274 (6%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVF-DEPNNEATYES-----QRKEKSIDSAIQPIT 54
           M     L+  ++L    FY ++GV     DEP N  T ES      R       A  P+ 
Sbjct: 1   MMPDHNLTVRELLA---FYLEAGVDCALADEPVNRLTDESDSALVARPVARALPAAMPLA 57

Query: 55  NIRHIHSP-------LVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEG 107
            +     P        +  A   A+ A +L  L+ LL  F  C L ST+   + A     
Sbjct: 58  PMLAPAQPLAPAPDQAISSAREAARSAPTLEALRDLLERFDGCALKSTATRLVFADGNPQ 117

Query: 108 QDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLS 167
             +M++G  P   ++I G PF G++G +LD ML +I + R+Q++I+ + PW PPGNR  +
Sbjct: 118 ARIMLVGEAPGRDEDIEGLPFVGRSGKLLDLMLAAIGLDRSQVYIANVIPWRPPGNRTPT 177

Query: 168 NIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIP 227
             E +IC P I RQIEL+ P +L+ +GN +     +       +  G+W +  T    I 
Sbjct: 178 PQETQICLPFIKRQIELVDPDVLVTLGNPSTQAILSTREGIM-RTRGRWIDYDTGRRSIR 236

Query: 228 TLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
            L T HP  L++ P  K+ +W  L  +  AL++L
Sbjct: 237 ALPTFHPAYLLRQPSYKRMSWQDLRAIATALESL 270


>gi|299134677|ref|ZP_07027869.1| phage SPO1 DNA polymerase-related protein [Afipia sp. 1NLS2]
 gi|298590487|gb|EFI50690.1| phage SPO1 DNA polymerase-related protein [Afipia sp. 1NLS2]
          Length = 271

 Score =  241 bits (614), Expect = 9e-62,   Method: Composition-based stats.
 Identities = 79/271 (29%), Positives = 132/271 (48%), Gaps = 15/271 (5%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVF-DEPNNEATYESQRKEKSIDS----------A 49
           M S+R  +  ++L    FY ++GV     +EP +  +        +              
Sbjct: 1   MISERPPTPHELLA---FYLEAGVDCALAEEPFDRLSEIEAEPAPAPRRIAPLTPAPALT 57

Query: 50  IQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQD 109
             P T++       ++ A  +A KA +L EL+ LL +F  C L +T+   +         
Sbjct: 58  AAPQTDLAPAPDAAIESARELAPKAKTLEELRGLLEAFDGCALKATATKLVFGDGNPQAR 117

Query: 110 LMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNI 169
           +M +G  P   +++ G PF G++G +LD ML SI + RT+ +I+ + PW PPGNR+ S  
Sbjct: 118 VMFVGEAPGRDEDLQGIPFIGRSGKLLDLMLASIGLDRTKAYIANVIPWRPPGNRDPSPH 177

Query: 170 EMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTL 229
           E ++C P I RQIEL+ P I++ +G  +     +       +  G+W +  T    I  +
Sbjct: 178 ETQMCLPFIKRQIELVDPDIVVCLGKPSSQAVLDLKDGIM-RTRGRWFDYNTGTRTIRAM 236

Query: 230 ATVHPQELIQYPLIKKNTWHALITLKKALKN 260
           AT HP  L++ P+ K+ TW  L T++ AL  
Sbjct: 237 ATFHPAYLLRQPIYKRMTWKDLRTIQTALAA 267


>gi|27377634|ref|NP_769163.1| hypothetical protein bll2523 [Bradyrhizobium japonicum USDA 110]
 gi|27350779|dbj|BAC47788.1| bll2523 [Bradyrhizobium japonicum USDA 110]
          Length = 271

 Score =  240 bits (612), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 72/270 (26%), Positives = 120/270 (44%), Gaps = 16/270 (5%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVF-DEPNNEATY----------ESQRKEKSIDSA 49
           M  +   +  ++L    FY ++GV     +EP +               +  +     +A
Sbjct: 1   MIPEPAPTVRELLA---FYLEAGVDCALTEEPIDRLAEIAAPPPVPRAAAPVEAPRPVAA 57

Query: 50  IQPITNIRHIHSP-LVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQ 108
              I           +  A   A+ A +L  L+ L++ F  C L  T+   + A      
Sbjct: 58  PAVIRGEAAPAPDVAIASAREAARTAPTLEALRELMQGFEGCALKHTATRLVFADGNPQA 117

Query: 109 DLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSN 168
            +M +G  P   ++I G PF G++G +LD M+ +I + RT  +I+ + PW PPGNR  + 
Sbjct: 118 RIMFVGEAPGRDEDIEGLPFVGRSGKLLDLMIGAIGLNRTTAYIANVIPWRPPGNRTPTP 177

Query: 169 IEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPT 228
            E ++C P I RQIEL++P +L+ +GN +             +  G+W +  T    I  
Sbjct: 178 QETQVCLPFIQRQIELVNPDVLVTLGNPSTQTLLGTREGIM-RTRGRWFDYETAGRTIRA 236

Query: 229 LATVHPQELIQYPLIKKNTWHALITLKKAL 258
           L T HP  L++ P  K+  W  L  + K L
Sbjct: 237 LPTFHPAYLLRSPSYKRLAWQDLRAIAKVL 266


>gi|217976632|ref|YP_002360779.1| phage SPO1 DNA polymerase-related protein [Methylocella silvestris
           BL2]
 gi|217502008|gb|ACK49417.1| phage SPO1 DNA polymerase-related protein [Methylocella silvestris
           BL2]
          Length = 281

 Score =  239 bits (609), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 74/264 (28%), Positives = 121/264 (45%), Gaps = 13/264 (4%)

Query: 10  EQILTIALFYADSGVYWVFDE-PNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQAD 68
           E ++ +  +YA+ GV    DE P++     +Q   +    AI        + +P    A 
Sbjct: 3   ESLIALLRWYAEMGVDIALDEIPHDRTRAPAQPPPERPAIAINAPPQAPAMSAPRQPVAI 62

Query: 69  SIAQK-----------ACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTP 117
           + A             A +L +L++ L +F  C L +T+   +      G  +M +G  P
Sbjct: 63  AGADSLERDAREAAAAAKTLEKLRAELLAFEGCGLKTTATQLVFGDGEAGAKVMFVGEAP 122

Query: 118 SDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPI 177
              ++  G PF G+ G +L++ML +I + R  ++I+ + PW PPGNR  + IE   C P 
Sbjct: 123 GADEDRQGVPFVGRAGQLLNRMLAAIGLDRRDVYIANVVPWRPPGNRTPTPIETAACLPF 182

Query: 178 IMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQEL 237
             RQIEL+ PKIL+ +G  +             +  G+W       + I  LA  HP  L
Sbjct: 183 TRRQIELVGPKILVCLGLPSAQTLLGAK-DSMTRIRGRWLTYDCGGTPIRALAMFHPAYL 241

Query: 238 IQYPLIKKNTWHALITLKKALKNL 261
           ++ P  KK  W  L  L +AL ++
Sbjct: 242 LRQPGQKKLAWQDLRMLARALADM 265


>gi|85714248|ref|ZP_01045236.1| phage SPO1 DNA polymerase-related protein [Nitrobacter sp. Nb-311A]
 gi|85698695|gb|EAQ36564.1| phage SPO1 DNA polymerase-related protein [Nitrobacter sp. Nb-311A]
          Length = 281

 Score =  238 bits (606), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 78/280 (27%), Positives = 133/280 (47%), Gaps = 24/280 (8%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVF-DEPNNEATYE-------------------SQ 40
           MTS +  +  ++L    FY ++GV     DEP +  +                     + 
Sbjct: 1   MTSDQATTVRELLA---FYLEAGVDCALGDEPIDRLSTPDLARSDRPVATAAGIVPVAAV 57

Query: 41  RKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTI 100
           R+     +   P   +       ++ A   A+ A SL  L++LL SF  C L  T+   +
Sbjct: 58  RQPPRQTATAAPRAGVAPPPDIAIESAREAARTAPSLEALRTLLESFDGCALKFTASRLV 117

Query: 101 CATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHP 160
            A       LM +G  P   ++I+G PF G++G +L++M+ +I + R+ ++I+ + PW P
Sbjct: 118 FADGNPQARLMFVGEAPGRDEDIAGLPFVGRSGQLLNRMIAAIGLKRSDVYIANVIPWRP 177

Query: 161 PGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLC 220
           PGNR  +  E +IC P I RQIEL++P +L+ +GN +         +   +  GKW +  
Sbjct: 178 PGNRTPTPQETQICLPFIRRQIELVNPDVLVTLGNPSTQTLLQ-TREGIKRIRGKWFDYD 236

Query: 221 TPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
                I  +AT HP  L++ P  K+  W  L  + +AL++
Sbjct: 237 VGTRTIRAMATFHPAYLLRSPFDKRMAWLDLRAIARALED 276


>gi|319898574|ref|YP_004158667.1| phage SPO1 DNA polymerase-related protein [Bartonella clarridgeiae
           73]
 gi|319402538|emb|CBI76081.1| phage SPO1 DNA polymerase-related protein [Bartonella clarridgeiae
           73]
          Length = 283

 Score =  237 bits (604), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 91/275 (33%), Positives = 130/275 (47%), Gaps = 16/275 (5%)

Query: 2   TSKRILSQEQILTIALFYADSGVYWVF-DEPNNEATYESQRKEKSIDSAIQPI------- 53
            SK+I        +  FY +SGV     D P +     +   E  ++ A  P        
Sbjct: 10  MSKKIKDLILSEDLLNFYKESGVDTALTDVPIDRFNQPTTPLEPQLNQAYNPPHHKQISP 69

Query: 54  -------TNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTE 106
                        ++     A  IA+ A +L ELKS L SF+DC L  T+ +T  +  T 
Sbjct: 70  TIKPYALPPYNPNNTQPALSAIEIAKNAQTLDELKSALLSFNDCSLKLTAKNTCFSDGTA 129

Query: 107 GQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNL 166
           G  LM+IG  P   ++I G PF GK G +L+K+L SI + R  ++I+   PW PPGNR  
Sbjct: 130 GSPLMLIGEAPGREEDIQGIPFVGKAGILLNKILASIGLTRQNVYIANTIPWRPPGNRTP 189

Query: 167 SNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSII 226
           +  E+ +CRP I RQI L  P+IL+ +G     FF    +    +  GKW      +  I
Sbjct: 190 TPREVALCRPFIERQIFLAKPRILIALGGTATQFFTGVQSSII-RIRGKWLTYENENLKI 248

Query: 227 PTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
           P + T HP  L++ P  KK TW   + +K  L NL
Sbjct: 249 PVMPTFHPAYLLRTPSQKKLTWIDFLEVKNRLNNL 283


>gi|319403899|emb|CBI77485.1| phage SPO1 DNA polymerase-related protein [Bartonella rochalimae
           ATCC BAA-1498]
          Length = 273

 Score =  236 bits (602), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 87/274 (31%), Positives = 127/274 (46%), Gaps = 15/274 (5%)

Query: 2   TSKRILSQEQILTIALFYADSGVYWVF-DEPNNEATYESQRKEK-------------SID 47
            S++         +  FY +SGV     D P +     +  + +             S  
Sbjct: 1   MSEKNKDVISNEDLLSFYKESGVDAALTDVPIDHFNQAASLEPQLNQAHDIPYYKKISPT 60

Query: 48  SAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEG 107
                +       +  V  A  IA+ A +L ELKS L SF+ C L  T+ +T  +  T G
Sbjct: 61  IKSHTLAPDNPDKTQPVLSAVEIAKSAQTLDELKSALLSFNGCSLKLTAKNTCFSDGTAG 120

Query: 108 QDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLS 167
             LM+IG  P   ++I G PF GK G +L+K+L SI + R  ++I+   PW PPGNR  +
Sbjct: 121 SPLMLIGEAPGREEDIQGIPFVGKAGILLNKILASIGLSRQNVYIANTIPWRPPGNRTPT 180

Query: 168 NIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIP 227
             E+ +CRP I RQI L  P+IL+ +G+    FF    +    +  GKW         IP
Sbjct: 181 PREVTLCRPFIERQILLAKPRILIALGSTAAQFFTGIQS-GIIRIRGKWLTYENEDLQIP 239

Query: 228 TLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
            + T HP  L++ P  KK TW   + +K  L NL
Sbjct: 240 VMPTFHPAYLLRTPSQKKLTWMDFLEVKNRLNNL 273


>gi|319406910|emb|CBI80545.1| phage SPO1 DNA polymerase-related protein [Bartonella sp. 1-1C]
          Length = 273

 Score =  235 bits (599), Expect = 5e-60,   Method: Composition-based stats.
 Identities = 86/274 (31%), Positives = 127/274 (46%), Gaps = 15/274 (5%)

Query: 2   TSKRILSQEQILTIALFYADSGVYWVF-DEPNNEATYESQRKEK-------------SID 47
            S++         +  FY +SGV     D P +     +  + +             S  
Sbjct: 1   MSEKNKDVISNEDLLSFYKESGVDAALTDVPIDHFNQAASLEPQLNQAHDIPYHKQISPT 60

Query: 48  SAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEG 107
                +       +  +  A  IA+ A +L ELKS L SF+ C L  T+ +T  +  T G
Sbjct: 61  IKSHTLAPDNPDKTQPLLSAVEIAKSAQTLDELKSALLSFNGCSLKLTAKNTCFSDGTAG 120

Query: 108 QDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLS 167
             LM+IG  P   ++I G PF GK G +L+K+L SI + R  ++I+   PW PPGNR  +
Sbjct: 121 SPLMLIGEAPGREEDIQGIPFVGKAGILLNKILASIGLSRQNVYIANTIPWRPPGNRTPT 180

Query: 168 NIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIP 227
             E+ +CRP I RQI L  P+IL+ +G+    FF    +    +  GKW         IP
Sbjct: 181 PREVALCRPFIERQILLAKPRILIALGSTAAQFFTGIQS-GIIRIRGKWLTYENEDLQIP 239

Query: 228 TLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
            + T HP  L++ P  KK TW   + +K  L NL
Sbjct: 240 VMPTFHPAYLLRTPSQKKLTWMDFLEVKNRLNNL 273


>gi|192289638|ref|YP_001990243.1| phage SPO1 DNA polymerase-related protein [Rhodopseudomonas
           palustris TIE-1]
 gi|192283387|gb|ACE99767.1| phage SPO1 DNA polymerase-related protein [Rhodopseudomonas
           palustris TIE-1]
          Length = 276

 Score =  234 bits (597), Expect = 9e-60,   Method: Composition-based stats.
 Identities = 77/277 (27%), Positives = 120/277 (43%), Gaps = 21/277 (7%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVF----------DEPNNEATYESQRKEKSIDSAI 50
           MT     S  Q+L    FY D+GV              D P+  A   +      +  A+
Sbjct: 1   MTPDPAPSLRQLLA---FYLDAGVDCALAEGPVNRMLDDAPDPAAREAAPEPRPIVKPAL 57

Query: 51  QPITNIR-------HIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICAT 103
                               +  A   A  A +L  L+ L++ F  C L +T+   + A 
Sbjct: 58  HAKPPPPLAFGAPPASPDAAIISAREAAATAPTLEALRELMQRFDGCALRATATQLVFAD 117

Query: 104 QTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGN 163
                 +M +G  P   ++I G PF G++G +LD ML +I + R  ++I+ + PW PPGN
Sbjct: 118 GNPQAKVMFVGEAPGRDEDIEGLPFVGRSGKLLDLMLAAIGLNRGNVYIANVIPWRPPGN 177

Query: 164 RNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPH 223
           R  +  E +IC P I RQIEL++P +L+ +GN +             +  G+W +  T  
Sbjct: 178 RTPTPQETQICLPFIRRQIELVNPDLLVTLGNPSTQALLGTRDGIM-RTRGRWFDYDTGT 236

Query: 224 SIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
             I  L T+HP  L++ P  K+  W  L  +  AL  
Sbjct: 237 RTIRALPTLHPAYLLRQPTYKRLAWQDLRAIATALAA 273


>gi|307941594|ref|ZP_07656949.1| DNA polymerase [Roseibium sp. TrichSKD4]
 gi|307775202|gb|EFO34408.1| DNA polymerase [Roseibium sp. TrichSKD4]
          Length = 307

 Score =  234 bits (596), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 77/305 (25%), Positives = 132/305 (43%), Gaps = 46/305 (15%)

Query: 2   TSKRILSQEQILTIALFYADSGVYWVFDE-PNNEATYESQ-------------------- 40
                LS+ ++  +  FY  SGV    +E P +     ++                    
Sbjct: 1   MENNTLSKREVEALIDFYLASGVDGFLEEEPVDRFAAPAKPPVSLADFQSPATQTPNSPP 60

Query: 41  -------------------RKEKSIDSAIQPITNIRH-----IHSPLVQQADSIAQKACS 76
                              R  ++  ++  PI               +  A   A  A S
Sbjct: 61  NQRGQQPVSSAGPAAQQQGRPPQTPPASASPIPAAPQGGAVIPDQAAINSARERALTAQS 120

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L EL+ LL +F  C+L  T+ + + A       +M +G  P   ++I GKPF G++G +L
Sbjct: 121 LDELRELLGTFEGCNLRLTAKNLVFADGNPVAKVMFVGEAPGRDEDILGKPFVGRSGQLL 180

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
           D+ML +I + R+  +I+ + PW PPGNR  +  E E+C+P I RQI L +P +L+F+G  
Sbjct: 181 DRMLTAIGLDRSSAYIANVVPWRPPGNRTPTPQETELCKPFIQRQITLANPDVLVFLGAA 240

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
           +     +       +  G+W    +    IP +AT HP  L++ PL K+ +W   + ++ 
Sbjct: 241 SAKSLLDVK-DGIRRLRGQWKEYDSGSRKIPCVATYHPAYLLRSPLEKRLSWRDFLAIRA 299

Query: 257 ALKNL 261
            L ++
Sbjct: 300 KLDDM 304


>gi|49474043|ref|YP_032085.1| DNA polymerase [Bartonella quintana str. Toulouse]
 gi|49239547|emb|CAF25904.1| DNA polymerase, bacteriophage type [Bartonella quintana str.
           Toulouse]
          Length = 275

 Score =  233 bits (595), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 94/276 (34%), Positives = 133/276 (48%), Gaps = 23/276 (8%)

Query: 3   SKRILSQEQILTIALFYADSGVYWVF-DEPNNEA---------------TYESQRKEKSI 46
           S+  +S E++L+   FY +SGV  V  D P +                 T   Q    +I
Sbjct: 5   SQYSISYEELLS---FYKESGVDAVLSDVPIDRFSQASSSTQELKKVIDTPHHQSVSPTI 61

Query: 47  DSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTE 106
                P+ +   I       A  IA+ A +L ELKS L  F+ C L  T+ ST  +  T 
Sbjct: 62  KQHSYPLPHSSTIQREP--SAIEIAKSANTLDELKSALLVFNGCSLKLTAKSTCFSDGTA 119

Query: 107 GQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNL 166
           G  LMIIG  P   ++I G PF GK G +L+K+L SI + R  ++I+   PW PPGNR  
Sbjct: 120 GSPLMIIGEAPGREEDIQGIPFVGKAGMLLNKILASIGLTRKNVYIANTIPWRPPGNRTP 179

Query: 167 SNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHS-I 225
           +  E+ +CRP I RQI L +P+IL+ +G      F         +  GKW    +  +  
Sbjct: 180 TPREVALCRPFIERQIHLANPRILIALGGVAMQ-FLTGSQNGIIRTRGKWCTYESEDNIK 238

Query: 226 IPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
           IP + T HP  L++ P  KK TW   + +K  L NL
Sbjct: 239 IPVMPTFHPAYLLRTPSQKKLTWRDFLEVKNRLNNL 274


>gi|86748208|ref|YP_484704.1| phage SPO1 DNA polymerase-related protein [Rhodopseudomonas
           palustris HaA2]
 gi|86571236|gb|ABD05793.1| phage SPO1 DNA polymerase-related protein [Rhodopseudomonas
           palustris HaA2]
          Length = 277

 Score =  233 bits (595), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 80/275 (29%), Positives = 126/275 (45%), Gaps = 19/275 (6%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVF-DEPNNE---------ATYESQRKEKSIDSAI 50
           MT +   S +Q+L    FY ++GV     DEP N          A  ++           
Sbjct: 1   MTPEPAPSLKQLLA---FYLEAGVDCALTDEPINRMLDDETATPAIADAPVARADTIRPP 57

Query: 51  QPITNI-----RHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQT 105
            P                +  A   A  A +L  L++L+  F  C L ST+   + A   
Sbjct: 58  APRPTALPGVAPPSPEAAIVSAREAAATAPTLEALRALMEQFEGCALRSTATRLVFADGN 117

Query: 106 EGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRN 165
               LM++G  P   ++I G PF G++G +LD ML +I + R+Q++I+ + PW PPGNR 
Sbjct: 118 PQARLMLVGEAPGREEDIEGLPFVGRSGKLLDLMLAAIGLDRSQVYIANVIPWRPPGNRT 177

Query: 166 LSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSI 225
            +  E +IC P I RQIEL++P IL+ +GN +     +       +  G+W +      +
Sbjct: 178 PTPQETQICLPFIKRQIELVNPAILVTLGNPSTQTLLS-TRDGITRTRGRWFDYDNGTRM 236

Query: 226 IPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
           I  + T+HP  L++ P  K+  W  L  +  AL  
Sbjct: 237 IRAMPTLHPAYLLRQPTYKRLAWQDLRAIATALAA 271


>gi|121602683|ref|YP_988758.1| uracil-DNA glycosylase [Bartonella bacilliformis KC583]
 gi|120614860|gb|ABM45461.1| uracil-DNA glycosylase, family 4 [Bartonella bacilliformis KC583]
          Length = 275

 Score =  233 bits (594), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 95/271 (35%), Positives = 134/271 (49%), Gaps = 19/271 (7%)

Query: 6   ILSQEQILTIALFYADSGVYWVF-DEPNNEATYESQRKEK-----SIDSAIQPITNIRHI 59
            +S E++L+   FY +SG      DEP N        ++K      I S  Q    I+  
Sbjct: 8   PISYEELLS---FYKESGADAALADEPINRFNQSPSSEQKLKQTCDIPSHQQTPPTIKLN 64

Query: 60  HSPL--------VQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLM 111
             PL           A  +A+ A +L ELKS L +F  C L  T+ +T  +  T G  LM
Sbjct: 65  APPLNHPDTTQHALSAIEMAKNAKTLDELKSALLAFDGCSLKMTAKNTCFSDGTAGSPLM 124

Query: 112 IIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEM 171
           +IG  P   ++I G PF GK G +L+K+L SI + R  ++I+   PW PPGNR  +  EM
Sbjct: 125 LIGEAPGREEDIQGIPFVGKAGILLNKILASIGLTRENVYIANTVPWRPPGNRTPTAREM 184

Query: 172 EICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHS-IIPTLA 230
            +CRP I RQI+L +P+IL+ +G     FF    +    +  GKW    T     IP + 
Sbjct: 185 ALCRPFIERQIQLANPRILVALGGTAVQFFTGTQSGIV-RIRGKWLTYETEDKVKIPVMP 243

Query: 231 TVHPQELIQYPLIKKNTWHALITLKKALKNL 261
           T HP  L++ P  KK TW   + +K  L NL
Sbjct: 244 TFHPAYLLRTPSQKKLTWIDFLEVKNRLNNL 274


>gi|163867968|ref|YP_001609172.1| phage SPO1 DNA polymerase-related protein [Bartonella tribocorum
           CIP 105476]
 gi|161017619|emb|CAK01177.1| phage SPO1 DNA polymerase-related protein [Bartonella tribocorum
           CIP 105476]
          Length = 279

 Score =  233 bits (593), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 87/274 (31%), Positives = 130/274 (47%), Gaps = 23/274 (8%)

Query: 7   LSQEQILTIALFYADSGVYWVF-DEPNNEATYESQRKEKSID---------SAIQPITNI 56
           +S E++L+   FY +SG   V  D P +        ++KS            +      +
Sbjct: 9   ISYEELLS---FYKESGADAVLADLPIDRFKQSFSSEKKSTPVVSVSHHQQRSPTTSPTV 65

Query: 57  RHIHSPL--------VQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQ 108
           +  H PL           A   A+ A +L ELKS L +F+ C L  T+ +T  +  T G 
Sbjct: 66  KLDHQPLHNSRAIQNEPAAIESAKSAKTLDELKSALLAFNGCSLKLTAKNTCFSDGTAGS 125

Query: 109 DLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSN 168
            LM+IG  P   ++I G PF GK G +L+K+L SI + R  ++I+   PW PPGNR  + 
Sbjct: 126 PLMLIGEAPGREEDIQGVPFVGKAGMLLNKILASIGLTRNNVYIANTIPWRPPGNRTPTP 185

Query: 169 IEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHS-IIP 227
            E+ +CRP I R I L  P++L+ +G      F         +  GKW    +  +  IP
Sbjct: 186 REIALCRPFIERHIYLARPRVLIALGGVAAQ-FLTGSQSGIIRTRGKWHIYESEDNIKIP 244

Query: 228 TLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
            + T HP  L++ P  KK TW   + +K  L NL
Sbjct: 245 VMPTFHPAYLLRTPSQKKLTWIDFLEVKNRLDNL 278


>gi|90425831|ref|YP_534201.1| phage SPO1 DNA polymerase-related protein [Rhodopseudomonas
           palustris BisB18]
 gi|90107845|gb|ABD89882.1| phage SPO1 DNA polymerase-related protein [Rhodopseudomonas
           palustris BisB18]
          Length = 277

 Score =  233 bits (593), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 79/277 (28%), Positives = 128/277 (46%), Gaps = 20/277 (7%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVF-DEPNNEATYE---------------SQRKEK 44
           MT +   +  ++L    FY ++GV     DEP N    +               S + + 
Sbjct: 1   MTPEPRPNARELLA---FYLEAGVDCALMDEPVNRLLDDIAPEPARPPAEPRLVSPQPQP 57

Query: 45  SIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQ 104
           +   A+             +  A   A+ A SL  L+ LL +F  C L +T+   + A  
Sbjct: 58  ATPRAVPTAAAPALAPDAAILSAREAARTAPSLQALRELLAAFDGCALKATATQLVFADG 117

Query: 105 TEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNR 164
                +M++G  P   ++I G PF G++G +LD+ML SI + R+ ++I+ + PW PPGNR
Sbjct: 118 NPQARIMLVGEAPGREEDIEGLPFVGRSGKLLDRMLASIGLDRSTVYIANVIPWRPPGNR 177

Query: 165 NLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHS 224
             +  E + C P   RQIEL+ P +L+ +GN +             +  G+W +  T   
Sbjct: 178 TPTPQETQTCLPFTQRQIELVDPDLLVTLGNPSTQTLLATREGIM-KTRGRWVDYDTGSR 236

Query: 225 IIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
            I  L T HP  L++ P  K+  W  L  + KAL++L
Sbjct: 237 RIRALPTFHPAYLLRSPSYKRMAWQDLRAIAKALEDL 273


>gi|240850173|ref|YP_002971566.1| phage SPO1 DNA polymerase-related protein [Bartonella grahamii
           as4aup]
 gi|240267296|gb|ACS50884.1| phage SPO1 DNA polymerase-related protein [Bartonella grahamii
           as4aup]
          Length = 276

 Score =  232 bits (592), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 85/271 (31%), Positives = 126/271 (46%), Gaps = 20/271 (7%)

Query: 7   LSQEQILTIALFYADSGVYWVF-DEPNNEATYESQRKEKSIDSA-----IQPITNIRHIH 60
           +S E++     FY +SG   V  + P N     +  + K I         Q    ++  H
Sbjct: 9   ISYEEL---LNFYKESGADAVLTNFPINRFKQSACSESKLISVVNISHNQQTSPTVKLDH 65

Query: 61  SPL---------VQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLM 111
            PL            A   A  A +L ELKS L +F+ C L  T+ +T  +  T G  LM
Sbjct: 66  RPLHNSRGAIQNEPTAIESANNAKTLDELKSALLAFNGCSLKLTAKNTCFSDGTAGSPLM 125

Query: 112 IIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEM 171
           +IG  P   ++I G PF GK G +L+K+L SI + R  ++I+   PW PPGNR  +  E+
Sbjct: 126 LIGEAPGREEDIQGIPFVGKAGMLLNKILASIGLTRNNVYIANTIPWRPPGNRTPTPREV 185

Query: 172 EICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHS-IIPTLA 230
            +CRP I R I L  P++L+ +G                +  GKW    +  +  IP + 
Sbjct: 186 ALCRPFIERHIYLARPRVLIALGGIAAQ-LLTGSQNGIIRTRGKWHIYESEDNIKIPVMP 244

Query: 231 TVHPQELIQYPLIKKNTWHALITLKKALKNL 261
           T HP  L++ P  KK TW   + +K  L +L
Sbjct: 245 TFHPAYLLRTPSQKKLTWIDFLEVKNRLDSL 275


>gi|319405336|emb|CBI78954.1| phage SPO1 DNA polymerase-related protein [Bartonella sp. AR 15-3]
          Length = 273

 Score =  232 bits (592), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 88/274 (32%), Positives = 125/274 (45%), Gaps = 15/274 (5%)

Query: 2   TSKRILSQEQILTIALFYADSGVYWVF-DEPNNEATYESQRKEK-------------SID 47
            SK+         +  FY +SGV     D P +        + +             S  
Sbjct: 1   MSKKDKDVILNEDLLSFYKESGVDTALTDVPIDHFNQAIPLEPQLNQACDISYHQKISPT 60

Query: 48  SAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEG 107
                        +  V  A  IA+ A +L ELKS L SF+ C L  T+ +T  +  T G
Sbjct: 61  IKSHTPLLNNPDKTQPVLSAVEIAKNAQTLDELKSALLSFNGCLLKLTAQNTCFSDGTAG 120

Query: 108 QDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLS 167
             LM+IG  P   ++I G PF GK G +L+K+L SI + R  ++I+   PW PPGNR  +
Sbjct: 121 SPLMLIGEAPGREEDIQGIPFVGKAGILLNKILASIGLTRQNVYIANTIPWRPPGNRTPT 180

Query: 168 NIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIP 227
             E+ +CRP I RQI L  P+IL+ +G+    FF    +    +  GKW         IP
Sbjct: 181 PREIALCRPFIERQILLAKPRILIALGSTAVQFFTGIQS-GIIRIRGKWLTYENEDLKIP 239

Query: 228 TLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
            + T HP  L++ P  KK TW   + +K  L NL
Sbjct: 240 VMPTFHPAYLLRTPSQKKLTWIDFLEVKNRLNNL 273


>gi|13476397|ref|NP_107967.1| hypothetical protein mll7705 [Mesorhizobium loti MAFF303099]
 gi|14027158|dbj|BAB54112.1| mll7705 [Mesorhizobium loti MAFF303099]
          Length = 291

 Score =  232 bits (591), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 83/291 (28%), Positives = 132/291 (45%), Gaps = 31/291 (10%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVF-DEPNNEATYESQRKEKSIDSAIQPITNIRHI 59
           MT+    S   I  I  FYA +GV     D P N     + R  +   + + P    +  
Sbjct: 1   MTAASPNSPTDIADILAFYASAGVDEALEDAPVNRFAEAAPRPVERAPAPVAPPREEKAP 60

Query: 60  HSPLVQQ---ADSIAQKAC-------------------------SLHELKSLLRSFHDCH 91
             P       A  +                              +L EL+  + +F  C+
Sbjct: 61  ERPAAPPGLDASKVPDAPPARSSVAAVPDEAQAALARQLATTATTLDELRQHMAAFDGCN 120

Query: 92  LCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIH 151
           L +T+ + + A       +M++G  P   ++I G PF G++G +LD+ML +I + RT ++
Sbjct: 121 LKATAKNLVFADGNPDAAVMLVGEAPGRDEDIEGLPFVGRSGRLLDRMLAAIGLDRTSVY 180

Query: 152 ISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQ 211
           I+ + PW PPGNR  +  E EICRP I RQIEL++PK+L+ +G  +     N  ++   +
Sbjct: 181 IANVIPWRPPGNRTPTPHETEICRPFIERQIELVNPKVLVNLGGPSAKTLLN-TSEGILR 239

Query: 212 NLGKWSNLCTPHSI-IPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
             G W    T   I IP + T+HP  L++ P  KK  W   + +K  L+ L
Sbjct: 240 LRGNWRVHTTASGIAIPAMPTLHPAYLLRTPAHKKLAWRDFLEVKAKLRAL 290


>gi|91975690|ref|YP_568349.1| phage SPO1 DNA polymerase-related protein [Rhodopseudomonas
           palustris BisB5]
 gi|91682146|gb|ABE38448.1| phage SPO1 DNA polymerase-related protein [Rhodopseudomonas
           palustris BisB5]
          Length = 282

 Score =  232 bits (591), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 82/281 (29%), Positives = 126/281 (44%), Gaps = 24/281 (8%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVF-DEPNNE-----------ATYESQRKEK---- 44
           MT +   S +Q+L    FY ++GV     DEP N            A             
Sbjct: 1   MTPEPAPSLQQLLA---FYLEAGVDCALNDEPINRLLDDAIAVPIQAETSEAAPRPDTEK 57

Query: 45  ----SIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTI 100
               +     QP   I  +    +  A   A  A SL  L++L+  F  C L ST+   +
Sbjct: 58  IRSLAPRPRAQPAGAIPPLPEAAIVSAREAAATAPSLDALRALMEQFDGCALRSTATRLV 117

Query: 101 CATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHP 160
            A       +M++G  P   ++I G PF G++G +LD ML +I + R++++I+ + PW P
Sbjct: 118 FADGNPKASIMLVGEAPGREEDIEGLPFVGRSGKLLDLMLAAIGLDRSKVYIANVIPWRP 177

Query: 161 PGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLC 220
           PGNR  +  E +IC P I RQIEL+ P IL+ +GN +     +       +  G+W +  
Sbjct: 178 PGNRTPTPQETQICLPFIRRQIELVDPAILVTLGNPSTQALLSTRDGIM-RTRGRWFDYH 236

Query: 221 TPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
                I  L T+HP  L++ P  K+  W  L  +  A   L
Sbjct: 237 NGARTIRALPTLHPAYLLRQPTYKRLAWQDLRAIATAFAAL 277


>gi|316932577|ref|YP_004107559.1| phage SPO1 DNA polymerase-like protein [Rhodopseudomonas palustris
           DX-1]
 gi|315600291|gb|ADU42826.1| phage SPO1 DNA polymerase-related protein [Rhodopseudomonas
           palustris DX-1]
          Length = 275

 Score =  231 bits (590), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 77/274 (28%), Positives = 120/274 (43%), Gaps = 20/274 (7%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVF-DEPNNEATYESQRKEKSIDSAIQPI------ 53
           M    + S  Q+L    FY D+GV     D P N    E+        +           
Sbjct: 1   MIPDPVPSLRQLLA---FYLDAGVDCALADAPVNRMLDEAPAPAGHEATEPSRAVKPALQ 57

Query: 54  ---------TNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQ 104
                              +  A   A  A +L  L+ L++ F  C L  T+   + A  
Sbjct: 58  AQPAPPPPRATQPATPDAAIVSAREAAATAPTLEALRDLMQQFDGCALRGTAKQLVFADG 117

Query: 105 TEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNR 164
                LM++G  P   ++I G PF G++G +LD ML +I + R++++I+ + PW PPGNR
Sbjct: 118 NPQAKLMLVGEAPGRDEDIEGLPFVGRSGKLLDLMLAAIGLDRSKVYIANVIPWRPPGNR 177

Query: 165 NLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHS 224
             +  E +IC P I RQIEL++P +L+ +GN +             +  G+W +  T   
Sbjct: 178 TPTPQETQICLPFIKRQIELVNPDLLVTLGNPSTQALLGTRDGIM-RTRGRWFDYDTGTR 236

Query: 225 IIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
            I  L T+HP  L++ P  K+  W  L  +  AL
Sbjct: 237 TIRALPTLHPAYLLRQPTYKRLAWQDLRAIATAL 270


>gi|154251174|ref|YP_001411998.1| phage SPO1 DNA polymerase-like protein [Parvibaculum
           lavamentivorans DS-1]
 gi|154155124|gb|ABS62341.1| phage SPO1 DNA polymerase-related protein [Parvibaculum
           lavamentivorans DS-1]
          Length = 290

 Score =  231 bits (590), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 75/284 (26%), Positives = 125/284 (44%), Gaps = 27/284 (9%)

Query: 3   SKRILSQEQILTIALFYADSGV-YWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHS 61
           S   ++ E+   +  FY ++GV   + DEP N      +    +     +     R I +
Sbjct: 4   SGPDMTPEEAAALLSFYVEAGVTDALGDEPVNRYALADEAARSAPVPLARAPEAPRTIRA 63

Query: 62  PLVQQ-------------------------ADSIAQKACSLHELKSLLRSFHDCHLCSTS 96
               +                         A   A +  +L EL+  L +F  C L  T+
Sbjct: 64  DPRGEMAPPPAARVAAPAAIPLEDAQAAESAQIAAARCNTLEELRQTLAAFEGCPLRYTA 123

Query: 97  LSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMIS 156
            + + A       +M++G  P   +++ G PF G++G +LD+ML +I + RT ++I+   
Sbjct: 124 KNLVFADGNPQARIMLVGEAPGRDEDLQGLPFVGRSGQLLDRMLAAIGLDRTSVYIANTL 183

Query: 157 PWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKW 216
           PW PPGNR  +  E  IC P I R IEL++PK+LL +G  +       D     +  G+W
Sbjct: 184 PWRPPGNRTPTPAEHAICMPFIERHIELMAPKVLLLLGGVSAKQLLRTDTGIM-RLRGRW 242

Query: 217 SNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
           +        IP L T+HP  L++ P  K+  W  L++ +  L  
Sbjct: 243 TTARIGECDIPALPTLHPAYLLRQPAQKRLAWRDLMSFRAWLDE 286


>gi|319408256|emb|CBI81909.1| phage SPO1 DNA polymerase-related protein [Bartonella
           schoenbuchensis R1]
          Length = 276

 Score =  231 bits (588), Expect = 9e-59,   Method: Composition-based stats.
 Identities = 86/272 (31%), Positives = 135/272 (49%), Gaps = 20/272 (7%)

Query: 6   ILSQEQILTIALFYADSGVYWVF-DEPNNEATYESQRKEKSIDSAI-------------- 50
           ++S E++L+   FY +SGV     D P +  +  +  ++KS  +                
Sbjct: 8   LISYEELLS---FYKESGVDAALNDTPIDRFSQSAILEQKSKQAVDIIHHKQTSQPIKLH 64

Query: 51  QPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDL 110
               +     +     A  +A+ A +L ELKS L +F+ C L  T+ +T  +  T G  L
Sbjct: 65  NKPPHNLDNKTHDTLSAIEMAKNAHTLDELKSALLAFNGCSLKLTAKNTCFSDGTAGSPL 124

Query: 111 MIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIE 170
           M+IG  P   ++I G PF GK G +L+K+L SI + R  ++I+   PW PPGNR  +  E
Sbjct: 125 MLIGEAPGRDEDIQGIPFVGKAGMLLNKILASIGLTRKNVYIANTIPWRPPGNRTPTPRE 184

Query: 171 MEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHS-IIPTL 229
           + +CRP I RQIEL +P++L+ +G     F          +  GKW    + ++  IP +
Sbjct: 185 VALCRPFIERQIELANPRVLIALGGTAAQFLTGAQG-GIIRIRGKWQIYESANNVKIPVM 243

Query: 230 ATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
            T HP  L++ P  KK TW   + +K  L NL
Sbjct: 244 PTFHPAYLLRTPSQKKLTWMDFLEVKDRLNNL 275


>gi|269958378|ref|YP_003328165.1| putative DNA glycosylase [Anaplasma centrale str. Israel]
 gi|269848207|gb|ACZ48851.1| putative DNA glycosylase [Anaplasma centrale str. Israel]
          Length = 289

 Score =  230 bits (587), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 68/261 (26%), Positives = 122/261 (46%), Gaps = 11/261 (4%)

Query: 10  EQILTIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPI--------TNIRHIHS 61
           E++L +  FY ++GV  V +E   EA   +   ++      +                 +
Sbjct: 23  EELLEVLRFYHENGVDCVLEEGGLEARTPAVVSQEQDVGTSRAGRLSEQGADKGESQFST 82

Query: 62  PLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSD 121
             V  A  IA     L EL++ + SF  C +   +++T+ +       +M+IG  P  ++
Sbjct: 83  DWVTAARKIAGGCSDLAELRAAIESFEGCEIKKAAMNTVFSDGNPDARIMLIGEAPGSNE 142

Query: 122 NISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQ 181
           +  G+PF G +G +LDKML +I + R   +IS  + W PPGNR  ++ E+EIC+P + + 
Sbjct: 143 DREGRPFCGASGMLLDKMLAAIGLNRKSTYISNTTFWRPPGNRRPTDFELEICKPFVEKH 202

Query: 182 IELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTL--ATVHPQELIQ 239
           I LI+P IL+ +G+       N   +   +  G++     P    P       HP  L++
Sbjct: 203 IALIAPSILVLVGSTACCALLN-TPESISRLRGRFHEYTNPFLAHPVTTAVIFHPAYLLR 261

Query: 240 YPLIKKNTWHALITLKKALKN 260
            P+ K+  W  L  ++  ++ 
Sbjct: 262 QPMQKRLAWEDLKMIRAYIEQ 282


>gi|260462363|ref|ZP_05810571.1| phage SPO1 DNA polymerase-related protein [Mesorhizobium
           opportunistum WSM2075]
 gi|259031857|gb|EEW33125.1| phage SPO1 DNA polymerase-related protein [Mesorhizobium
           opportunistum WSM2075]
          Length = 298

 Score =  230 bits (587), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 82/292 (28%), Positives = 133/292 (45%), Gaps = 33/292 (11%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVF-DEPNNEATYESQRKEKSIDSAIQPITNIRHI 59
           MT+    S  +I  I  FYA +GV     D P N     + R  +   + +      +  
Sbjct: 8   MTAAPN-SPTEIADILAFYASAGVDEALEDAPVNRFAEAAPRPVERAPAPLPSPREDKTP 66

Query: 60  HSPLVQQ-----------------------------ADSIAQKACSLHELKSLLRSFHDC 90
             P                                 A  +A  A +L EL+  + +F  C
Sbjct: 67  ERPAASSGLDASKVPDAPVRTVSATAAVPDEAQAALARQMATSASTLEELRQHMAAFEGC 126

Query: 91  HLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQI 150
           +L +T+ + + A       +M++G  P   ++I G PF G++G +LD+ML +I + R+ +
Sbjct: 127 NLKATAKNLVFADGNPQAAVMLVGEAPGRDEDIEGLPFVGRSGRLLDRMLAAIGLDRSSV 186

Query: 151 HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTY 210
           +I+ + PW PPGNR  +  E EICRP I RQIEL++PK+L+ +G  +     N  ++   
Sbjct: 187 YIANVIPWRPPGNRTPTPHETEICRPFIERQIELLNPKVLVNLGGPSAKTLLN-TSEGIL 245

Query: 211 QNLGKWSNLCT-PHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
           +  G W    T     IP + T+HP  L++ P  KK  W   + +K  L+ L
Sbjct: 246 RLRGNWRAHTTASGVTIPAMPTLHPAYLLRTPAHKKLAWRDFLEVKAKLRAL 297


>gi|190571317|ref|YP_001975675.1| putative DNA glycosylase [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|190357589|emb|CAQ55030.1| putative DNA glycosylase [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
          Length = 257

 Score =  230 bits (587), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 71/256 (27%), Positives = 130/256 (50%), Gaps = 8/256 (3%)

Query: 7   LSQEQILTIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQ 66
           ++ E +  +  FY + GV     E   E   E++R  +S     +         S  + +
Sbjct: 1   MNNEDL-ELLKFYHEVGVDCTLTEGEEEKKVENERAAQSSVIEQKK----AMFPSDWIIE 55

Query: 67  ADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGK 126
           A  +A +  S+ EL+S ++SF  C +  T+ +T+ +       +M++G  P  ++++ G 
Sbjct: 56  ARKLASECGSVDELRSAVKSFEGCEIKKTATNTVFSDGNPNAKIMLVGEAPGANEDLKGI 115

Query: 127 PFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELIS 186
           PF G +G +LDKML +I + RT+++IS    W PPGNR  +++E+++CRP + + I L+ 
Sbjct: 116 PFCGASGMLLDKMLGAINLDRTKVYISNTVFWRPPGNRKPTDLELDMCRPFVEKHIALVL 175

Query: 187 PKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPH--SIIPTLATVHPQELIQYPLIK 244
           P+IL+F+G        + + +      GK+      +    I T A  HP  L++ P  K
Sbjct: 176 PQILIFVGGIACYSLLD-NTKTISNLRGKFHTYTNQYLSHAITTAAIFHPAYLLRQPAQK 234

Query: 245 KNTWHALITLKKALKN 260
           +  W  L  +++ L N
Sbjct: 235 RLAWEDLKKIREYLDN 250


>gi|110633263|ref|YP_673471.1| phage SPO1 DNA polymerase-related protein [Mesorhizobium sp. BNC1]
 gi|110284247|gb|ABG62306.1| phage SPO1 DNA polymerase-related protein [Chelativorans sp. BNC1]
          Length = 285

 Score =  230 bits (585), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 85/284 (29%), Positives = 133/284 (46%), Gaps = 25/284 (8%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVF-DEPNNEATYESQ---------RKEKSIDSAI 50
           MTS   L    I  +  FY+++G      +E  +                R  +S  +A 
Sbjct: 1   MTSTTPLDFAGIRELLAFYSEAGADEALWEEAQDRFAEAKASAQTFSETVRPAQSDAAAP 60

Query: 51  QPITNIRHIHSPLVQQ-------------ADSIAQKACSLHELKSLLRSFHDCHLCSTSL 97
           QP           +               A  +A++A +L ELK +L  F  C+L  T+ 
Sbjct: 61  QPENRATQPKPAPISAQPAAVPDEAQAAHAREVARQARTLDELKEILAGFEGCNLRLTAK 120

Query: 98  STICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISP 157
           + + A      DLM++G  P   +++ G PF G++G +L++ML +I   R+  +I+ + P
Sbjct: 121 NLVFADGNPQADLMLVGEAPGRDEDLQGLPFVGRSGQLLNRMLAAIGRDRSTAYIANVIP 180

Query: 158 WHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWS 217
           W PPGNR+ S +E EICRP I R IEL++PK+L+ +GN +             +  G WS
Sbjct: 181 WRPPGNRDPSPLETEICRPFIERHIELVAPKLLVTLGNPSTKLLLGTQTGIM-RLRGTWS 239

Query: 218 NLCT-PHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
              T     IPT+ T+HP  L++ P  KK  W   + +K  L N
Sbjct: 240 VHRTAGGLEIPTMPTLHPAYLLRNPAHKKLAWRDFLAVKMRLAN 283


>gi|49475280|ref|YP_033321.1| DNA polymerase [Bartonella henselae str. Houston-1]
 gi|49238086|emb|CAF27293.1| DNA polymerase, bacteriophage type [Bartonella henselae str.
           Houston-1]
          Length = 275

 Score =  230 bits (585), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 88/270 (32%), Positives = 136/270 (50%), Gaps = 19/270 (7%)

Query: 7   LSQEQILTIALFYADSGVYWVF-DEPNNEATYESQRKEKSIDSA-----IQPITNIRHIH 60
           ++ E++L+   FY +SGV     D P +  +  +  ++KS          Q   +I+  +
Sbjct: 9   ITYEELLS---FYKESGVDTALTDLPIDRFSQSASLEKKSTQVVKISHNQQTSPSIKLDN 65

Query: 61  SPLVQQ--------ADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMI 112
            PL           A   A+ A +L ELKS L +F+ C L  T+ +T  +  T G  LM+
Sbjct: 66  HPLSNSTIIQGELSAIESAKNANTLDELKSALLAFNGCSLKLTAKNTCFSDGTAGSPLML 125

Query: 113 IGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEME 172
           IG  P   ++I G PF GK G +L+K+L SI + R  ++I+   PW PPGNR  +  E+ 
Sbjct: 126 IGEAPGREEDIQGIPFVGKAGMLLNKILASIGLTRNSVYIANTIPWRPPGNRTPTPREVA 185

Query: 173 ICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHS-IIPTLAT 231
           +CRP I RQI L +P+IL+ +G      F         +  GKW    + ++  IP + T
Sbjct: 186 LCRPFIERQIYLANPRILIALGGVATQ-FLTGAQNGIIRTRGKWLTYKSENNIKIPVMPT 244

Query: 232 VHPQELIQYPLIKKNTWHALITLKKALKNL 261
            HP  L++ P  KK TW   + +K  L +L
Sbjct: 245 FHPAYLLRTPSQKKLTWLDFLEVKNRLDSL 274


>gi|56417232|ref|YP_154306.1| hypothetical protein AM1237 [Anaplasma marginale str. St. Maries]
 gi|222475596|ref|YP_002564013.1| hypothetical protein AMF_934 [Anaplasma marginale str. Florida]
 gi|56388464|gb|AAV87051.1| hypothetical protein AM1237 [Anaplasma marginale str. St. Maries]
 gi|222419734|gb|ACM49757.1| Conserved hypothetical protein [Anaplasma marginale str. Florida]
          Length = 290

 Score =  229 bits (584), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 69/260 (26%), Positives = 124/260 (47%), Gaps = 11/260 (4%)

Query: 11  QILTIALFYADSGVYWVFDE--------PNNEATYESQRKEKSIDSAIQPITNIRHIHSP 62
           ++L +  FY ++GV  V +E        P      +     +    + Q         + 
Sbjct: 25  ELLEVLKFYHENGVDCVLEEDGPGTCAPPVAALQEQEGCTLQVGSPSEQMDAGASQFSTD 84

Query: 63  LVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDN 122
            V  A SIA K  +L EL+  + +F  C +   +++T+ +       +M+IG  P  +++
Sbjct: 85  WVAAAKSIADKCGTLAELREAVEAFEGCEIKKAAMNTVFSDGNPNAKIMLIGEAPGSNED 144

Query: 123 ISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQI 182
             G+PF G +G +LDKML +I + R   +IS  + W PPGNR  ++ E+EIC+P + + I
Sbjct: 145 REGRPFCGASGMLLDKMLAAIGLDRKSTYISNTTFWRPPGNRRPTDFELEICKPFVEKHI 204

Query: 183 ELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPH--SIIPTLATVHPQELIQY 240
            LI+P IL+ +G+       +   +   +  G++     P     I T    HP  L++ 
Sbjct: 205 ALIAPSILVLVGSTACCSLLS-TPESISRLRGRFHEYANPFLAHPIKTAVIFHPAYLLRQ 263

Query: 241 PLIKKNTWHALITLKKALKN 260
           P+ K+  W  L  ++  ++N
Sbjct: 264 PMQKRLAWEDLKMIRSHIEN 283


>gi|254475928|ref|ZP_05089314.1| uracil-DNA glycosylase [Ruegeria sp. R11]
 gi|214030171|gb|EEB71006.1| uracil-DNA glycosylase [Ruegeria sp. R11]
          Length = 275

 Score =  229 bits (584), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 64/260 (24%), Positives = 114/260 (43%), Gaps = 10/260 (3%)

Query: 3   SKRILSQEQILTIALFYADSGV-YWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHS 61
            +  L       +  +  + G    + D P N    E+++ + +   A  P    + +  
Sbjct: 23  MESALDYHSARALLAWQIELGATDAICDAPVNRYELEARQPKPTARQAEAPPPKPKEV-- 80

Query: 62  PLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSD 121
             V+ A  IA+    L  LK+ L  F  C L   + + + +    G  +M+IG  P   +
Sbjct: 81  DPVEVARDIARGVRDLAGLKAALAQFEHCDLRKGARNLVFSDGKPGARVMVIGEAPGRDE 140

Query: 122 NISGKPFSGKTGNMLDKMLQSIEIMRTQI-HISMISPWHPPGNRNLSNIEMEICRPIIMR 180
           ++ G+PF G+ G +LD+ML +I + R    +I+ + PW PP NR+    E+ +  P + R
Sbjct: 141 DLEGRPFVGRAGQLLDRMLAAIGLSRQDNVYITNVLPWRPPQNRDPLPAEIAMMTPFLER 200

Query: 181 QIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQY 240
            + L +P IL+ +GN + +           +  G W          P +   HP  L++ 
Sbjct: 201 HVALANPDILIAMGNISCDALMGKRG--ITRLRGTWGEAWGK----PVMPMFHPAYLLRQ 254

Query: 241 PLIKKNTWHALITLKKALKN 260
           PL K+  W  L+ +K  L  
Sbjct: 255 PLQKRAAWSDLLDIKSRLDA 274


>gi|254995400|ref|ZP_05277590.1| hypothetical protein AmarM_05693 [Anaplasma marginale str.
           Mississippi]
 gi|255003587|ref|ZP_05278551.1| hypothetical protein AmarPR_05168 [Anaplasma marginale str. Puerto
           Rico]
 gi|255004718|ref|ZP_05279519.1| hypothetical protein AmarV_05513 [Anaplasma marginale str.
           Virginia]
          Length = 279

 Score =  229 bits (584), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 69/260 (26%), Positives = 124/260 (47%), Gaps = 11/260 (4%)

Query: 11  QILTIALFYADSGVYWVFDE--------PNNEATYESQRKEKSIDSAIQPITNIRHIHSP 62
           ++L +  FY ++GV  V +E        P      +     +    + Q         + 
Sbjct: 14  ELLEVLKFYHENGVDCVLEEDGPGTCAPPVAALQEQEGCTLQVGSPSEQMDAGASQFSTD 73

Query: 63  LVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDN 122
            V  A SIA K  +L EL+  + +F  C +   +++T+ +       +M+IG  P  +++
Sbjct: 74  WVAAAKSIADKCGTLAELREAVEAFEGCEIKKAAMNTVFSDGNPNAKIMLIGEAPGSNED 133

Query: 123 ISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQI 182
             G+PF G +G +LDKML +I + R   +IS  + W PPGNR  ++ E+EIC+P + + I
Sbjct: 134 REGRPFCGASGMLLDKMLAAIGLDRKSTYISNTTFWRPPGNRRPTDFELEICKPFVEKHI 193

Query: 183 ELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPH--SIIPTLATVHPQELIQY 240
            LI+P IL+ +G+       +   +   +  G++     P     I T    HP  L++ 
Sbjct: 194 ALIAPSILVLVGSTACCSLLS-TPESISRLRGRFHEYANPFLAHPIKTAVIFHPAYLLRQ 252

Query: 241 PLIKKNTWHALITLKKALKN 260
           P+ K+  W  L  ++  ++N
Sbjct: 253 PMQKRLAWEDLKMIRSHIEN 272


>gi|83591606|ref|YP_425358.1| phage SPO1 DNA polymerase-like protein [Rhodospirillum rubrum ATCC
           11170]
 gi|83574520|gb|ABC21071.1| Phage SPO1 DNA polymerase-related protein [Rhodospirillum rubrum
           ATCC 11170]
          Length = 315

 Score =  228 bits (581), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 73/278 (26%), Positives = 123/278 (44%), Gaps = 28/278 (10%)

Query: 11  QILTIALFYADSGVY-WVFDEPNNEATYESQRK-----------------EKSIDSAIQP 52
            +  +  +Y ++GV   V D P +      +                     +  +   P
Sbjct: 35  DLAGLLGWYLEAGVDLAVGDSPLDRYALSERAPVPRVAPPAARPPTPAASRPTGRTPGGP 94

Query: 53  ------ITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTE 106
                   +     +   + A  +A +A SL +L++ L SF  C L  T+  T+ A    
Sbjct: 95  RIEDGGPNDEPPTQAESQRAASFLAAQAGSLEDLRTALDSFRSCALRRTATQTVFADGCP 154

Query: 107 GQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRN 165
              +MIIG  P   ++  G+PF G +G +LD ML SI + R    +I+ + PW PPGNR 
Sbjct: 155 QSGMMIIGEAPGADEDRLGRPFVGVSGKLLDAMLGSIGLDRADSCYITNVVPWRPPGNRK 214

Query: 166 LSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPH-- 223
            +  E+ +C P + R I L+ P+++L +G       F   ++   +  G W +   P   
Sbjct: 215 PTADEVALCLPFLERHIALVRPRLILAVGGLAAQALFG-RSEGITRLRGHWHDYEGPGLD 273

Query: 224 SIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
             +P LAT HP  L++ P  K+  W  L+ L++ L +L
Sbjct: 274 RSVPVLATFHPAYLLRTPAQKRLAWRDLLALRQRLDSL 311


>gi|319784543|ref|YP_004144019.1| phage SPO1 DNA polymerase-related protein [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317170431|gb|ADV13969.1| phage SPO1 DNA polymerase-related protein [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 296

 Score =  228 bits (581), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 83/293 (28%), Positives = 134/293 (45%), Gaps = 33/293 (11%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVFDE-PNNEATYESQRKEKSIDSAIQPITNIRHI 59
           MT+    ++  I  +  FYA  GV    +E P N     + +  +    A         +
Sbjct: 4   MTAASPTNRPDIADLLAFYASVGVDEALEEQPVNRFAEVAPKPMERAPIAAPSGGTAAPL 63

Query: 60  HSPLV--------QQADSIAQK----------------------ACSLHELKSLLRSFHD 89
            S  V          A  +A+                       A +L EL+  + +F  
Sbjct: 64  RSTTVSRGEAGDRANAPPVARSPSATTAVPDEAQAALARQLATTATTLDELRQHMAAFEG 123

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C+L +T+ + + A       +M++G  P   ++I G PF G++G +LD+ML +I + RT 
Sbjct: 124 CNLKATAKNLVFADGNPEAAVMLVGEAPGRDEDIEGLPFVGRSGRLLDRMLAAIGLDRTS 183

Query: 150 IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKT 209
            +I+ + PW PPGNR  +  E EICRP I RQIEL++PK+L+ +G  +     N  ++  
Sbjct: 184 AYIANVIPWRPPGNRTPTPHETEICRPFIERQIELVNPKVLINLGGPSAKTLLN-TSEGI 242

Query: 210 YQNLGKWSNLCTPHSI-IPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
            +  G W    T   I IP + T+HP  L++ P  KK  W   + +K  L+ L
Sbjct: 243 LRLRGNWRVHTTASGIAIPAMPTLHPAYLLRTPSHKKLAWRDFLEVKAKLRAL 295


>gi|92118685|ref|YP_578414.1| phage SPO1 DNA polymerase-related protein [Nitrobacter hamburgensis
           X14]
 gi|91801579|gb|ABE63954.1| phage SPO1 DNA polymerase-related protein [Nitrobacter hamburgensis
           X14]
          Length = 289

 Score =  228 bits (581), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 79/285 (27%), Positives = 129/285 (45%), Gaps = 28/285 (9%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVF-DEPNNEATYE--------------------- 38
           MTS    +  +++    FY ++GV     D P +  +                       
Sbjct: 1   MTSDHAPTVRELMA---FYLEAGVDCALGDGPVDRLSAPDLAAPDLAAPDRPVVAPAGTG 57

Query: 39  --SQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTS 96
                K         P   I       ++ A   A+ A SL  L++LL +F  C L  T+
Sbjct: 58  PVPAGKPPDRAVTAAPRVGIAPPPEIAIESAREAARTAPSLEALRTLLDTFDGCALKFTA 117

Query: 97  LSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMIS 156
              + A       LM +G  P   ++I G PF G++G +L++M+ +I + R+ ++I+ + 
Sbjct: 118 SRLVFADGNPHARLMFVGEAPGRDEDIEGLPFVGRSGQLLNRMIAAIGLTRSDVYIANVI 177

Query: 157 PWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKW 216
           PW PPGNR  +  E +IC P I RQIEL++P +L+ +GN +         +   +  GKW
Sbjct: 178 PWRPPGNRTPTPQETQICLPFIRRQIELVNPDVLVTLGNPSTQTLL-PTREGIMKTRGKW 236

Query: 217 SNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
            +  T    I  +AT HP  L++ P  K+  W  L  + KALK++
Sbjct: 237 FDYDTDTRTIRAMATFHPAYLLRSPSSKRMAWLDLRAIAKALKDM 281


>gi|182678993|ref|YP_001833139.1| phage SPO1 DNA polymerase-related protein [Beijerinckia indica
           subsp. indica ATCC 9039]
 gi|182634876|gb|ACB95650.1| phage SPO1 DNA polymerase-related protein [Beijerinckia indica
           subsp. indica ATCC 9039]
          Length = 290

 Score =  227 bits (579), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 77/281 (27%), Positives = 124/281 (44%), Gaps = 31/281 (11%)

Query: 10  EQILTIALFYADSGVYWVFDE-PNNEATYESQRKEKSIDSAIQPITNIRH---------- 58
           + +  +  +YA  GV    DE P++     +    +   S  Q     R           
Sbjct: 3   DSLTALLRWYAAMGVDIALDEAPHDRFAESAAMASRRAPSVPQDDRQARADHPPPSSVSP 62

Query: 59  -------------------IHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLST 99
                                  L Q A+  A  A +L EL+  L +F  C L +T+   
Sbjct: 63  SRQQAPAPRQLPGFAQEALSQEALSQNAEEAAASAKTLDELREKLDAFQGCGLKNTATQL 122

Query: 100 ICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWH 159
           + A       +MIIG  P   ++  G+PF G+ G +LD+ML ++++ RTQ++I+ I PW 
Sbjct: 123 VFADGNPNSSVMIIGEAPGADEDRQGRPFVGRAGQLLDRMLAAVDLDRTQVYIANIVPWR 182

Query: 160 PPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNL 219
           PPGNR  + +E+  C P I RQIEL+SP+ ++ +G  +         +   +  G+W + 
Sbjct: 183 PPGNRTPTPLEIAACLPFIRRQIELVSPRFIVCLGAPSAQTLLGTK-EAITRLRGRWRDW 241

Query: 220 CTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
                 I  L  +HP  L++ P  KK  W     L KAL++
Sbjct: 242 SCGGKTIHVLPMLHPAYLLRQPAEKKRAWADWRLLAKALRD 282


>gi|146339065|ref|YP_001204113.1| putative DNA polymerases [Bradyrhizobium sp. ORS278]
 gi|146191871|emb|CAL75876.1| putative DNA polymerases [Bradyrhizobium sp. ORS278]
          Length = 273

 Score =  227 bits (578), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 76/275 (27%), Positives = 122/275 (44%), Gaps = 20/275 (7%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVF-DEPNNEATYESQRK---------------EK 44
           M  + +    Q+L    FY ++GV     D+P N                          
Sbjct: 2   MNPEPLPDVRQLLA---FYLEAGVDCALADDPINRLVEPDAAPAPVAAAARQAAPQPGRS 58

Query: 45  SIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQ 104
              + I P           +  A   A+ A +L  L+ LL +F  C L  T+   + A  
Sbjct: 59  PAPAIISPRGEPPPAPDAAIASARESARTAPTLQALRELLETFDGCALKQTASRLVFADG 118

Query: 105 TEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNR 164
                +M++G  P   ++I G PF G++G +LD+M+ +I + RT+++I+ + PW PPGNR
Sbjct: 119 NPEARVMLVGEAPGRDEDIEGLPFVGRSGKLLDRMIGAIGLDRTKVYIANVIPWRPPGNR 178

Query: 165 NLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHS 224
             +  E +IC P I RQIEL+ P +L+ +GN +             +  GKW +  T   
Sbjct: 179 TPTPQETQICLPFIRRQIELVDPDVLVTLGNPSTQALLGTTEGIM-RTRGKWRDYDTGKR 237

Query: 225 IIPTLATVHPQELIQYPLIKKNTWHALITLKKALK 259
            I  +AT HP  L++ P  K+ +W  L  +   L 
Sbjct: 238 TIRAIATFHPAYLLRSPSYKRLSWQDLRAIATVLA 272


>gi|58584375|ref|YP_197948.1| Uracil-DNA glycosylase [Wolbachia endosymbiont strain TRS of Brugia
           malayi]
 gi|58418691|gb|AAW70706.1| Uracil-DNA glycosylase [Wolbachia endosymbiont strain TRS of Brugia
           malayi]
          Length = 266

 Score =  226 bits (576), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 71/259 (27%), Positives = 131/259 (50%), Gaps = 8/259 (3%)

Query: 9   QEQILTIALFYADSGVYWVFDEPNNEATYES-----QRKEKSIDSAIQPITNIRHIHSPL 63
           +++ L +  FY + G+     E N E   E        +  +I + +Q         S  
Sbjct: 2   RDEDLELLKFYYEVGIDCTLTEGNEEKKVEKEKNSKAIQSPTIQAEVQKKEQQSMFPSDW 61

Query: 64  VQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNI 123
           + +A  +A K  S+ EL+S ++SF  C +  TS +T+ +   +   +M++G  P  ++++
Sbjct: 62  IIEARKLASKCNSMDELRSAVKSFEGCEIKKTSTNTVFSDGNQSAKIMLVGEAPGANEDL 121

Query: 124 SGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIE 183
            G PF G +G +LDKML +I + RT+++IS    W PPGNR  +++E+++CRP + + I 
Sbjct: 122 KGIPFCGASGMLLDKMLSAINLDRTKVYISNTVFWRPPGNRKPTDLELDMCRPFVEKHIA 181

Query: 184 LISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHS--IIPTLATVHPQELIQYP 241
           LISP IL+ +G  +     + + +      G++      +    I T    HP  L++ P
Sbjct: 182 LISPHILILVGGISCYSLLD-NTKTISTLRGRFHTYTNQYLSYSITTAVIFHPAYLLRQP 240

Query: 242 LIKKNTWHALITLKKALKN 260
             K+  W  L  +++ L +
Sbjct: 241 AQKRLAWEDLKKIREYLNS 259


>gi|58698049|ref|ZP_00372973.1| phage SPO1 DNA polymerase domain protein [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|225629945|ref|YP_002726736.1| uracil-DNA glycosylase-like protein [Wolbachia sp. wRi]
 gi|58535406|gb|EAL59481.1| phage SPO1 DNA polymerase domain protein [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|225591926|gb|ACN94945.1| uracil-DNA glycosylase-like protein [Wolbachia sp. wRi]
          Length = 270

 Score =  225 bits (574), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 71/265 (26%), Positives = 128/265 (48%), Gaps = 13/265 (4%)

Query: 7   LSQEQILTIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIR--------- 57
           +S E +  +  FY + GV     E   E   ES+          +   + R         
Sbjct: 1   MSNEDL-ELLKFYHEVGVDCTLMEGEEEKKLESKEPSVIQTGTQKKDADTRWGDTKDGKD 59

Query: 58  HIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTP 117
              S  + +A  +A K  S+ EL+S ++SF  C +  T+ +T+ +       +M++G  P
Sbjct: 60  MFPSDWIIEARKLAGKCGSVDELRSAVKSFEGCEIKKTATNTVFSDGNPNAKIMLVGEAP 119

Query: 118 SDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPI 177
             ++++ G PF G +G +LDKML +I + RT+++IS    W PPGNR  +++E+++CRP 
Sbjct: 120 GANEDLQGIPFCGASGMLLDKMLNAINLDRTKVYISNTVFWRPPGNRKPTDLELDMCRPF 179

Query: 178 IMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPH--SIIPTLATVHPQ 235
           + + I L+SP+IL+ +G        ++         G++      +  + I T A  HP 
Sbjct: 180 VEKHIALVSPQILILVGGIACYSLLDSTK-TISNLRGRFHTYTNQYLSNSITTAAIFHPA 238

Query: 236 ELIQYPLIKKNTWHALITLKKALKN 260
            L++ P  K+  W     +++ L N
Sbjct: 239 YLLRQPAQKRLAWEDSKKIREYLDN 263


>gi|75676780|ref|YP_319201.1| phage SPO1 DNA polymerase-related protein [Nitrobacter winogradskyi
           Nb-255]
 gi|74421650|gb|ABA05849.1| phage SPO1 DNA polymerase-related protein [Nitrobacter winogradskyi
           Nb-255]
          Length = 301

 Score =  225 bits (572), Expect = 7e-57,   Method: Composition-based stats.
 Identities = 79/294 (26%), Positives = 123/294 (41%), Gaps = 38/294 (12%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVF-DEPNNEATYESQRKEKSIDSAIQPITNIRHI 59
           MTS    +  ++L    FY ++GV     DEP +  +             I         
Sbjct: 1   MTSDHSTTVRELLA---FYLEAGVDCALGDEPVDRLSTPDLAPPDLAPPNIATPALAPGR 57

Query: 60  HSPLVQQADSIAQK---------------------------------ACSLHELKSLLRS 86
                  A  IA                                   A SL  L++LL  
Sbjct: 58  PIAAKTGAAPIAATRQPSRQTATAPPRAGIAPPPDVAAEHAREAARTAPSLEALRALLEG 117

Query: 87  FHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIM 146
           F  C L  T+   + A       LM +G  P   ++I G PF G++G +L++M+ +I + 
Sbjct: 118 FEGCALKFTASRLVFADGNPQARLMFVGEAPGRDEDIEGLPFVGRSGQLLNRMIAAIGLK 177

Query: 147 RTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDA 206
           R  ++I+ + PW PPGNR  +  E +IC P I RQIEL++P +L+ +GN +         
Sbjct: 178 RGDVYIANVIPWRPPGNRTPTPQETQICLPFIRRQIELVNPDVLVTLGNPSTQTLLQTRE 237

Query: 207 QKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
               +  G+W +  T    I  +AT HP  L++ P  K+  WH L  + KAL++
Sbjct: 238 GIM-KTRGRWFDYDTGARTIRAMATFHPAYLLRSPSYKRMAWHDLRAIAKALED 290


>gi|163759107|ref|ZP_02166193.1| phage SPO1 DNA polymerase-related protein [Hoeflea phototrophica
           DFL-43]
 gi|162283511|gb|EDQ33796.1| phage SPO1 DNA polymerase-related protein [Hoeflea phototrophica
           DFL-43]
          Length = 313

 Score =  225 bits (572), Expect = 7e-57,   Method: Composition-based stats.
 Identities = 75/307 (24%), Positives = 133/307 (43%), Gaps = 50/307 (16%)

Query: 4   KRILSQEQILTIALFYADSGVYWVFDE--------------------------PNNEATY 37
              +  + +  +  FYA+SGV  V +E                          P     +
Sbjct: 5   ASDIPPQALAALLGFYAESGVDGVCEEVAIDRFAQSAEMAQSRKQNASRNTQAPVTAGAF 64

Query: 38  ESQRKEKSIDSAIQPIT-----------------------NIRHIHSPLVQQADSIAQKA 74
             Q +  S     +P                          +      + + A ++A+ A
Sbjct: 65  GEQSRSASDGPGSRPSPAMAAQRAPAASGASAGTTPAQASQLTVPGEAVFKDARALAESA 124

Query: 75  CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
            ++ EL++ L  F  C+L  ++ S + A      ++M IG  P   +++ G PF G+ G 
Sbjct: 125 STIDELRAALEGFGGCNLRHSAKSLVFADGNPEAEVMFIGEAPGREEDLQGTPFVGRAGQ 184

Query: 135 MLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           +LD+ML +I + R   +I+ + PW PPGNR  +  E+E+CRP I R + L +PKI++ +G
Sbjct: 185 LLDRMLAAIGLNRQTAYITNMIPWRPPGNRTPAPHEIELCRPFIERHVTLAAPKIVVMLG 244

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITL 254
           N       N D        G W    +  + IP + T+HP  L++ P  K+  W  L++L
Sbjct: 245 NVATKSLLNTDKGILS-LRGDWMEYTSGTTSIPAMPTLHPAYLLRNPAQKRLVWADLLSL 303

Query: 255 KKALKNL 261
           ++ L+++
Sbjct: 304 QQRLEDM 310


>gi|58616770|ref|YP_195969.1| hypothetical protein ERGA_CDS_00430 [Ehrlichia ruminantium str.
           Gardel]
 gi|58416382|emb|CAI27495.1| Conserved hypothetical protein [Ehrlichia ruminantium str. Gardel]
          Length = 263

 Score =  225 bits (572), Expect = 8e-57,   Method: Composition-based stats.
 Identities = 63/265 (23%), Positives = 124/265 (46%), Gaps = 12/265 (4%)

Query: 7   LSQEQILTIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQ 66
           +S   +L    F+ ++GV  + +   N+ +  +Q    ++      +       S L + 
Sbjct: 1   MSDSDLLEALKFFYENGVDCILETE-NQVSISNQDTYLNLKGGNNDVEEYNMERSSLKED 59

Query: 67  ADS--------IAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPS 118
           A++         A++  +L EL+S +  F  C + + + +T+ +       +M+IG  P 
Sbjct: 60  AEAYYLLKAQSAAEQCSTLEELRSAIEYFDGCDIKNLATNTVFSDGNPNAKMMLIGEAPG 119

Query: 119 DSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPII 178
            +++I G PF G +G +L+KML++I   R  ++IS    W PPGNR  ++ E+ +CRP +
Sbjct: 120 ANEDIHGIPFCGNSGMLLNKMLEAIGFNRNTVYISNSVFWRPPGNRRPTDFEIAVCRPFV 179

Query: 179 MRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPH--SIIPTLATVHPQE 236
            + I L+ PK+L+ +G+       ++      +  G++           I T    HP  
Sbjct: 180 EKHIALVMPKMLVLVGSTACYAILDSK-NPISKLRGRFHMYNNRFLQHSITTGIIFHPSY 238

Query: 237 LIQYPLIKKNTWHALITLKKALKNL 261
           L++ P+ K+  W  L  ++     L
Sbjct: 239 LLRQPMQKRIAWEDLKQIRDCFNTL 263


>gi|288962809|ref|YP_003453103.1| DNA polymerase bacteriophage-type [Azospirillum sp. B510]
 gi|288915075|dbj|BAI76559.1| DNA polymerase bacteriophage-type [Azospirillum sp. B510]
          Length = 285

 Score =  224 bits (571), Expect = 8e-57,   Method: Composition-based stats.
 Identities = 74/283 (26%), Positives = 132/283 (46%), Gaps = 28/283 (9%)

Query: 6   ILSQEQILTIALFYADSGVYWVF-DEPNNEATYESQRKEKSIDSAIQ------------- 51
           ++    IL    ++ D G      DEP + A   S+   ++    +              
Sbjct: 1   MIDVCDILDALRWHTDIGCDEAIGDEPTDWAALASRPATRAPSPGVAPAAGAAIARAPAA 60

Query: 52  -------------PITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLS 98
                           +     S    QA + A +A +L  L++ LRSF  C L +T+++
Sbjct: 61  TRPPASARPAAPFASPDQPLGASEAGIQARARAGEAGTLEALEAALRSFDGCPLKATAMN 120

Query: 99  TICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPW 158
           T+ A       +M+IG  P + ++  GKPF G +G +LD+ML  I + R  ++IS I PW
Sbjct: 121 TVFADGNPQAPVMLIGEAPGEDEDRQGKPFVGVSGKLLDRMLAQIGLDRGTVYISNILPW 180

Query: 159 HPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSN 218
            PPGNR+ +  E+  C P + R +EL+ PK+L+ +G  +     N  A+   +  G+W +
Sbjct: 181 RPPGNRSPTQAEVAACLPFLERHVELVRPKLLVALGGVSAKTLLN-RAEGITRLRGQWRS 239

Query: 219 LCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
                + IP +  +HP  L++ P+ K+  W  ++ L++ +  +
Sbjct: 240 YEAAGTPIPLMPMLHPAYLLRNPIAKREAWRDMLALRQKIDEV 282


>gi|304393614|ref|ZP_07375542.1| DNA polymerase [Ahrensia sp. R2A130]
 gi|303294621|gb|EFL88993.1| DNA polymerase [Ahrensia sp. R2A130]
          Length = 293

 Score =  224 bits (571), Expect = 9e-57,   Method: Composition-based stats.
 Identities = 77/282 (27%), Positives = 123/282 (43%), Gaps = 37/282 (13%)

Query: 14  TIALFYADSGVYWVF-DEPNNE------------------ATYESQRKEKSIDSAIQPIT 54
            +  +YA++GV     DEP +                    T E Q ++  +      + 
Sbjct: 9   ELLEWYAEAGVDIALADEPVDRFAEAAQAFEAVKNKKAVSKTDERQTQQAPVADQQSNLR 68

Query: 55  NIRHIHS-----------------PLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSL 97
           +     +                   V+QA  +A KA +L EL+  +R F  C+L   + 
Sbjct: 69  DQSRTKAATPPPAAAPARPTIPDGAAVEQAKQLASKATTLDELRDAIRGFEGCNLRYQAK 128

Query: 98  STICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISP 157
             + A       +M+IG  P   ++  G PF GK+G +LD+ML +I + R  ++IS + P
Sbjct: 129 QMVFADGNPEASVMLIGEAPGRDEDAQGLPFVGKSGQLLDRMLAAIGLDRKSVYISNVIP 188

Query: 158 WHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWS 217
           W P GNR  +  E+EICRP I R IEL +PK+L+ +G  +                G+W 
Sbjct: 189 WRPAGNRTPTPAEIEICRPFIERHIELAAPKLLVLVGGSSAKAML-RTTDGITSVRGRWK 247

Query: 218 NLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALK 259
           ++       P L   HP  L++ P  K+  W  L+ LK  L+
Sbjct: 248 DVKIGEREWPALPMFHPAYLLRNPAQKRRAWQDLLMLKARLE 289


>gi|42520066|ref|NP_965981.1| phage SPO1 DNA polymerase-related protein [Wolbachia endosymbiont
           of Drosophila melanogaster]
 gi|42409803|gb|AAS13915.1| phage SPO1 DNA polymerase-related protein [Wolbachia endosymbiont
           of Drosophila melanogaster]
          Length = 273

 Score =  224 bits (570), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 69/268 (25%), Positives = 125/268 (46%), Gaps = 16/268 (5%)

Query: 7   LSQEQILTIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIH------ 60
           +S + +  +  FY + GV     E   E   ES+   +                      
Sbjct: 1   MSNKDL-ELLKFYHEVGVDCTLTEGEEEKKLESKESVQPSVIQTGTKKKDADTRWGDTKD 59

Query: 61  ------SPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIG 114
                 S  + +A  +A K  S+ EL+S + SF  C +  T+ +T+ +       +M++G
Sbjct: 60  GKDMFPSDWIIEARKLASKCNSVDELRSAVESFEGCEIKKTATNTVFSDGNPNAKVMLVG 119

Query: 115 YTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEIC 174
             P  ++++ G PF G +G +LDKML +I + RT+++IS    W PPGNR  +++E+++C
Sbjct: 120 EAPGANEDLQGIPFCGASGMLLDKMLNAINLDRTKVYISNTVFWRPPGNRKPTDLELDMC 179

Query: 175 RPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPH--SIIPTLATV 232
           RP + + + L SP+IL+ +G        ++         G++      +  + I T A  
Sbjct: 180 RPFVEKHVALASPQILILVGGIACYSLLDSTK-TISNLRGRFHTYTNQYLSNSITTAAIF 238

Query: 233 HPQELIQYPLIKKNTWHALITLKKALKN 260
           HP  L++ P  K+  W  L  +++ L N
Sbjct: 239 HPAYLLRQPAQKRLAWEDLKKIREYLDN 266


>gi|99034822|ref|ZP_01314738.1| hypothetical protein Wendoof_01000436 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
          Length = 273

 Score =  224 bits (570), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 69/268 (25%), Positives = 126/268 (47%), Gaps = 16/268 (5%)

Query: 7   LSQEQILTIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIH------ 60
           +S + +  +  FY + GV     E   E   ES+   +                      
Sbjct: 1   MSNKDL-ELLKFYHEVGVDCTLTEGEEEKKLESKESVQPSVIQTGTKKKDADTRWGDTKD 59

Query: 61  ------SPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIG 114
                 S  + +A  +A K  S+ EL+S + SF  C +  T+ +T+ +       +M++G
Sbjct: 60  GKDMFPSDWIIEARKLASKCNSVDELRSAVESFEGCEIKKTATNTVFSDGNPNAKVMLVG 119

Query: 115 YTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEIC 174
             P  ++++ G PF G +G +LDKML +I + RT+++IS    W PPGNR  +++E+++C
Sbjct: 120 EAPGANEDLQGIPFCGASGMLLDKMLNAINLDRTKVYISNTVFWRPPGNRKPTDLELDMC 179

Query: 175 RPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPH--SIIPTLATV 232
           RP + + + L+SP+IL+ +G        ++         G++      +  + I T A  
Sbjct: 180 RPFVEKHVALVSPQILILVGGIACYSLLDSTK-TISNLRGRFHTYTNQYLSNSITTAAIF 238

Query: 233 HPQELIQYPLIKKNTWHALITLKKALKN 260
           HP  L++ P  K+  W  L  +++ L N
Sbjct: 239 HPAYLLRQPAQKRLAWEDLKKIREYLDN 266


>gi|57238783|ref|YP_179919.1| hypothetical protein Erum0530 [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58578708|ref|YP_196920.1| hypothetical protein ERWE_CDS_00440 [Ehrlichia ruminantium str.
           Welgevonden]
 gi|57160862|emb|CAH57764.1| putative uracil DNA glycosylase [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58417334|emb|CAI26538.1| Conserved hypothetical protein [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 263

 Score =  224 bits (570), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 63/265 (23%), Positives = 124/265 (46%), Gaps = 12/265 (4%)

Query: 7   LSQEQILTIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQ 66
           +S   +L    F+ ++GV  + +   N+ +  +Q    ++      +       S L + 
Sbjct: 1   MSDSDLLEALKFFYENGVDCILETE-NQVSISNQDTYLNLKGGNNDVEEYNMERSSLKED 59

Query: 67  ADS--------IAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPS 118
           A++         A++  +L EL+S +  F  C + + + +T+ +       +M+IG  P 
Sbjct: 60  AEAYYLLKAQSAAEQCSTLEELRSAIEYFDGCDIKNLATNTVFSDGNPNAKMMLIGEAPG 119

Query: 119 DSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPII 178
            +++I G PF G +G +L+KML++I   R  ++IS    W PPGNR  ++ E+ +CRP +
Sbjct: 120 ANEDIHGIPFCGTSGMLLNKMLEAIGFNRNTVYISNSVFWRPPGNRRPTDFEIAVCRPFV 179

Query: 179 MRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPH--SIIPTLATVHPQE 236
            + I L+ PK+L+ +G+       ++      +  G++           I T    HP  
Sbjct: 180 EKHIALVMPKMLVLVGSTACYAILDSK-NPISKLRGRFHMYNNRFLQHSITTGIIFHPSY 238

Query: 237 LIQYPLIKKNTWHALITLKKALKNL 261
           L++ P+ K+  W  L  ++     L
Sbjct: 239 LLRQPMQKRIAWEDLKQIRDCFNTL 263


>gi|39934111|ref|NP_946387.1| phage SPO1 DNA polymerase-like protein [Rhodopseudomonas palustris
           CGA009]
 gi|39647959|emb|CAE26479.1| possible phage DNA polymerases [Rhodopseudomonas palustris CGA009]
          Length = 276

 Score =  224 bits (570), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 76/269 (28%), Positives = 120/269 (44%), Gaps = 21/269 (7%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVF-DEPNNEATYESQR--------------KEKS 45
           MT     S  Q+L    FY D+GV     ++P N    ++                K   
Sbjct: 1   MTPDPAPSLRQLLA---FYLDAGVDCALAEDPINRMLDDAPEPAAREAAPEPRPIVKPAL 57

Query: 46  IDSAIQPITNIRHIHSP--LVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICAT 103
                 P+       SP   +  A   A  A +L  L+ L++ F  C L +T+   + A 
Sbjct: 58  HAKPPPPLAFGAPPASPDAAIISAREAAATAPTLEALRELMQRFDGCALRATATQLVFAD 117

Query: 104 QTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGN 163
                 ++ +G  P   ++I G PF G++G +LD ML +I + R  ++I+ + PW PPGN
Sbjct: 118 GNPQAKVVFVGEAPGRDEDIEGLPFVGRSGKLLDLMLAAIGLNRGNVYIANVIPWRPPGN 177

Query: 164 RNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPH 223
           R  +  E +IC P I RQIEL++P +L+ +GN +             +  G+W +  T  
Sbjct: 178 RTPTPQETQICLPFIRRQIELVNPDLLVTLGNPSTQALLGTRDGIM-RTRGRWFDYDTGT 236

Query: 224 SIIPTLATVHPQELIQYPLIKKNTWHALI 252
             I  L T+HP  L++ P  K+  W  L 
Sbjct: 237 RTIRALPTLHPAYLLRQPTYKRLAWQDLR 265


>gi|148253838|ref|YP_001238423.1| putative DNA polymerase [Bradyrhizobium sp. BTAi1]
 gi|146406011|gb|ABQ34517.1| putative DNA polymerase [Bradyrhizobium sp. BTAi1]
          Length = 274

 Score =  224 bits (570), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 76/276 (27%), Positives = 123/276 (44%), Gaps = 21/276 (7%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVF-DEPNNEATYESQRK----------------E 43
           M  + +    Q+L    FY ++GV     DEP N                          
Sbjct: 2   MIPEPLPDVRQLLA---FYLETGVDCALADEPINRLVEPEAAPAPAAAVARPAAASPAGR 58

Query: 44  KSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICAT 103
               + I P           +  A   A  A +L  L+ LL +F  C L  T+   + A 
Sbjct: 59  LPAPAIIPPRGEPPPPPEAAIASAREAALTAPTLEALRELLENFDGCALKQTATRLVFAD 118

Query: 104 QTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGN 163
                 +M++G  P   ++I G PF G++G +LD+M+ +I + R++++I+ + PW PPGN
Sbjct: 119 GNPQARIMLVGEAPGRDEDIEGLPFVGRSGKLLDRMIGAIGLDRSKVYIANVIPWRPPGN 178

Query: 164 RNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPH 223
           R  +  E +IC P I RQIEL+ P +L+ +GN +             ++ GKW +  T  
Sbjct: 179 RTPTPQETQICLPFIRRQIELVDPDVLVTLGNPSTQAILGTTEGIM-RSRGKWRDYDTGK 237

Query: 224 SIIPTLATVHPQELIQYPLIKKNTWHALITLKKALK 259
             I  +AT HP  L++ P  K+ +W  L  + K + 
Sbjct: 238 RTIRAIATFHPAYLLRSPSYKRLSWQDLRAIAKVMA 273


>gi|163732348|ref|ZP_02139794.1| uracil-DNA glycosylase, C-terminal [Roseobacter litoralis Och 149]
 gi|161394646|gb|EDQ18969.1| uracil-DNA glycosylase, C-terminal [Roseobacter litoralis Och 149]
          Length = 261

 Score =  223 bits (569), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 66/267 (24%), Positives = 121/267 (45%), Gaps = 14/267 (5%)

Query: 1   MTSKRILSQEQILTIALFYADSGV-YWVFDEPNNEATYE--SQRKEKSIDSAIQPITNIR 57
           M  +        L +  +  + G    + + P N       ++ ++K   + + P     
Sbjct: 1   MAMESS-DFHHALALLDWQIELGATEAIGETPVNRYELPDKAKVQKKPGSAVMTPGAATV 59

Query: 58  HIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTP 117
                 V+ A   A  A  L +L++ L +F  C L   + + + +    G  +MIIG  P
Sbjct: 60  AEKIDGVEAARKAALGAQDLEQLRAALAAFDHCDLKRGARNLVFSDGVAGAKVMIIGEAP 119

Query: 118 SDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ----IHISMISPWHPPGNRNLSNIEMEI 173
              +++ G+PF G+ G +LD+ML +I++ R      ++I+ + PW PP NR+ S+ E+ +
Sbjct: 120 GREEDMQGRPFVGRAGQLLDRMLAAIDMGREHQSDPVYITNVLPWRPPQNRDPSSEEIAM 179

Query: 174 CRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVH 233
            RP + R I L  P++L+ +GN +             +  G W         +P L   H
Sbjct: 180 MRPFVERHIALAKPQVLVIMGNISAQTLLGKRG--ITRLRGHWVEAF----GVPALPMFH 233

Query: 234 PQELIQYPLIKKNTWHALITLKKALKN 260
           P  L++ P  K+  W  L++L+  L+N
Sbjct: 234 PAYLLRTPTAKREAWADLLSLQARLQN 260


>gi|254511671|ref|ZP_05123738.1| uracil-DNA glycosylase [Rhodobacteraceae bacterium KLH11]
 gi|221535382|gb|EEE38370.1| uracil-DNA glycosylase [Rhodobacteraceae bacterium KLH11]
          Length = 257

 Score =  223 bits (567), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 63/261 (24%), Positives = 114/261 (43%), Gaps = 9/261 (3%)

Query: 3   SKRILSQEQILTIALFYADSGV-YWVFDEPNNEATYESQRKEKS-IDSAIQPITNIRHIH 60
            +  L       +  +  + G    + D P +      +  +     +    I +     
Sbjct: 1   MESALDPHTARALLEWQIELGATDAIGDAPIDRYALPDKAPKAPKAKTVATAIPSKTPEP 60

Query: 61  SPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDS 120
                 A  +A+ A SL  L++ + +F  C L   +   + A  T G  +MIIG  P   
Sbjct: 61  VDAAAIAQQVAKSAGSLPALQAAMDAFEHCDLKRGARQLVFADGTPGARVMIIGEAPGRD 120

Query: 121 DNISGKPFSGKTGNMLDKMLQSIEIMRTQI-HISMISPWHPPGNRNLSNIEMEICRPIIM 179
           ++  GKPF G+ G +LD+ML +I++ R Q  +I+ + PW PP NR+    E+ + +P + 
Sbjct: 121 EDREGKPFVGRAGQLLDRMLAAIDLDRKQNVYITNVLPWRPPQNRDPKPEEIGMMKPFLE 180

Query: 180 RQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ 239
           R + L  P++L+ +GN +             +  G+W         +P +   HP  L++
Sbjct: 181 RHVALAQPEVLVVMGNISCQAVLGKRG--ITRLRGRW----DQALNLPVIPMFHPAYLLR 234

Query: 240 YPLIKKNTWHALITLKKALKN 260
            P +K+  W  L+ LK  L+ 
Sbjct: 235 QPQMKRQAWADLLELKSRLEA 255


>gi|225677066|ref|ZP_03788071.1| uracil-DNA glycosylase-like protein [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
 gi|225590888|gb|EEH12110.1| uracil-DNA glycosylase-like protein [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
          Length = 273

 Score =  222 bits (565), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 70/268 (26%), Positives = 133/268 (49%), Gaps = 16/268 (5%)

Query: 7   LSQEQILTIALFYADSGVYWVFDEPNNEATYESQ---RKEKSIDSAIQPITNIR------ 57
           +S + +  +  FY + GV     E   E   ES+   +         +   ++R      
Sbjct: 1   MSNKDL-ELLKFYHEVGVDCTLMEGEEEKKLESKESVQPSVIQTGTKKKDADMRWDDTKD 59

Query: 58  ---HIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIG 114
                 S  + +A  +A K  S+ EL+S+++SF  C +  T+ +T+ +       +M++G
Sbjct: 60  GKDMFPSDWIIEARKLASKCNSVDELRSVVKSFEGCEIKKTATNTVFSDGNPNAKVMLVG 119

Query: 115 YTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEIC 174
             P  ++++ G PF G +G +LDKML +I + RT+++IS    W PPGNR  +++E+++C
Sbjct: 120 EAPGANEDLQGIPFCGASGMLLDKMLNAINLDRTKVYISNTVFWRPPGNRKPTDLELDMC 179

Query: 175 RPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPH--SIIPTLATV 232
           RP + + + L+SP+IL+ +G        ++  +      G++      +  + I T A  
Sbjct: 180 RPFVEKHVALVSPQILILVGGIACYSLLDST-ETISNLRGRFHTYTNQYLSNSITTAAIF 238

Query: 233 HPQELIQYPLIKKNTWHALITLKKALKN 260
           HP  L++ P  K+  W  L  +++ L N
Sbjct: 239 HPAYLLRQPAQKRLAWEDLKKIREYLDN 266


>gi|220925901|ref|YP_002501203.1| phage SPO1 DNA polymerase-like protein [Methylobacterium nodulans
           ORS 2060]
 gi|219950508|gb|ACL60900.1| phage SPO1 DNA polymerase-related protein [Methylobacterium
           nodulans ORS 2060]
          Length = 278

 Score =  222 bits (565), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 76/277 (27%), Positives = 121/277 (43%), Gaps = 19/277 (6%)

Query: 2   TSKRILSQEQILTIALFYADSGVYWVFDE-PNNEATYESQRKEKSIDSAIQPITN----- 55
            +     +  +L    F+  SGV  V DE P++       +      +A+ P+       
Sbjct: 1   MTDDAPDRSDLLAYLDFHVASGVDAVLDEVPHDRFAESEAKAAARPAAALPPVPPPAPAP 60

Query: 56  ------------IRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICAT 103
                                  A  +A+ A SL EL++LL  F  C L  T+ + + A 
Sbjct: 61  RPPSRGSTFGRSAAAEPGEAADDARELARAAGSLAELEALLARFESCPLRFTAKNLVFAD 120

Query: 104 QTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGN 163
                 +M +G  P   ++  GKPF G++G +LD+M+ +I + R+  ++  I PW PPGN
Sbjct: 121 GEPSARVMFVGEAPGADEDRVGKPFMGRSGQLLDRMMAAIGLDRSNAYVGNIVPWRPPGN 180

Query: 164 RNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPH 223
           R+ +  E+  C+P I RQI L  P IL+ +G                ++ G+W    T  
Sbjct: 181 RSPTPQEVATCKPFIERQIALADPDILVCLGGVATQTLAG-TRDGILKSRGRWFPYQTGR 239

Query: 224 SIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
             I  LAT+HP  L++ PL K+  W     L+ AL  
Sbjct: 240 REIRLLATLHPAYLLRQPLQKRLAWRDFRALRAALDA 276


>gi|163745656|ref|ZP_02153016.1| uracil-DNA glycosylase, C-terminal [Oceanibulbus indolifex HEL-45]
 gi|161382474|gb|EDQ06883.1| uracil-DNA glycosylase, C-terminal [Oceanibulbus indolifex HEL-45]
          Length = 254

 Score =  222 bits (565), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 71/255 (27%), Positives = 119/255 (46%), Gaps = 8/255 (3%)

Query: 8   SQEQILTIALFYADSGV-YWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQ 66
              Q   +  +  + G    + D P N     +   + S   A  P           V  
Sbjct: 5   DYHQAAEMLAWQVELGATEAICDAPVNRYEVPASPPKASAKIAKGPQPMQAAEKPDPVAL 64

Query: 67  ADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGK 126
           A   AQ A +L EL++ ++ F  C L   + + + +    G  LMI G +P   ++ +GK
Sbjct: 65  ARRAAQGAQTLDELRAAIQGFEACELHKGARNLVFSDGVPGAPLMIFGESPDRDEDRAGK 124

Query: 127 PFSGKTGNMLDKMLQSIEIMRTQI-HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELI 185
           PF G+TG MLD+ML +I++ R +  ++S I PW  P  R+    E+ + RP + R IEL 
Sbjct: 125 PFVGRTGQMLDRMLAAIDMGRDRNVYLSNILPWRTPQGRDPKPDEIAMMRPFVQRHIELA 184

Query: 186 SPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKK 245
            PK+L+  GN +       + +   +  G W    T  + +P +  VHP  L++ P  K+
Sbjct: 185 KPKVLILFGNWSCQSLL--EKRSIMRLRGNW----TKAADLPCMPMVHPAYLLRNPEAKR 238

Query: 246 NTWHALITLKKALKN 260
             W  L++++  L+N
Sbjct: 239 EAWADLLSVQAKLRN 253


>gi|163738869|ref|ZP_02146282.1| phage SPO1 DNA polymerase-related protein [Phaeobacter
           gallaeciensis BS107]
 gi|163741885|ref|ZP_02149275.1| uracil-DNA glycosylase [Phaeobacter gallaeciensis 2.10]
 gi|161385058|gb|EDQ09437.1| uracil-DNA glycosylase [Phaeobacter gallaeciensis 2.10]
 gi|161387674|gb|EDQ12030.1| phage SPO1 DNA polymerase-related protein [Phaeobacter
           gallaeciensis BS107]
          Length = 253

 Score =  221 bits (563), Expect = 7e-56,   Method: Composition-based stats.
 Identities = 66/258 (25%), Positives = 110/258 (42%), Gaps = 10/258 (3%)

Query: 3   SKRILSQEQILTIALFYADSGV-YWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHS 61
            +  L       +  +  + G    + D P N    +++  +    +A       R I  
Sbjct: 1   MESALDYHSAHALLAWQIELGATDAIGDAPVNRYELQARLPKPGAAAAEVAPAKPRDI-- 58

Query: 62  PLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSD 121
             V+ A  +A  A SL  L   L  F  C L   + + + A    G  +M++G  P   +
Sbjct: 59  DPVEVARQMAGAAGSLEGLYEALGQFEHCELKKGARNLVFADGQPGARVMVVGEAPGRDE 118

Query: 122 NISGKPFSGKTGNMLDKMLQSIEIMRTQI-HISMISPWHPPGNRNLSNIEMEICRPIIMR 180
           +I+GKPF G+ G +LD+ML +I + R    +I+ + PW PP NR+    E+ +  P + R
Sbjct: 119 DIAGKPFVGRAGQLLDRMLAAIGLSRKDSVYIANVLPWRPPQNRDPLPAEIAMMTPFLER 178

Query: 181 QIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQY 240
            I L  P IL+ +GN + +           +  G W          P +   HP  L++ 
Sbjct: 179 HIALAKPDILIAMGNISCDALLGKRG--ITRMRGTWQEAQGK----PVMPMFHPAYLLRQ 232

Query: 241 PLIKKNTWHALITLKKAL 258
           P  K+  W  L+ +K  L
Sbjct: 233 PAQKRAAWADLLEIKARL 250


>gi|83854882|ref|ZP_00948412.1| uracil-DNA glycosylase [Sulfitobacter sp. NAS-14.1]
 gi|83941405|ref|ZP_00953867.1| uracil-DNA glycosylase [Sulfitobacter sp. EE-36]
 gi|83842725|gb|EAP81892.1| uracil-DNA glycosylase [Sulfitobacter sp. NAS-14.1]
 gi|83847225|gb|EAP85100.1| uracil-DNA glycosylase [Sulfitobacter sp. EE-36]
          Length = 257

 Score =  220 bits (561), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 64/259 (24%), Positives = 116/259 (44%), Gaps = 11/259 (4%)

Query: 5   RILSQEQILTIALFYADSGV-YWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPL 63
             +   Q L +  +  + G    + D P N     +  ++            +      +
Sbjct: 2   ESVDYHQALALLHWQIELGATEAICDAPVNRYEVPAAVEKPKAQKGKSGPVPLAAQGPDV 61

Query: 64  VQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNI 123
           V +A   A  A +L EL++ + +F  C L   +   + +  T G  +MI+G  P   ++ 
Sbjct: 62  VAEATQAAAGAATLDELRAAMAAFEHCELKRGARKMVFSDGTPGARVMIVGEAPGRDEDR 121

Query: 124 SGKPFSGKTGNMLDKMLQSIEIMRTQ----IHISMISPWHPPGNRNLSNIEMEICRPIIM 179
            G+PF G+ G +LDKML +I++ R      ++I+ + PW PP NR+    E+ + +P + 
Sbjct: 122 EGRPFVGRAGVLLDKMLAAIDMGRHHQTSPVYITNVLPWRPPQNRDPKPDEIAMMKPFLA 181

Query: 180 RQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ 239
           R I L  P++L+ +GN +             +  G+W+        +P L   HP  L++
Sbjct: 182 RHIALAKPEVLVIVGNWSAQALLGKRG--ITRLRGQWTQAE----GLPALPMFHPAYLLR 235

Query: 240 YPLIKKNTWHALITLKKAL 258
            P  K+  W  L++LK  L
Sbjct: 236 SPEFKREAWADLLSLKAKL 254


>gi|254504642|ref|ZP_05116793.1| uracil-DNA glycosylase, family 4, putative [Labrenzia alexandrii
           DFL-11]
 gi|222440713|gb|EEE47392.1| uracil-DNA glycosylase, family 4, putative [Labrenzia alexandrii
           DFL-11]
          Length = 300

 Score =  220 bits (561), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 74/297 (24%), Positives = 126/297 (42%), Gaps = 48/297 (16%)

Query: 12  ILTIALFYADSGVYWVFDEPN--------------------------------------N 33
           +  +  FY  SGV     E                                         
Sbjct: 4   LEALLDFYLASGVDASLGEDVVDWFQLSEVQAKARQQSATPQAAAQPVAAPGQNVSQQVR 63

Query: 34  EATYESQRKEKSIDSAIQPITNI---------RHIHSPLVQQADSIAQKACSLHELKSLL 84
           + + ++Q   +   +   P                   ++  A  +A    SL +L++ L
Sbjct: 64  QVSPQNQSPSQPRPTQAAPAVGAGTRSPTDHGAIPDQAVISTARELASSTGSLADLRACL 123

Query: 85  RSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIE 144
            +F  C+L  T+ S + A       +M+IG  P   +++ GKPF G++G +LD+ML +I 
Sbjct: 124 EAFDGCNLKRTAKSLVFADGNPDARVMLIGEAPGRDEDLQGKPFVGRSGQLLDRMLTAIG 183

Query: 145 IMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNN 204
           + R++++I+   PW PPGNR  +  E EICRP I RQIEL++P +++F+G  +       
Sbjct: 184 LDRSRVYIANTVPWRPPGNRTPTPQETEICRPFIQRQIELVNPDVVVFLGAASAKTLLGV 243

Query: 205 DAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
                 +  G+W         +  LAT HP  L++ PL K+ +W   +++K  L  L
Sbjct: 244 Q-DGIRKMRGRWMTYPVAGRQVAALATYHPAYLLRSPLEKRLSWRDFLSVKSKLSEL 299


>gi|218682587|ref|ZP_03530188.1| phage SPO1 DNA polymerase-related protein [Rhizobium etli CIAT 894]
          Length = 299

 Score =  220 bits (560), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 94/295 (31%), Positives = 148/295 (50%), Gaps = 35/295 (11%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVFDEP--NNEATYESQRKEKSIDSAIQPI----- 53
           M S   LS  ++  +  F+AD+GV W+ +E   +  A +E+ +  +   +  QP      
Sbjct: 1   MISANDLSPAELAALLHFHADAGVEWLLEEEAVDRFAEFEAMKAARRPPTQAQPSVAGEG 60

Query: 54  ---------------------------TNIRHIHSPLVQQADSIAQKACSLHELKSLLRS 86
                                                VQQA  +A+ A SL ELK+ + +
Sbjct: 61  TGSGQGRTTPRPNAAARPAPAAIAASGPQPAIPDGEAVQQARFVAETARSLAELKTAIEA 120

Query: 87  FHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIM 146
           F+ C+L  ++ STI A+      +M+IG  P   D+  G PFSGK+G + DKML +I + 
Sbjct: 121 FNGCNLKHSARSTIFASGDADSGIMVIGSAPGAEDDREGVPFSGKSGQLFDKMLAAIGLT 180

Query: 147 RTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDA 206
           R+ + ++ + PW PPGNR  S  EM+ICRP I RQI L  PK +L +GN +  FFF  + 
Sbjct: 181 RSSVLLTQVIPWRPPGNRPPSAAEMDICRPFIERQIALAEPKAILLLGNFSARFFFGEND 240

Query: 207 QKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
                  G+W  +     +IP +A++HPQ+L+  P+ K+  W+ L+  +  LK+L
Sbjct: 241 TIHG-LRGRWKEIAVADCVIPAIASLHPQDLLTAPVNKRLAWNDLLAFQAKLKSL 294


>gi|68171577|ref|ZP_00544951.1| Phage SPO1 DNA polymerase-related protein [Ehrlichia chaffeensis
           str. Sapulpa]
 gi|88657868|ref|YP_506904.1| uracil-DNA glycosylase [Ehrlichia chaffeensis str. Arkansas]
 gi|67999003|gb|EAM85680.1| Phage SPO1 DNA polymerase-related protein [Ehrlichia chaffeensis
           str. Sapulpa]
 gi|88599325|gb|ABD44794.1| uracil-DNA glycosylase, family 4 [Ehrlichia chaffeensis str.
           Arkansas]
          Length = 261

 Score =  220 bits (559), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 68/262 (25%), Positives = 128/262 (48%), Gaps = 8/262 (3%)

Query: 7   LSQEQILTIALFYADSGVYWVFDEPN-NEATYESQRKEKSIDSAIQPITNIRHIHSPLVQ 65
           +S   +L +  FY ++G+    ++   N  T ++   + S D+          I      
Sbjct: 1   MSDLDLLEVLKFYHENGIDCTLEDVQYNVFTSKNLSLQNSSDTGYCMKEKQASIKENTED 60

Query: 66  ----QADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSD 121
               +A S+A++  ++ +LKS + SF  C + + + +T+ A       +M+IG  P  ++
Sbjct: 61  YYLLKAQSLAEQCNTIEQLKSAVESFDGCDIKNLATNTVFADGNPKARVMLIGEAPGANE 120

Query: 122 NISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQ 181
           ++ G PF G +G +LDKMLQ+I   RT ++IS    W PPGNR  ++ E+ +C+P + + 
Sbjct: 121 DLKGIPFCGASGMLLDKMLQAIGFDRTTVYISNAVFWRPPGNRRPTDFEIAVCKPFVEKH 180

Query: 182 IELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPH--SIIPTLATVHPQELIQ 239
           I LI P++L+ +G+       ++      +  G++ +         I T    HP  L++
Sbjct: 181 IALIVPQMLVLVGSTACYAMLDSK-NPISRLRGRFHSYSNQFLQHSITTGIIFHPSYLLR 239

Query: 240 YPLIKKNTWHALITLKKALKNL 261
            P+ K+  W  L  +K+    L
Sbjct: 240 QPMQKRLAWEDLKQIKRYFDTL 261


>gi|259415078|ref|ZP_05739000.1| uracil-DNA glycosylase [Silicibacter sp. TrichCH4B]
 gi|259348988|gb|EEW60742.1| uracil-DNA glycosylase [Silicibacter sp. TrichCH4B]
          Length = 255

 Score =  220 bits (559), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 63/260 (24%), Positives = 115/260 (44%), Gaps = 9/260 (3%)

Query: 3   SKRILSQEQILTIALFYADSGV-YWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHS 61
            +  L       +  +  + G    + D P N    + Q+ +     A  P   ++    
Sbjct: 1   MESELDYWSAKALLEWQVELGATEAMMDAPINRYELQDQKPKA-ARGAEAPPAPVKPKSV 59

Query: 62  PLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSD 121
             V +A  +A+ A +L  L++ L +F  C L   + + + +    G  +MIIG  P   +
Sbjct: 60  DPVAEAVKLAKSADALPGLRAALETFEHCDLKRGARNLVFSDGQAGARVMIIGEAPGRDE 119

Query: 122 NISGKPFSGKTGNMLDKMLQSIEIMRTQI-HISMISPWHPPGNRNLSNIEMEICRPIIMR 180
           ++ GKPF G+ G +LDKML +I++ R +  +I+ + PW PP NR+    E+ +  P + R
Sbjct: 120 DLQGKPFVGRAGQLLDKMLAAIDLSRDENVYITNVLPWRPPQNRDPLPAEIAMLVPFLER 179

Query: 181 QIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQY 240
            + L  P +L+ +GN +             +  G W+         P +   HP  L++ 
Sbjct: 180 HVALAQPDVLVLMGNISCQAVLGKRG--ITRLRGNWAQAWGK----PVIPMFHPAYLLRQ 233

Query: 241 PLIKKNTWHALITLKKALKN 260
              K+  W  L+ L+  L +
Sbjct: 234 ASAKRQAWADLLELRARLNS 253


>gi|91203817|emb|CAJ71470.1| conserved hypothetical protein [Candidatus Kuenenia
           stuttgartiensis]
          Length = 263

 Score =  220 bits (559), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 66/253 (26%), Positives = 113/253 (44%), Gaps = 8/253 (3%)

Query: 10  EQILTIALFYADSGVYWV-FDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQAD 68
           + +     F    GV  +  +  NN     +   +K+            +   PL  +  
Sbjct: 15  KDLKARLAFEETFGVEVISINAQNNLVKSSTTITQKNDMPKTSAPQTESNDKKPLTTRPK 74

Query: 69  SIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPF 128
               KA  L ELK+     H C L  T  + +         LM +G  P   +++ G+PF
Sbjct: 75  E--GKAKLLEELKNETLVCHKCPLGETRTNLVFGAGNPMASLMFVGEAPGRDEDLQGEPF 132

Query: 129 SGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPK 188
            G+ G +L K++++I++ R+ ++I+ I    PPGNRN    E+ +C P++ +QI++I PK
Sbjct: 133 VGRAGQLLTKIIEAIDMKRSDVYIANILKCRPPGNRNPLTDEIALCIPVLTKQIDIIKPK 192

Query: 189 ILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTW 248
           +L  +G        N   +      GK+ +       IPT+AT HP  L++ P  K   W
Sbjct: 193 VLCAMGTFAAQTLLNTK-EPIGFLRGKFHDY----KGIPTMATFHPAYLLRNPGEKAKVW 247

Query: 249 HALITLKKALKNL 261
             +  ++  LK L
Sbjct: 248 EDMKKIRDLLKEL 260


>gi|99078039|ref|YP_611297.1| phage SPO1 DNA polymerase-related protein [Ruegeria sp. TM1040]
 gi|99035177|gb|ABF62035.1| phage SPO1 DNA polymerase-related protein [Ruegeria sp. TM1040]
          Length = 255

 Score =  219 bits (557), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 69/261 (26%), Positives = 117/261 (44%), Gaps = 9/261 (3%)

Query: 3   SKRILSQEQILTIALFYADSGV-YWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHS 61
            +  L       +  +  + G    + D P +    E Q+  K   +A  P T ++    
Sbjct: 1   MESELDYWSAKALLEWQVELGATEAMMDTPIDRYGLEDQKP-KPARAADTPPTPVKPKTV 59

Query: 62  PLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSD 121
             V +A  +A+ A +L  L++ L  F  C L   + + + +    G  +MIIG  P   +
Sbjct: 60  DPVAEAAKLAKTAQALPSLRAALEQFEHCDLKRGARNLVFSDGQAGARVMIIGEAPGRDE 119

Query: 122 NISGKPFSGKTGNMLDKMLQSIEIMRTQI-HISMISPWHPPGNRNLSNIEMEICRPIIMR 180
           ++ GKPF G+ G +LDKML +IE+ R +  +I+ + PW PP NR+    E+ +  P + R
Sbjct: 120 DLQGKPFVGRAGQLLDKMLDAIELSREKNVYITNVLPWRPPQNRDPLPAEISMLVPFLER 179

Query: 181 QIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQY 240
            + L  P IL+ +GN +             +  G WS         P +   HP  L++ 
Sbjct: 180 HVALAEPDILVLMGNISCQAVLGKRG--ITRLRGTWSEAWGK----PVIPMFHPAYLLRQ 233

Query: 241 PLIKKNTWHALITLKKALKNL 261
              K+  W  L+ L+  L +L
Sbjct: 234 AHAKRQAWADLLELRARLNSL 254


>gi|83945346|ref|ZP_00957694.1| hypothetical protein OA2633_14206 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83851180|gb|EAP89037.1| hypothetical protein OA2633_14206 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 261

 Score =  219 bits (557), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 72/263 (27%), Positives = 120/263 (45%), Gaps = 4/263 (1%)

Query: 1   MT-SKRILSQEQILTIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHI 59
           MT          + ++  ++  SGV  +   P  ++   +         A          
Sbjct: 1   MTAPLNPEDIRALKSLISWWEQSGVEALPPLPAPKSARPAPPPSMEAR-ATGAQARQAGF 59

Query: 60  HSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSD 119
            +   Q   ++AQ A ++ ELK  L +F  C L +T+  T+ A      D+M++G  P  
Sbjct: 60  GAAPTQNGRAMAQAAQTVGELKQALDAFDGCPLKATATQTVYARGNPQADVMVVGEAPGR 119

Query: 120 SDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIM 179
            ++  G PF G+ G +LD+ML +I +  T  +I+ +  W PPGNR  ++ E+E C P   
Sbjct: 120 DEDREGAPFIGQAGQLLDRMLAAIGLNETSAYITNVVFWRPPGNRKPTDAEIEACLPFAE 179

Query: 180 RQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSI-IPTLATVHPQELI 238
           R IEL+ PK+++F G  +     ++ A       G+W +        IP L   HP  L+
Sbjct: 180 RHIELVRPKVIVFAGGISAQSLLHSKAGIMA-LRGRWHDYTLSDGTMIPALPMYHPAFLL 238

Query: 239 QYPLIKKNTWHALITLKKALKNL 261
           + P  K  +W  L++LK  L  L
Sbjct: 239 RRPQEKAKSWQDLLSLKAKLAAL 261


>gi|328544965|ref|YP_004305074.1| Uracil-DNA glycosylase, family 4 [polymorphum gilvum SL003B-26A1]
 gi|326414707|gb|ADZ71770.1| Uracil-DNA glycosylase, family 4, putative [Polymorphum gilvum
           SL003B-26A1]
          Length = 300

 Score =  218 bits (556), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 77/288 (26%), Positives = 130/288 (45%), Gaps = 38/288 (13%)

Query: 8   SQEQILTIALFYADSGVYWVFDE-PNNEATYESQRKEKSIDSAIQP-------------- 52
           S   +  +  F   +GV  + +E P +     ++ +      A +P              
Sbjct: 11  SLRDLEALLDFLQAAGVDGLLEEAPVDRFALPAEAEASRSAPAQRPEMRPDLRPAAPATP 70

Query: 53  ------ITNIRHIHSPL----------------VQQADSIAQKACSLHELKSLLRSFHDC 90
                  T    + +PL                V  A   A+ A +L  L++ L +F  C
Sbjct: 71  GPGVTAPTRAAPVPAPLPGGGGYDGAVIPGEETVVSAREAARSAETLEALRACLAAFKGC 130

Query: 91  HLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQI 150
           +L  T+ + +         +M++G  P   +++ G PF G++G +LD+ML++I + R+Q+
Sbjct: 131 NLHLTAKNLVFDDGNPQARVMLVGEAPGRDEDLQGLPFVGRSGQLLDRMLKAIGLDRSQV 190

Query: 151 HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTY 210
           +I+ + PW PPGNR  +  E EIC+P I RQIEL  P IL+F+G  +             
Sbjct: 191 YIANVVPWRPPGNRTPTPQETEICKPFIARQIELADPDILVFLGAASAKVLLGVQ-DGIR 249

Query: 211 QNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
           +  G+W    T    I  +AT HP  L++ PL K+  W   + L++AL
Sbjct: 250 KMRGRWMTYDTGRRQIRCIATFHPAYLLRSPLEKRLAWRDFLALRQAL 297


>gi|306842110|ref|ZP_07474780.1| uracil-DNA glycosylase, family 4 [Brucella sp. BO2]
 gi|306287783|gb|EFM59211.1| uracil-DNA glycosylase, family 4 [Brucella sp. BO2]
          Length = 290

 Score =  218 bits (556), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 78/281 (27%), Positives = 130/281 (46%), Gaps = 31/281 (11%)

Query: 11  QILTIALFYADSGVYW-VFDEPNNEATY---ESQRKEKSIDSAIQPITNIRH-------- 58
            I  +  FYA++GV   + + P +        +  + +   +A QP +N           
Sbjct: 9   DIEGLLRFYAEAGVDVPLCETPIDRFAAATHPAPAQSRMQAAAQQPESNPAQAREERART 68

Query: 59  -----------------IHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTIC 101
                              +  +  A   A +A +L EL+  L +F  C+L  T+ +   
Sbjct: 69  VAVPSPSSKPVQAAMDLPDNAQIALAREAASQAETLEELREKLAAFDGCNLKFTAKNLCF 128

Query: 102 ATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPP 161
           A      D+M IG  P   +++ G PF GK+G +L++M+++I + R +++I+   PW PP
Sbjct: 129 ADGDPSSDIMFIGEAPGRDEDMEGLPFVGKSGQLLNRMIEAIGLKREEVYIANTIPWRPP 188

Query: 162 GNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCT 221
           GNR  + +E E+CRP I RQIEL +PK+L+ +G           A+   +  G W    T
Sbjct: 189 GNRAPTPLETELCRPFIERQIELAAPKVLVALGGPAGKALTGA-AEGILRLRGNWKIHRT 247

Query: 222 P-HSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
           P    IP + T+HP  L++ P  K+  W   + +K  L  L
Sbjct: 248 PTGMEIPVMPTLHPAYLLRTPAQKRFAWRDFLAVKLKLAEL 288


>gi|306845226|ref|ZP_07477802.1| uracil-DNA glycosylase, family 4 [Brucella sp. BO1]
 gi|306274385|gb|EFM56192.1| uracil-DNA glycosylase, family 4 [Brucella sp. BO1]
          Length = 290

 Score =  218 bits (555), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 78/281 (27%), Positives = 130/281 (46%), Gaps = 31/281 (11%)

Query: 11  QILTIALFYADSGVYW-VFDEPNNEATY---ESQRKEKSIDSAIQPITNIRH-------- 58
            I  +  FYA++GV   + + P +        +  + +   +A QP +N           
Sbjct: 9   DIEGLLRFYAEAGVDVPLCETPIDRFAAATHPAPAQSRMQAAAQQPESNPVQAREERART 68

Query: 59  -----------------IHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTIC 101
                              +  +  A   A +A +L EL+  L +F  C+L  T+ +   
Sbjct: 69  VAAPSPSSKPVQAAMDLPDNAQIALAREAASQAETLEELREKLAAFDGCNLKFTAKNLCF 128

Query: 102 ATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPP 161
           A      D+M IG  P   +++ G PF GK+G +L++M+++I + R +++I+   PW PP
Sbjct: 129 ADGDPSSDIMFIGEAPGRDEDMEGLPFVGKSGQLLNRMIEAIGLKREEVYIANTIPWRPP 188

Query: 162 GNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCT 221
           GNR  + +E E+CRP I RQIEL +PK+L+ +G           A+   +  G W    T
Sbjct: 189 GNRAPTPLETELCRPFIERQIELAAPKVLVALGGPAGKALTG-TAEGILRLRGNWKIHRT 247

Query: 222 P-HSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
           P    IP + T+HP  L++ P  K+  W   + +K  L  L
Sbjct: 248 PTGMEIPVMPTLHPAYLLRTPAQKRFAWRDFLAVKLKLAEL 288


>gi|254718769|ref|ZP_05180580.1| uracil-DNA glycosylase, family 4 [Brucella sp. 83/13]
 gi|265983747|ref|ZP_06096482.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|306840191|ref|ZP_07472971.1| uracil-DNA glycosylase, family 4 [Brucella sp. NF 2653]
 gi|264662339|gb|EEZ32600.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|306404722|gb|EFM61021.1| uracil-DNA glycosylase, family 4 [Brucella sp. NF 2653]
          Length = 290

 Score =  218 bits (555), Expect = 7e-55,   Method: Composition-based stats.
 Identities = 78/281 (27%), Positives = 130/281 (46%), Gaps = 31/281 (11%)

Query: 11  QILTIALFYADSGVYW-VFDEPNNEATY---ESQRKEKSIDSAIQPITNIRH-------- 58
            I  +  FYA++GV   + + P +        +  + +   +A QP +N           
Sbjct: 9   DIEGLLRFYAEAGVDVPLCETPIDRFAAATHPAPAQSRMQAAAQQPESNPAQAREERART 68

Query: 59  -----------------IHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTIC 101
                              +  +  A   A +A +L EL+  L +F  C+L  T+ +   
Sbjct: 69  VAVPSPSSKPVQAAMDLPDNAQIALAREAASQAETLEELREKLAAFDGCNLKFTAKNLCF 128

Query: 102 ATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPP 161
           A      D+M IG  P   +++ G PF GK+G +L++M+++I + R +++I+   PW PP
Sbjct: 129 ADGDPSSDIMFIGEAPGRDEDMEGLPFVGKSGQLLNRMIEAIGLKREEVYIANTIPWRPP 188

Query: 162 GNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCT 221
           GNR  + +E E+CRP I RQIEL +PK+L+ +G           A+   +  G W    T
Sbjct: 189 GNRAPTPLETELCRPFIERQIELAAPKVLVALGGPAGKALTGA-AEGILRLRGNWKIHRT 247

Query: 222 P-HSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
           P    IP + T+HP  L++ P  K+  W   + +K  L  L
Sbjct: 248 PTGMEIPVMPTLHPAYLLRTPAQKRFAWRDFLAVKLKLAEL 288


>gi|239831462|ref|ZP_04679791.1| uracil-DNA glycosylase, family 4 [Ochrobactrum intermedium LMG
           3301]
 gi|239823729|gb|EEQ95297.1| uracil-DNA glycosylase, family 4 [Ochrobactrum intermedium LMG
           3301]
          Length = 284

 Score =  218 bits (554), Expect = 9e-55,   Method: Composition-based stats.
 Identities = 79/275 (28%), Positives = 121/275 (44%), Gaps = 25/275 (9%)

Query: 11  QILTIALFYADSGVYWVFDE-PNNEATYESQRKEKSIDSAIQPITNIRHI---------- 59
            I  +  FYA++GV     E P +      +          Q                  
Sbjct: 9   DIEGLLRFYAEAGVDMPLSETPIDRFAEPQRPAPAQPAMQTQSPPERPRQQPRPAPAPAP 68

Query: 60  HSPLVQQADSIAQKAC------------SLHELKSLLRSFHDCHLCSTSLSTICATQTEG 107
            S  VQ A  +   A             +L EL+  L +F  C+L  T+ +   A     
Sbjct: 69  TSRPVQAAADLPDTAQIALAREAAAQASTLDELREKLAAFDGCNLKFTAKNLCFADGDPS 128

Query: 108 QDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLS 167
            D+M IG  P   +++ G PF GK+G +L++M++SI + R  ++I+   PW PPGNR  +
Sbjct: 129 SDIMFIGEAPGRDEDMEGLPFVGKSGQLLNRMIESIGLKRESVYIANTIPWRPPGNRTPT 188

Query: 168 NIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSI-I 226
            +E E+CRP I RQIEL +PK+L+ +G            +   +  G W    TP  I I
Sbjct: 189 PLETELCRPFIERQIELAAPKVLVALGGPAGKALTGAT-EGILRLRGNWKIHRTPSGIEI 247

Query: 227 PTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
           P + T+HP  L++ P  K+  W   + +K  L  L
Sbjct: 248 PVMPTLHPAYLLRTPAQKRFAWRDFLAVKLKLAEL 282


>gi|256060754|ref|ZP_05450917.1| uracil-DNA glycosylase, family 4 [Brucella neotomae 5K33]
 gi|261324742|ref|ZP_05963939.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261300722|gb|EEY04219.1| conserved hypothetical protein [Brucella neotomae 5K33]
          Length = 290

 Score =  217 bits (553), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 77/281 (27%), Positives = 130/281 (46%), Gaps = 31/281 (11%)

Query: 11  QILTIALFYADSGVYW-VFDEPNNEATY---ESQRKEKSIDSAIQPITNIRH-------- 58
            +  +  FYA++GV   + + P +        +  + +   +A QP +N           
Sbjct: 9   DMEGLLRFYAEAGVDVPLCETPIDRFAAATHPAPAQSRMQAAAQQPESNPAQAREERART 68

Query: 59  -----------------IHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTIC 101
                              +  +  A   A +A +L EL+  L +F  C+L  T+ +   
Sbjct: 69  VAVPSPSSKPVQAAMVLPDNAQIALAREAASQAETLEELREKLAAFDGCNLKFTAKNLCF 128

Query: 102 ATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPP 161
           A      D+M IG  P   +++ G PF GK+G +L++M+++I + R +++I+   PW PP
Sbjct: 129 ADGDPSSDIMFIGEAPGRDEDMEGLPFVGKSGQLLNRMIEAIGLKREEVYIANTIPWRPP 188

Query: 162 GNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCT 221
           GNR  + +E E+CRP I RQIEL +PK+L+ +G           A+   +  G W    T
Sbjct: 189 GNRAPTPLETELCRPFIERQIELAAPKVLVALGGPAGKALTGA-AEGILRLRGNWKIHRT 247

Query: 222 P-HSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
           P    IP + T+HP  L++ P  K+  W   + +K  L  L
Sbjct: 248 PTGMEIPVMPTLHPAYLLRTPAQKRFAWRDFLAVKLKLAEL 288


>gi|89056392|ref|YP_511843.1| phage SPO1 DNA polymerase-related protein [Jannaschia sp. CCS1]
 gi|88865941|gb|ABD56818.1| phage SPO1 DNA polymerase-related protein [Jannaschia sp. CCS1]
          Length = 300

 Score =  217 bits (553), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 63/267 (23%), Positives = 107/267 (40%), Gaps = 24/267 (8%)

Query: 11  QILTIALFYADSGVY-WVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHS-------- 61
             L    +  + G    + D P +     +         A  P+   R            
Sbjct: 40  DALAALEWQVELGADEAMLDAPLDRFDLPAPVAMPKAPPAAGPVGPSRAAAPVNSTRPAT 99

Query: 62  ----PLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTP 117
                 V  A  +A+ A SL  L S +  F  C L   + + +    T    +MI+G  P
Sbjct: 100 LPQVDAVAIARQLAEAAGSLEALSSAMEGFEHCELRRGARNFVFHDGTPDARVMIVGEAP 159

Query: 118 SDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQI-----HISMISPWHPPGNRNLSNIEME 172
              ++  GKPF G+ G +LD+M  +I + R        +I+ + PW PP NR+    E+ 
Sbjct: 160 GREEDSQGKPFVGRAGQLLDRMFAAIGLDRAVEGGEGLYITNMLPWRPPQNRDPKAEELA 219

Query: 173 ICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATV 232
           +  P + R I+L+ P++L+ +GN               +  G W ++       PT+   
Sbjct: 220 MMAPFVQRHIDLVDPEVLVLMGNHACAGLLGRRG--ITRMRGTWEDVN----GRPTMPMC 273

Query: 233 HPQELIQYPLIKKNTWHALITLKKALK 259
           HP  L++ P  K+  W  L+++K  L 
Sbjct: 274 HPAYLLRNPAAKREAWADLLSIKARLA 300


>gi|158425118|ref|YP_001526410.1| phage SPO1 DNA polymerase-related protein [Azorhizobium caulinodans
           ORS 571]
 gi|158332007|dbj|BAF89492.1| phage SPO1 DNA polymerase-related protein [Azorhizobium caulinodans
           ORS 571]
          Length = 297

 Score =  217 bits (552), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 78/296 (26%), Positives = 126/296 (42%), Gaps = 41/296 (13%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVF-DEPNNEATYESQRKEKSIDSAIQPITNIRHI 59
           MTS    + E       FYA++GV     DEP +     +  K +       P T     
Sbjct: 1   MTS---FAYEHFRDALAFYAEAGVDVAIGDEPVDRFAESAAEKARRGVGRSAPQTASAQP 57

Query: 60  HSP------------------------------------LVQQADSIAQKACSLHELKSL 83
            +                                      V  A   A  A SL EL+++
Sbjct: 58  VNDSPAASPAPVRAPAAPRAPAPAAAGPGPMAAAQAPDQAVMAAREAAHTAASLDELRAM 117

Query: 84  LRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSI 143
           L +F  C L  T+   + A       +M +G  P   +++ G PF G++G +LD ML +I
Sbjct: 118 LEAFEGCPLKRTATRLVFADGNPAAKVMFVGEAPGRDEDVQGLPFVGRSGRLLDLMLGAI 177

Query: 144 EIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFN 203
            + RT+ +I+ + PW PPGNR  +  E  IC P I RQ+EL +P +L+ +G  +     +
Sbjct: 178 GLDRTKAYIANVIPWRPPGNRTPTPQETAICLPFIRRQVELANPDVLVCLGGPSAQALLS 237

Query: 204 NDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALK 259
              +   +  G++ +  T    I  +AT HP  L++ PL K+  W  ++ ++ AL 
Sbjct: 238 -TTEGITKLRGRFMSYDTGSRTIKAIATFHPAYLLRTPLGKRLAWRDMLAVEAALN 292


>gi|17987604|ref|NP_540238.1| DNA polymerase [Brucella melitensis bv. 1 str. 16M]
 gi|23501507|ref|NP_697634.1| phage SPO1 DNA polymerase-like protein [Brucella suis 1330]
 gi|62289582|ref|YP_221375.1| phage SPO1 DNA polymerase-like protein [Brucella abortus bv. 1 str.
           9-941]
 gi|82699512|ref|YP_414086.1| uracil-DNA glycosylase [Brucella melitensis biovar Abortus 2308]
 gi|148560496|ref|YP_001258613.1| phage SPO1 DNA polymerase-like protein [Brucella ovis ATCC 25840]
 gi|161618595|ref|YP_001592482.1| uracil-DNA glycosylase [Brucella canis ATCC 23365]
 gi|163842895|ref|YP_001627299.1| uracil-DNA glycosylase [Brucella suis ATCC 23445]
 gi|189023841|ref|YP_001934609.1| DNA polymerase, bacteriophage-type [Brucella abortus S19]
 gi|225627127|ref|ZP_03785165.1| uracil-DNA glycosylase, family 4 [Brucella ceti str. Cudo]
 gi|225852145|ref|YP_002732378.1| uracil-DNA glycosylase [Brucella melitensis ATCC 23457]
 gi|237815079|ref|ZP_04594077.1| uracil-DNA glycosylase, family 4 [Brucella abortus str. 2308 A]
 gi|254688903|ref|ZP_05152157.1| uracil-DNA glycosylase, family 4 [Brucella abortus bv. 6 str. 870]
 gi|254693384|ref|ZP_05155212.1| uracil-DNA glycosylase, family 4 [Brucella abortus bv. 3 str.
           Tulya]
 gi|254697035|ref|ZP_05158863.1| uracil-DNA glycosylase, family 4 [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254701414|ref|ZP_05163242.1| uracil-DNA glycosylase, family 4 [Brucella suis bv. 5 str. 513]
 gi|254703959|ref|ZP_05165787.1| uracil-DNA glycosylase, family 4 [Brucella suis bv. 3 str. 686]
 gi|254707663|ref|ZP_05169491.1| uracil-DNA glycosylase, family 4 [Brucella pinnipedialis
           M163/99/10]
 gi|254709754|ref|ZP_05171565.1| uracil-DNA glycosylase, family 4 [Brucella pinnipedialis B2/94]
 gi|254713757|ref|ZP_05175568.1| uracil-DNA glycosylase, family 4 [Brucella ceti M644/93/1]
 gi|254717185|ref|ZP_05178996.1| uracil-DNA glycosylase, family 4 [Brucella ceti M13/05/1]
 gi|254729934|ref|ZP_05188512.1| uracil-DNA glycosylase, family 4 [Brucella abortus bv. 4 str. 292]
 gi|256031244|ref|ZP_05444858.1| uracil-DNA glycosylase, family 4 [Brucella pinnipedialis M292/94/1]
 gi|256044322|ref|ZP_05447226.1| uracil-DNA glycosylase, family 4 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256159355|ref|ZP_05457138.1| uracil-DNA glycosylase, family 4 [Brucella ceti M490/95/1]
 gi|256254652|ref|ZP_05460188.1| uracil-DNA glycosylase, family 4 [Brucella ceti B1/94]
 gi|256257151|ref|ZP_05462687.1| uracil-DNA glycosylase, family 4 [Brucella abortus bv. 9 str. C68]
 gi|256264343|ref|ZP_05466875.1| DNA polymerase [Brucella melitensis bv. 2 str. 63/9]
 gi|256369059|ref|YP_003106567.1| phage SPO1 DNA polymerase-related protein [Brucella microti CCM
           4915]
 gi|260168380|ref|ZP_05755191.1| phage SPO1 DNA polymerase-related protein [Brucella sp. F5/99]
 gi|260545657|ref|ZP_05821398.1| DNA polymerase [Brucella abortus NCTC 8038]
 gi|260563676|ref|ZP_05834162.1| DNA polymerase [Brucella melitensis bv. 1 str. 16M]
 gi|260566792|ref|ZP_05837262.1| DNA polymerase [Brucella suis bv. 4 str. 40]
 gi|260754388|ref|ZP_05866736.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260757607|ref|ZP_05869955.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260761433|ref|ZP_05873776.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260883413|ref|ZP_05895027.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|261213634|ref|ZP_05927915.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|261219001|ref|ZP_05933282.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261221827|ref|ZP_05936108.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|261315159|ref|ZP_05954356.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261317285|ref|ZP_05956482.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261321499|ref|ZP_05960696.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261751953|ref|ZP_05995662.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261754611|ref|ZP_05998320.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|261757840|ref|ZP_06001549.1| DNA polymerase [Brucella sp. F5/99]
 gi|265988323|ref|ZP_06100880.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|265990734|ref|ZP_06103291.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265997792|ref|ZP_06110349.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|294851989|ref|ZP_06792662.1| uracil-DNA glycosylase [Brucella sp. NVSL 07-0026]
 gi|297247997|ref|ZP_06931715.1| DNA polymerase bacteriophage-type [Brucella abortus bv. 5 str.
           B3196]
 gi|17983312|gb|AAL52502.1| DNA polymerase, bacteriophage-type [Brucella melitensis bv. 1 str.
           16M]
 gi|23347415|gb|AAN29549.1| phage SPO1 DNA polymerase-related protein [Brucella suis 1330]
 gi|62195714|gb|AAX74014.1| phage SPO1 DNA polymerase-related protein [Brucella abortus bv. 1
           str. 9-941]
 gi|82615613|emb|CAJ10600.1| ATP/GTP-binding site motif A (P-loop):Uracil-DNA glycosylase
           superfamily:Phage SPO1 DNA polymerase-related protein
           [Brucella melitensis biovar Abortus 2308]
 gi|148371753|gb|ABQ61732.1| phage SPO1 DNA polymerase-related protein [Brucella ovis ATCC
           25840]
 gi|161335406|gb|ABX61711.1| uracil-DNA glycosylase, family 4 [Brucella canis ATCC 23365]
 gi|163673618|gb|ABY37729.1| uracil-DNA glycosylase, family 4 [Brucella suis ATCC 23445]
 gi|189019413|gb|ACD72135.1| DNA polymerase, bacteriophage-type [Brucella abortus S19]
 gi|225617962|gb|EEH15006.1| uracil-DNA glycosylase, family 4 [Brucella ceti str. Cudo]
 gi|225640510|gb|ACO00424.1| uracil-DNA glycosylase, family 4 [Brucella melitensis ATCC 23457]
 gi|237789916|gb|EEP64126.1| uracil-DNA glycosylase, family 4 [Brucella abortus str. 2308 A]
 gi|255999219|gb|ACU47618.1| phage SPO1 DNA polymerase-related protein [Brucella microti CCM
           4915]
 gi|260097064|gb|EEW80939.1| DNA polymerase [Brucella abortus NCTC 8038]
 gi|260153692|gb|EEW88784.1| DNA polymerase [Brucella melitensis bv. 1 str. 16M]
 gi|260156310|gb|EEW91390.1| DNA polymerase [Brucella suis bv. 4 str. 40]
 gi|260667925|gb|EEX54865.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260671865|gb|EEX58686.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260674496|gb|EEX61317.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260872941|gb|EEX80010.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|260915241|gb|EEX82102.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|260920411|gb|EEX87064.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|260924090|gb|EEX90658.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261294189|gb|EEX97685.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261296508|gb|EEY00005.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261304185|gb|EEY07682.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261737824|gb|EEY25820.1| DNA polymerase [Brucella sp. F5/99]
 gi|261741706|gb|EEY29632.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261744364|gb|EEY32290.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|262552260|gb|EEZ08250.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|263001518|gb|EEZ14093.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263094617|gb|EEZ18415.1| DNA polymerase [Brucella melitensis bv. 2 str. 63/9]
 gi|264660520|gb|EEZ30781.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|294820578|gb|EFG37577.1| uracil-DNA glycosylase [Brucella sp. NVSL 07-0026]
 gi|297175166|gb|EFH34513.1| DNA polymerase bacteriophage-type [Brucella abortus bv. 5 str.
           B3196]
 gi|326408646|gb|ADZ65711.1| DNA polymerase, bacteriophage-type [Brucella melitensis M28]
 gi|326538367|gb|ADZ86582.1| uracil-DNA glycosylase, family 4 [Brucella melitensis M5-90]
          Length = 290

 Score =  217 bits (552), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 77/281 (27%), Positives = 130/281 (46%), Gaps = 31/281 (11%)

Query: 11  QILTIALFYADSGVYW-VFDEPNNEATY---ESQRKEKSIDSAIQPITNIRH-------- 58
            +  +  FYA++GV   + + P +        +  + +   +A QP +N           
Sbjct: 9   DMEGLLRFYAEAGVDVPLCETPIDRFAAATHPAPAQSRMQAAAQQPESNPAQAREERART 68

Query: 59  -----------------IHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTIC 101
                              +  +  A   A +A +L EL+  L +F  C+L  T+ +   
Sbjct: 69  VAVPSPSSKPVQAAMDLPDNAQIALAREAASQAETLEELREKLAAFDGCNLKFTAKNLCF 128

Query: 102 ATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPP 161
           A      D+M IG  P   +++ G PF GK+G +L++M+++I + R +++I+   PW PP
Sbjct: 129 ADGDPSSDIMFIGEAPGRDEDMEGLPFVGKSGQLLNRMIEAIGLKREEVYIANTIPWRPP 188

Query: 162 GNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCT 221
           GNR  + +E E+CRP I RQIEL +PK+L+ +G           A+   +  G W    T
Sbjct: 189 GNRAPTPLETELCRPFIERQIELAAPKVLVALGGPAGKALTGA-AEGILRLRGNWKIHRT 247

Query: 222 P-HSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
           P    IP + T+HP  L++ P  K+  W   + +K  L  L
Sbjct: 248 PTGMEIPVMPTLHPAYLLRTPAQKRFAWRDFLAVKLKLAEL 288


>gi|256113158|ref|ZP_05454035.1| uracil-DNA glycosylase, family 4 [Brucella melitensis bv. 3 str.
           Ether]
 gi|265994572|ref|ZP_06107129.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|262765685|gb|EEZ11474.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
          Length = 290

 Score =  217 bits (552), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 76/281 (27%), Positives = 129/281 (45%), Gaps = 31/281 (11%)

Query: 11  QILTIALFYADSGVYW-VFDEPNNEATY---ESQRKEKSIDSAIQPITNIRH-------- 58
            +  +  FYA++GV   + + P +        +  + +   +A QP +N           
Sbjct: 9   DMEGLLRFYAEAGVDVPLCETPIDRFAAATHPAPAQSRMQAAAQQPESNPAQAREERART 68

Query: 59  -----------------IHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTIC 101
                              +  +  A   A +A +L EL+  L +F  C+L  T+ +   
Sbjct: 69  VAVPSPSSKPVQAAMDLPDNAQIALAREAASQAETLEELREKLAAFDGCNLKFTAKNLCF 128

Query: 102 ATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPP 161
           A      D+M IG  P   +++ G PF GK+G +L++M+++I + R +++I+   PW PP
Sbjct: 129 ADGDPSSDIMFIGEAPGRDEDMEGLPFVGKSGQLLNRMIEAIGLKREEVYIANTIPWRPP 188

Query: 162 GNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCT 221
           GNR  + +E E+ RP I RQIEL +PK+L+ +G           A+   +  G W    T
Sbjct: 189 GNRAPTPLETELYRPFIERQIELAAPKVLVALGGPAGKALTGA-AEGILRLRGNWKIHRT 247

Query: 222 P-HSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
           P    IP + T+HP  L++ P  K+  W   + +K  L  L
Sbjct: 248 PTGMEIPVMPTLHPAYLLRTPAQKRFAWRDFLAVKLKLAEL 288


>gi|73666677|ref|YP_302693.1| DNA polymerase-related protein [Ehrlichia canis str. Jake]
 gi|72393818|gb|AAZ68095.1| DNA polymerase-related protein [Ehrlichia canis str. Jake]
          Length = 261

 Score =  217 bits (552), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 66/262 (25%), Positives = 128/262 (48%), Gaps = 8/262 (3%)

Query: 7   LSQEQILTIALFYADSGVYWVFDEPN-----NEATYESQRKEKSIDSAIQPITNIRHIHS 61
           +    +L +  FY ++GV    ++       N+            +   + I+   +  +
Sbjct: 1   MDDLDLLEVLKFYHENGVDCTLEDIQYHVLKNKNLSLQDTDSIKSNLEGKKISMKENTET 60

Query: 62  PLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSD 121
             + +A S+A+K  ++ +LKS + SF  C + + + +T+ A      ++M+IG  P  ++
Sbjct: 61  YYLLKAQSLAEKCNNIEQLKSAIESFDGCDIKNLATNTVFADGNPKAEMMLIGEAPGANE 120

Query: 122 NISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQ 181
           ++ G PF G +G +LDKML++I   RT ++IS    W PPGNR  ++ E+ +C+P + + 
Sbjct: 121 DLKGIPFCGASGMLLDKMLKAIGFDRTTVYISNAVFWRPPGNRRPTDFEIAVCKPFVEKH 180

Query: 182 IELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPH--SIIPTLATVHPQELIQ 239
           I LI PK+L+ +G+       ++      +  G++         + I T    HP  L++
Sbjct: 181 IALIIPKMLVLVGSTACYAMLDSK-NPISKLRGRFHLYNNQFLQNSITTSIIFHPSYLLR 239

Query: 240 YPLIKKNTWHALITLKKALKNL 261
            P+ K+  W  L  +K+    L
Sbjct: 240 QPMQKRIAWEDLKQIKRYFDGL 261


>gi|254487011|ref|ZP_05100216.1| uracil-DNA glycosylase, C-terminal domain protein [Roseobacter sp.
           GAI101]
 gi|214043880|gb|EEB84518.1| uracil-DNA glycosylase, C-terminal domain protein [Roseobacter sp.
           GAI101]
          Length = 257

 Score =  216 bits (551), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 62/260 (23%), Positives = 116/260 (44%), Gaps = 11/260 (4%)

Query: 5   RILSQEQILTIALFYADSGV-YWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPL 63
             +   Q L +  +  + G    + D P N     +  ++                    
Sbjct: 2   ESVEYHQALALLHWQIELGATEAICDAPVNRYEVPAAVEKPKPAKPGPGRVVPMAAGIDP 61

Query: 64  VQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNI 123
           + +A   A  A +L +L++ +++F  C L   + + + +  T G  +MI+G  P   ++ 
Sbjct: 62  LAEATRFAAAAQTLEDLRAAMQAFEHCELKRGARNMVFSDGTPGARVMIVGEAPGRDEDR 121

Query: 124 SGKPFSGKTGNMLDKMLQSIEIMRTQ----IHISMISPWHPPGNRNLSNIEMEICRPIIM 179
            G+PF G  G +LD+ML +I++ RT     ++I+ + PW PP NR+    E+ + +P ++
Sbjct: 122 EGRPFVGAAGQLLDRMLAAIDMGRTHADAPVYITNVLPWRPPQNRDPKPDEIAMMKPFLI 181

Query: 180 RQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ 239
           R IEL  P++L+ +GN               +  G+W+ +      +  L   HP  L++
Sbjct: 182 RHIELAKPEVLVIVGNWAAQALLGKRG--ITRLRGQWAQVQ----GLAALPMFHPAYLLR 235

Query: 240 YPLIKKNTWHALITLKKALK 259
            P  K+  W  L+ LK  L 
Sbjct: 236 SPEFKREAWADLLELKARLA 255


>gi|260431599|ref|ZP_05785570.1| uracil-DNA glycosylase [Silicibacter lacuscaerulensis ITI-1157]
 gi|260415427|gb|EEX08686.1| uracil-DNA glycosylase [Silicibacter lacuscaerulensis ITI-1157]
          Length = 279

 Score =  216 bits (550), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 64/261 (24%), Positives = 117/261 (44%), Gaps = 9/261 (3%)

Query: 1   MTSKRILSQEQILTIALFYADSGV-YWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHI 59
           M  +  L       +  +  + GV   + D P +         +    +        + +
Sbjct: 24  MGMESALDPFTARALLEWQVELGVTDAIVDTPVDRYALPDTAPKARKAATPLAAPQ-KPV 82

Query: 60  HSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSD 119
               V +A   A  A SL +L++ + +F  C L   +   + A  T G  +MI+G  P  
Sbjct: 83  KLDPVAEAKKAAAAASSLDQLRAAMETFAHCDLKRGARQLVFADGTAGAPVMIVGEAPGR 142

Query: 120 SDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPII 178
            ++  G+PF G+ G +LD+ML +I++ R   ++I+ + PW PP NR+    E+ + +P +
Sbjct: 143 EEDRVGRPFVGRAGQLLDRMLAAIDLDRAKNVYITNVLPWRPPQNRDPRPDEIAMMQPFV 202

Query: 179 MRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELI 238
            R + L  PK+L+ +GN +     N       +  G+W         +P L  +HP  L+
Sbjct: 203 ERHVALSKPKVLVVMGNISCQAVLNKRG--ITRLRGQW----NQALNLPVLPMLHPAYLL 256

Query: 239 QYPLIKKNTWHALITLKKALK 259
           + P  K+  W  L+ L+  L+
Sbjct: 257 RQPHAKRQAWADLLELRAFLE 277


>gi|126727771|ref|ZP_01743601.1| hypothetical protein RB2150_10424 [Rhodobacterales bacterium
           HTCC2150]
 gi|126702898|gb|EBA02001.1| hypothetical protein RB2150_10424 [Rhodobacterales bacterium
           HTCC2150]
          Length = 264

 Score =  216 bits (550), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 62/268 (23%), Positives = 118/268 (44%), Gaps = 16/268 (5%)

Query: 3   SKRILSQEQILTIALFYADSGV-YWVFDEPNNEATYESQRKEKSIDS------AIQPITN 55
            + +        +  +  D GV   + D P N      +  +    +        +P   
Sbjct: 1   MESVFDYHSARAMLEWQIDLGVTETISDAPINRFEAVQEPVKPKATATVENGKPTKPAPP 60

Query: 56  IRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGY 115
           ++ +    V +A  +A +A +L EL  +   F  C L   +   + A       L+I+G 
Sbjct: 61  VKPVAVDAVAEAQKLADQATTLEELAKIQSEFEMCDLKKGARKFVFADGNPKSRLLILGE 120

Query: 116 TPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR---TQIHISMISPWHPPGNRNLSNIEME 172
            P   ++  G+PF+G+ G +LDKML +I++ R      +++ + PW PP NR+ S  E+ 
Sbjct: 121 APGRDEDQQGRPFAGEAGQLLDKMLAAIDMDRTGENSAYVTNVMPWRPPQNRDPSVEEIA 180

Query: 173 ICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATV 232
           +  P + + IEL+SP +++ +GN       +       +  G W+         P +   
Sbjct: 181 MMMPFVSKHIELVSPDVVILMGNVACLAALSKKG--ITRLRGNWATAFER----PVMPIF 234

Query: 233 HPQELIQYPLIKKNTWHALITLKKALKN 260
           HP  L++ P+ K++ W  L+ ++  LK 
Sbjct: 235 HPAYLLRTPVAKRDAWADLLAVQAKLKK 262


>gi|190891014|ref|YP_001977556.1| DNA-directed DNA polymerase (uracil-DNA glycosylase) [Rhizobium
           etli CIAT 652]
 gi|190696293|gb|ACE90378.1| probable DNA-directed DNA polymerase protein (uracil-DNA
           glycosylase) [Rhizobium etli CIAT 652]
          Length = 296

 Score =  216 bits (550), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 91/292 (31%), Positives = 142/292 (48%), Gaps = 32/292 (10%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVFDEP-NNEATY---------------------- 37
           M S   LS  ++  +  F+AD+GV W+ +E   +                          
Sbjct: 1   MISANDLSPAELAALLHFHADAGVEWLLEEEAVDRFAEFEAMKAARRPASAQQERPAAGE 60

Query: 38  --------ESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHD 89
                    S R   +   A              VQQA  +A+ A SL ELK+ + +F+ 
Sbjct: 61  RPSVGERQTSPRPTAAARPAPVSGPQPAIPDGEAVQQARFVAEAARSLGELKTAIEAFNG 120

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C+L  ++ STI A+      +M+IG  PS  D+  G PFSGK+G + DKML +I + R+ 
Sbjct: 121 CNLKHSARSTIFASGDAESGIMVIGSAPSAEDDREGLPFSGKSGQLFDKMLAAIGLNRSS 180

Query: 150 IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKT 209
           + ++ + PW PPGNR  S  E++ICRP I RQI L  P+ +L +GN    FF   +    
Sbjct: 181 VLLTQVIPWRPPGNRAASAAEIDICRPFIERQIALAEPQAILLLGNFAARFFLGENDTIH 240

Query: 210 YQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
               G+W ++      IP +A++HPQ+L+  P+ K+  W+ L+  +  LK+L
Sbjct: 241 G-LRGRWKDIVIADRAIPAIASLHPQDLLTAPVNKRLAWNDLLAFQAKLKSL 291


>gi|163796468|ref|ZP_02190428.1| Phage SPO1 DNA polymerase-related protein [alpha proteobacterium
           BAL199]
 gi|159178318|gb|EDP62862.1| Phage SPO1 DNA polymerase-related protein [alpha proteobacterium
           BAL199]
          Length = 285

 Score =  216 bits (549), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 77/273 (28%), Positives = 135/273 (49%), Gaps = 21/273 (7%)

Query: 8   SQEQILTIALFYADSGVYW-VFDEPNNEATYESQRKE-KSIDSAIQPITNIRHIHSPLVQ 65
           S+     +  +Y D+GV   + D   +         +  ++ +A +P+  +     P  +
Sbjct: 4   SRAAARALLGWYVDAGVDEPMGDIAVDRFASVRPPPQIPTVAAAAKPVATVAQQAEPQAR 63

Query: 66  Q---------------ADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDL 110
                           A S A  A +L EL+ +L++F  C L  T+ +T+ A    G  +
Sbjct: 64  PTRPARAAPVDGSLGAARSAAFSAKTLEELRGILQAFDGCPLKVTATNTVFADGVPGAPV 123

Query: 111 MIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQI-HISMISPWHPPGNRNLSNI 169
           M++G  P   ++ +G+PF G +G +LD+ML +I + R +  +IS + PW PPGNRN ++ 
Sbjct: 124 MVVGEAPGADEDRAGRPFVGLSGQLLDRMLATIGLDRQRNVYISNVLPWRPPGNRNPTDN 183

Query: 170 EMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTP--HSIIP 227
           EM +C P I R IEL +P++L+ +G  +     +   +   +  G+W +   P   + +P
Sbjct: 184 EMAMCLPFIQRHIELAAPRVLVLVGGTSVKTLLD-RQEGITRLRGRWFDWQGPSAAAAVP 242

Query: 228 TLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
            LAT HP  L++ P  K + W  L+ LK+ L  
Sbjct: 243 ALATYHPAYLLRSPGQKASAWKDLLALKRWLVE 275


>gi|90420838|ref|ZP_01228743.1| uracil-DNA glycosylase, phage SPO1 DNA polymerase-related protein
           [Aurantimonas manganoxydans SI85-9A1]
 gi|90334813|gb|EAS48585.1| uracil-DNA glycosylase, phage SPO1 DNA polymerase-related protein
           [Aurantimonas manganoxydans SI85-9A1]
          Length = 306

 Score =  216 bits (549), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 72/295 (24%), Positives = 127/295 (43%), Gaps = 40/295 (13%)

Query: 5   RILSQEQILTIALFYADSGVYWVF-DEPNNEATY-------------------------- 37
             + +E  + +  +Y  +GV  V  + P +                              
Sbjct: 8   HPIDREAAIALLEWYRAAGVDAVTGEHPRDRFAETQAEIAARKARRGQPAGVAPAATGEP 67

Query: 38  ---------ESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFH 88
                       R  +  +    P   I       V  A   A+ A +L EL++ L  F 
Sbjct: 68  PRPAQEARVAPARTPQPAEEPGFPAPRIAVPDDIAVADARERARSATTLAELRAALDDFD 127

Query: 89  DCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRT 148
            C+L  ++ ST+    +E  D+M++G  P   ++ +G PF G++G +L++ML+SI + R 
Sbjct: 128 GCNLRISARSTVFGDGSETADVMLVGEAPGREEDTAGVPFVGRSGQLLNRMLESIGLERE 187

Query: 149 QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQK 208
            + ++   PW PPGNR  +  E +IC P + R IEL++PKIL+ +G+ +         + 
Sbjct: 188 AVRVTNTVPWRPPGNRPPTPAETQICLPFVQRHIELVAPKILVCLGSPSAKAILGAQ-EG 246

Query: 209 TYQNLGKWSNLCTP---HSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
             +  G+W+           I  +A +HP  L++ P  K+  W  LI L++ L  
Sbjct: 247 ILRVRGRWTTYSFGLEQCDAIDAVAMLHPAYLLRQPAQKRLAWRDLIALRERLAQ 301


>gi|254780743|ref|YP_003065156.1| putative uracil-DNA glycosylase [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040420|gb|ACT57216.1| putative uracil-DNA glycosylase [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 261

 Score =  216 bits (549), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 261/261 (100%), Positives = 261/261 (100%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIH 60
           MTSKRILSQEQILTIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIH
Sbjct: 1   MTSKRILSQEQILTIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIH 60

Query: 61  SPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDS 120
           SPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDS
Sbjct: 61  SPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDS 120

Query: 121 DNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMR 180
           DNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMR
Sbjct: 121 DNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMR 180

Query: 181 QIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQY 240
           QIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQY
Sbjct: 181 QIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQY 240

Query: 241 PLIKKNTWHALITLKKALKNL 261
           PLIKKNTWHALITLKKALKNL
Sbjct: 241 PLIKKNTWHALITLKKALKNL 261


>gi|298290634|ref|YP_003692573.1| phage SPO1 DNA polymerase-related protein [Starkeya novella DSM
           506]
 gi|296927145|gb|ADH87954.1| phage SPO1 DNA polymerase-related protein [Starkeya novella DSM
           506]
          Length = 295

 Score =  215 bits (548), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 77/289 (26%), Positives = 126/289 (43%), Gaps = 29/289 (10%)

Query: 1   MTSKRILSQEQILT-IALFYADSGVYWVF-DEPNNEATYESQRKEKSIDSAIQPIT---- 54
           +     L+   +L  I  F+ ++GV     ++P +  T  +  +  +    +   +    
Sbjct: 2   LLMAPTLNDRDVLADILAFHVEAGVDVALGEQPVDRFTESAAERSAAAGRVVLAPSAESA 61

Query: 55  ----------------------NIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHL 92
                                            +A   A  A +L  L++LL  F  C L
Sbjct: 62  PAPRPAPPVPAAHRPATPALAGEAPPPPDLAAVEAREAAASAPTLEALEALLEKFDGCPL 121

Query: 93  CSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHI 152
             T+   + A       LM++G  P   ++I GKPF G++G +LD+ML +I I RT  +I
Sbjct: 122 KHTATRLVFADGNPQARLMLVGEAPGRDEDIEGKPFVGRSGKLLDRMLAAIGIDRTTAYI 181

Query: 153 SMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQN 212
           + + PW PPGNR  +  E  IC P I RQIEL +P +L+ +G  +             + 
Sbjct: 182 ANVVPWRPPGNRTPTPQETAICLPFICRQIELANPDVLVCLGGPSAQTLLGIR-DGITKA 240

Query: 213 LGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
            G+W +  T   +IP LAT HP  L++ PL K+  W  ++ ++  L  L
Sbjct: 241 RGRWMDYDTGSRVIPALATFHPAYLLRSPLGKRMAWRDMLAIEARLAGL 289


>gi|218675319|ref|ZP_03524988.1| probable DNA-directed DNA polymerase protein (uracil-DNA
           glycosylase) [Rhizobium etli GR56]
          Length = 296

 Score =  215 bits (548), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 90/292 (30%), Positives = 141/292 (48%), Gaps = 32/292 (10%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVFDEP-NNEATYES-------------------- 39
           M S   LS  ++  +  F+AD+GV W+ +E   +                          
Sbjct: 1   MISANDLSPAELAALLHFHADAGVEWLLEEEAVDRFAEFEAMKAARRPASAQQERPAVGE 60

Query: 40  ----------QRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHD 89
                      R   +   A              VQQA  +A+ A SL ELK+ + +F+ 
Sbjct: 61  RPNSGERQTLPRPTAAARPAPVSGPQPAIPDGEAVQQARFVAEAARSLAELKTAIEAFNG 120

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C+L  ++ STI A+      +M+IG  PS  D+  G PFSGK+G + DKML +I + R+ 
Sbjct: 121 CNLKHSARSTIFASGDAESGIMVIGSAPSAEDDREGLPFSGKSGQLFDKMLAAIGLNRSS 180

Query: 150 IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKT 209
           + ++ + PW PPGNR  S  E++ICRP I RQI L  P+ +L +GN    FF   +    
Sbjct: 181 VLLTQVIPWRPPGNRAASAAEIDICRPFIERQIALAEPQAILLLGNFAARFFLGENDTIH 240

Query: 210 YQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
               G+W ++      IP +A++HPQ+L+  P+ K+  W+ L+  +  LK+L
Sbjct: 241 G-LRGRWKDIVIADRAIPAIASLHPQDLLTAPVNKRLAWNDLLAFQAKLKSL 291


>gi|170743515|ref|YP_001772170.1| phage SPO1 DNA polymerase-related protein [Methylobacterium sp.
           4-46]
 gi|168197789|gb|ACA19736.1| phage SPO1 DNA polymerase-related protein [Methylobacterium sp.
           4-46]
          Length = 300

 Score =  215 bits (548), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 76/297 (25%), Positives = 120/297 (40%), Gaps = 45/297 (15%)

Query: 8   SQEQILTIALFYADSGVYWVFDE-PNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQ 66
               +L    F+  +GV    DE P++     + R   + +S   P +       P  + 
Sbjct: 3   DDRDLLAYLDFHVAAGVDAALDEAPHDRFAESASRGRPASESRPAPESRPAPEPRPTPES 62

Query: 67  -------------------------------------------ADSIAQKACSLHELKSL 83
                                                      A  +A+ A +L EL+ L
Sbjct: 63  RPTPEPRPAAEPVPAPAAAPRPPARASTFGRSAAAEPGEAAGDARELARTAATLEELEQL 122

Query: 84  LRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSI 143
           L  F  C L  T+ + + A       +M +G  P   ++  GKPF G++G +LD+M+ +I
Sbjct: 123 LARFESCPLRFTAKNLVFADGEPTARVMFVGEAPGADEDRVGKPFMGRSGQLLDRMMAAI 182

Query: 144 EIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFN 203
            + RT  ++  + PW PPGNRN +  E+  C+P I RQI L  P IL+ +G         
Sbjct: 183 GLDRTNAYVGNVVPWRPPGNRNPTPQEIATCKPFIERQIALADPDILVCLGGVATQT-LA 241

Query: 204 NDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
                  ++ G+W    T    I  LAT+HP  L++ PL K+  W     L+ AL  
Sbjct: 242 ATKDGILKSRGRWFPYRTERREIRLLATLHPAYLLRQPLQKRLAWRDFRVLRAALDA 298


>gi|56695203|ref|YP_165551.1| uracil-DNA glycosylase [Ruegeria pomeroyi DSS-3]
 gi|56676940|gb|AAV93606.1| uracil-DNA glycosylase [Ruegeria pomeroyi DSS-3]
          Length = 261

 Score =  215 bits (548), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 64/266 (24%), Positives = 115/266 (43%), Gaps = 14/266 (5%)

Query: 3   SKRILSQEQILTIALFYADSGV-YWVFDEPNNEATYES------QRKEKSIDSAIQPITN 55
            +  L     L +  +  + GV   + D P +             +          P   
Sbjct: 1   MESALDPHTALALLQWQVELGVTETILDAPLDRYALPETAPRPPAQAAADPRRPAMPAPP 60

Query: 56  IRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGY 115
            +       Q+A   A+   SL  L++ L  F  C L   + + + A    G  +MIIG 
Sbjct: 61  PKAPEVDPAQEAVRAARAVGSLDALRTALAEFEHCELKRGARNLVFADGVPGARVMIIGE 120

Query: 116 TPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQI-HISMISPWHPPGNRNLSNIEMEIC 174
            P   ++  G+PF G+ G +LD+ML +I + R++  +I+ + PW PP NR+   +E+ + 
Sbjct: 121 APGRDEDREGRPFVGRAGQLLDRMLAAIGLSRSESVYITNVLPWRPPQNRDPLPVEIGMM 180

Query: 175 RPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHP 234
           +P + R + L  P++L+ +GN +             +  G+W    T    +P L   HP
Sbjct: 181 KPFLERHVALAKPEVLVLMGNISCETVLGRRG--ITRLRGQW----TQAMGLPVLPMFHP 234

Query: 235 QELIQYPLIKKNTWHALITLKKALKN 260
             L++ P +K+  W  L+ L+  L+ 
Sbjct: 235 AYLLRQPQMKRQAWADLLELQAKLRE 260


>gi|89070681|ref|ZP_01157950.1| uracil-DNA glycosylase [Oceanicola granulosus HTCC2516]
 gi|89043702|gb|EAR49906.1| uracil-DNA glycosylase [Oceanicola granulosus HTCC2516]
          Length = 261

 Score =  215 bits (548), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 58/256 (22%), Positives = 105/256 (41%), Gaps = 13/256 (5%)

Query: 11  QILTIALFYADSGVYWVF-DEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADS 69
                  +  + G      D P +    ++ R + +   A      +       V +A  
Sbjct: 9   AAKAALDWQIELGADEAIGDAPVDRYALDAARAKPTAPVAAPNAVPVPAAPDDPVAEARR 68

Query: 70  IAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFS 129
           +A  A  L  L + +  F  C L + + S +         LMI+G  P   ++ +G+PF 
Sbjct: 69  LAAGARDLGGLAAAMEGFEHCALKAGARSFVFCDGNPDARLMIVGEAPGREEDRAGRPFV 128

Query: 130 GKTGNMLDKMLQSIEIMRTQI------HISMISPWHPPGNRNLSNIEMEICRPIIMRQIE 183
           G+ G +LD+ML +I + R         +I+ + PW PP NR     E+ +  P +   I 
Sbjct: 129 GRAGQLLDRMLAAIGMARAAPDAAHAVYITNVLPWRPPENRRPERAEIAMFLPFLEAHIA 188

Query: 184 LISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLI 243
           L  P++L+ +GN   +           +  G W+ +      +P L   HP  L++ P  
Sbjct: 189 LARPEVLVLMGNTPCDALLGRSG--ITRMRGSWTEV----LGVPALPMFHPAFLLRQPQA 242

Query: 244 KKNTWHALITLKKALK 259
           K+  W  L+ ++  L+
Sbjct: 243 KREAWADLLDVQARLR 258


>gi|153009985|ref|YP_001371200.1| phage SPO1 DNA polymerase-like protein [Ochrobactrum anthropi ATCC
           49188]
 gi|151561873|gb|ABS15371.1| phage SPO1 DNA polymerase-related protein [Ochrobactrum anthropi
           ATCC 49188]
          Length = 285

 Score =  214 bits (546), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 83/276 (30%), Positives = 128/276 (46%), Gaps = 26/276 (9%)

Query: 11  QILTIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHI----------- 59
            I  +  FYA++G+     E   +   E QR   S  +A  P +  R             
Sbjct: 9   DIEGLLRFYAEAGIDMPLSETPIDRFAEPQRPASSQPTAQMPNSPERARQQQPRPAPAPA 68

Query: 60  -HSPLVQQADSIAQKAC------------SLHELKSLLRSFHDCHLCSTSLSTICATQTE 106
             S  VQ A  +   A             +L EL+  L +F  C+L  T+ +   A    
Sbjct: 69  PTSKPVQAAADLPDTAQIALAREAAAQASTLEELREKLAAFDGCNLKFTAKNLCFADGDP 128

Query: 107 GQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNL 166
             D+M IG  P   +++ G PF GK+G +L++M++SI++ R  ++I+   PW PPGNR  
Sbjct: 129 SSDIMFIGQAPGRDEDMEGLPFVGKSGQLLNRMIESIDLKRESVYIANTIPWRPPGNRTP 188

Query: 167 SNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHS-I 225
           + +E E+CRP I RQIEL SPK+L+ +G            +   +  G W    TP+   
Sbjct: 189 TPLETELCRPFIERQIELASPKVLVALGGPAGKALTGAT-EGILRLRGNWKIHRTPNGLE 247

Query: 226 IPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
           IP + T+HP  L++ P  K+  W   + +K  L  L
Sbjct: 248 IPVMPTLHPAYLLRTPAQKRFAWRDFLAVKLKLAEL 283


>gi|83952423|ref|ZP_00961154.1| uracil-DNA glycosylase [Roseovarius nubinhibens ISM]
 gi|83836096|gb|EAP75394.1| uracil-DNA glycosylase [Roseovarius nubinhibens ISM]
          Length = 267

 Score =  214 bits (546), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 65/272 (23%), Positives = 112/272 (41%), Gaps = 19/272 (6%)

Query: 3   SKRILSQEQILTIALFYADSGVYWVF-DEPNNEATYESQRKEKSIDSAIQ------PITN 55
               L       +  +  + G      D P +    E +  + +  +A         +  
Sbjct: 1   MDSALDFHTARALLEWQVELGADEAIGDSPVDRYALEPRAPKPATPAAAPSPAEAAKLPP 60

Query: 56  IRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGY 115
           +    +  V +A   A  A  L  LK+ +  +  C L   +   + +    G  +M+IG 
Sbjct: 61  VAAPKTDPVAEARKSALAAQDLAGLKAAMAGYEHCELKRGARQLVFSDGHPGARVMLIGE 120

Query: 116 TPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR------TQIHISMISPWHPPGNRNLSNI 169
            P   ++ +GKPF G+ G MLD+ML +I + R         +I+ + PW PP NR+ S  
Sbjct: 121 APGRDEDRAGKPFVGQAGQMLDRMLAAIGLDRGSDDPGQGAYITNVMPWRPPQNRDPSPE 180

Query: 170 EMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTL 229
           E+ +  P + R + L +P +LL +GN +             +  G W+         P L
Sbjct: 181 EIAMMVPFMERHVALANPDLLLLVGNISCQAGLGKRG--ITRLRGNWTEAYGK----PAL 234

Query: 230 ATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
              HP  L++ P  K+  W  L++LK  L+ L
Sbjct: 235 PIFHPAYLLRMPSAKREAWADLLSLKARLQGL 266


>gi|327193963|gb|EGE60838.1| putative DNA-directed DNA polymerase protein (uracil-DNA
           glycosylase) [Rhizobium etli CNPAF512]
          Length = 296

 Score =  214 bits (546), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 91/292 (31%), Positives = 142/292 (48%), Gaps = 32/292 (10%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVFDEP-NNEATY---------------------- 37
           M S   LS  ++  +  F+AD+GV W+ +E   +                          
Sbjct: 1   MISANDLSPAELAALLHFHADAGVEWLLEEEAVDRFAEFEAMKAARRPASAQQERPAAGE 60

Query: 38  --------ESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHD 89
                    S R   +   A              VQQA  +A+ A SL ELK+ + +F+ 
Sbjct: 61  SPSVGERQTSPRLTAAARPAPVSGPQPAIPDGEAVQQARFVAEAARSLGELKTAIEAFNG 120

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C+L  ++ STI A+      +M+IG  PS  D+  G PFSGK+G + DKML +I + R+ 
Sbjct: 121 CNLKHSARSTIFASGDAESGIMVIGSAPSAEDDREGLPFSGKSGQLFDKMLAAIGLNRSS 180

Query: 150 IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKT 209
           + ++ + PW PPGNR  S  E++ICRP I RQI L  P+ +L +GN    FF   +    
Sbjct: 181 VLLTQVIPWRPPGNRAASAAEIDICRPFIERQIALAEPQAILLLGNFAARFFLGENDTIH 240

Query: 210 YQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
               G+W ++      IP +A++HPQ+L+  P+ K+  W+ L+  +  LK+L
Sbjct: 241 G-LRGRWKDIVIADRAIPAIASLHPQDLLTAPVNKRLAWNDLLAFQAKLKSL 291


>gi|85859396|ref|YP_461598.1| uracil DNA glycosylase superfamily protein [Syntrophus
           aciditrophicus SB]
 gi|85722487|gb|ABC77430.1| uracil DNA glycosylase superfamily protein [Syntrophus
           aciditrophicus SB]
          Length = 263

 Score =  214 bits (546), Expect = 8e-54,   Method: Composition-based stats.
 Identities = 51/237 (21%), Positives = 103/237 (43%), Gaps = 6/237 (2%)

Query: 26  WVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQ--ADSIAQKACSLHELKSL 83
           W    P +  T E  +K   +   +    + + +   L+             +L +++  
Sbjct: 29  WELRHPLSWTTAEGDQKSPFLGMKLASGVHEQDVKESLISSDITGPADNPLETLDDIRRD 88

Query: 84  LRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSI 143
           + + H C L  T  + +        +L+ +G  P   +++ G+PF G+ G++L +++ ++
Sbjct: 89  MEACHRCPLEKTRKNLVFGEGNPHSELVFVGEAPGADEDLQGRPFVGRAGHLLTRIIDAM 148

Query: 144 EIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFN 203
            + R  ++I  I    PPGNRN    E+E+C P ++RQ+E I P+I+  +G         
Sbjct: 149 GLKREDVYICNILKCRPPGNRNPLPEEIEVCEPWLIRQLEAIRPRIICALGTFAAQTLLK 208

Query: 204 NDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
                     G++ +       I  + T HP  L++ P  K+  W  +  + K L+ 
Sbjct: 209 KKGIPITVLRGQFHDY----HGIKLMPTYHPAYLLRNPGAKRQVWEDVQKIMKVLEA 261


>gi|209548539|ref|YP_002280456.1| phage SPO1 DNA polymerase-related protein [Rhizobium leguminosarum
           bv. trifolii WSM2304]
 gi|209534295|gb|ACI54230.1| phage SPO1 DNA polymerase-related protein [Rhizobium leguminosarum
           bv. trifolii WSM2304]
          Length = 299

 Score =  214 bits (544), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 97/295 (32%), Positives = 149/295 (50%), Gaps = 35/295 (11%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVFDE-----------------PNNEATYESQ--- 40
           M S   LS  ++  +  F+AD+GV W+ +E                 P  +    +    
Sbjct: 1   MISANDLSPAELAALLHFHADAGVEWLLEEEAIDRFAEFEAMKAARRPAAQTQPSAAGER 60

Query: 41  ------RKEKSIDSAIQPITNIRHIHSP--------LVQQADSIAQKACSLHELKSLLRS 86
                 R      +A++P    R    P         VQQA  +A+ A SL ELK+ + +
Sbjct: 61  TPLGENRTPPRPATAVRPAPAERAASGPQPAIPDGEAVQQARFVAESARSLAELKTAIEA 120

Query: 87  FHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIM 146
           F+ C+L  ++ STI A+      +M+IG  P   D+  G PFSGK+G + DKML +I + 
Sbjct: 121 FNGCNLKHSARSTIFASGDAESGIMVIGSAPGAEDDREGVPFSGKSGQLFDKMLAAIGLT 180

Query: 147 RTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDA 206
           R+ I ++ + PW PPGNR  S  EM+ICRP I RQI L  PK +L +GN +  FFF  + 
Sbjct: 181 RSVILLTQVIPWRPPGNRAPSAAEMDICRPFIERQIALAQPKAILLLGNFSARFFFGEND 240

Query: 207 QKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
                  G+W  +     +IP +A++HPQ+L+  P+ K+  W+ L+  +  LK+L
Sbjct: 241 TIHG-LRGRWKEIAAADCVIPAIASLHPQDLLTAPVNKRLAWNDLLAFQAKLKSL 294


>gi|154246315|ref|YP_001417273.1| phage SPO1 DNA polymerase-related protein [Xanthobacter
           autotrophicus Py2]
 gi|154160400|gb|ABS67616.1| phage SPO1 DNA polymerase-related protein [Xanthobacter
           autotrophicus Py2]
          Length = 307

 Score =  214 bits (544), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 76/306 (24%), Positives = 123/306 (40%), Gaps = 47/306 (15%)

Query: 1   MTSKRILSQEQ----ILTIALFYADSGVY-WVFDEPNNEATYESQRKEKS---------- 45
           MT+      E     I  I  FY ++GV   V + P +     +  + +S          
Sbjct: 1   MTATPQDHPEDHLSDIADILAFYLEAGVDVAVGEAPVDRFAESAAEQARSRTQRPPAVPA 60

Query: 46  -------------------------------IDSAIQPITNIRHIHSPLVQQADSIAQKA 74
                                            SA      +       V  A   A+ A
Sbjct: 61  PDMPPPPTVSRPQASARPAPPAAPAPRSGTLSASAAGASALVTQPPDEAVMSAREAARNA 120

Query: 75  CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
            SL  L+++L  F  C L  T+   + A       +M +G  P   ++  G PF G++G 
Sbjct: 121 ESLDALRAILDGFEGCALKRTATRLVFADGNPKAKVMFVGEAPGRDEDQQGLPFVGRSGR 180

Query: 135 MLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           +LD M+ +I + RT  +I+ + PW PPGNR  +  E  +C P I RQIEL  P IL+ +G
Sbjct: 181 LLDLMMAAIGLDRTSAYIANVIPWRPPGNRTPTPQETAVCLPFIKRQIELADPDILVCLG 240

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITL 254
             +         +   +  G++ +  +    I  +AT HP  L++ PL K+  W  ++ +
Sbjct: 241 GPSAQALLA-TTEGITRLRGRFMDYESGTRTIRAIATFHPAYLLRTPLGKRLAWRDMLAV 299

Query: 255 KKALKN 260
           + AL N
Sbjct: 300 EAALAN 305


>gi|110680596|ref|YP_683603.1| uracil-DNA glycosylase, C-terminal [Roseobacter denitrificans OCh
           114]
 gi|109456712|gb|ABG32917.1| uracil-DNA glycosylase, C-terminal [Roseobacter denitrificans OCh
           114]
          Length = 259

 Score =  213 bits (543), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 65/260 (25%), Positives = 117/260 (45%), Gaps = 13/260 (5%)

Query: 8   SQEQILTIALFYADSGV-YWVFDEPNNEATYES--QRKEKSIDSAIQPITNIRHIHSPLV 64
                L +  +  + G    + + P N        Q K+K+  + + P        +  V
Sbjct: 5   DFHHALALLDWQIELGATEAIGETPVNRYDLPDKIQPKQKAAQTTVAPAAARAAEKTDPV 64

Query: 65  QQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNIS 124
             A   A  A  L +L++ L  F  C L   + + + +    G  +M+IG  P   +++ 
Sbjct: 65  DAARKAAFAAQDLDQLRAALAGFEHCDLKRGARNLVFSDGVAGARVMVIGEAPGREEDLQ 124

Query: 125 GKPFSGKTGNMLDKMLQSIEIMR----TQIHISMISPWHPPGNRNLSNIEMEICRPIIMR 180
           G+PF G+ G +LD+ML +I++ R      ++I+ + PW PP NR+ S+ E+ + RP + R
Sbjct: 125 GRPFVGRAGQLLDRMLAAIDMGRDRQSDPVYITNVVPWRPPQNRDPSSDEIAMMRPFVER 184

Query: 181 QIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQY 240
            I L  P++L+ +GN +             +  G+W         +P L   HP  L++ 
Sbjct: 185 HIALAKPEVLVIMGNVSAQALLGKRG--ITRLRGQWVEAF----GVPALPMFHPAYLLRN 238

Query: 241 PLIKKNTWHALITLKKALKN 260
              K+  W  L++L+  L N
Sbjct: 239 TAAKREAWADLLSLQARLHN 258


>gi|254467145|ref|ZP_05080556.1| uracil-DNA glycosylase [Rhodobacterales bacterium Y4I]
 gi|206688053|gb|EDZ48535.1| uracil-DNA glycosylase [Rhodobacterales bacterium Y4I]
          Length = 250

 Score =  213 bits (541), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 66/257 (25%), Positives = 112/257 (43%), Gaps = 10/257 (3%)

Query: 7   LSQEQILTIALFYADSGV-YWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQ 65
           +       +  + A+ G    + D P +    E    +    +A  P    +      V 
Sbjct: 1   MDYWSARALLEWQAELGATEALCDAPVDRYALEQAAPKPKPGAAPAPPPKPKEADPAEV- 59

Query: 66  QADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISG 125
            A   A+ A SL  L+  L +F  C L   + + + +    G  +MIIG  P   +++ G
Sbjct: 60  -AQKAARGAASLPALRDALAAFDHCDLKRGARNLVFSDGQPGARVMIIGEAPGRDEDLQG 118

Query: 126 KPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIEL 184
           KPF G+ G +LD+ML++I + R   ++I+ + PW PP NR+    E+ +  P + R + L
Sbjct: 119 KPFVGRAGQLLDRMLEAIGLSRAENVYITNVLPWRPPQNRDPLPAEIAMLTPFLERHVAL 178

Query: 185 ISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIK 244
             P IL+ +GN +             +  G+W          P +   HP  L++ P  K
Sbjct: 179 AEPDILVLMGNISCQAVLGKRG--ITRLRGQWDQAWNK----PVIPMFHPAYLLRQPAQK 232

Query: 245 KNTWHALITLKKALKNL 261
           +  W  L+ LK  L +L
Sbjct: 233 RLAWADLLELKARLGSL 249


>gi|118590804|ref|ZP_01548205.1| hypothetical protein SIAM614_06538 [Stappia aggregata IAM 12614]
 gi|118436780|gb|EAV43420.1| hypothetical protein SIAM614_06538 [Stappia aggregata IAM 12614]
          Length = 320

 Score =  212 bits (540), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 73/298 (24%), Positives = 125/298 (41%), Gaps = 46/298 (15%)

Query: 8   SQEQILTIALFYADSGVYWVF-DEPNNEATYESQRKEKSIDSAIQ--------------- 51
               +  +  FYA +GV     D+P +       +  +   +  Q               
Sbjct: 20  DPRHLEALLDFYAGAGVDCFLQDDPVDWVALTRAQAAQRAQAGSQVASSAQPQQPRQQTP 79

Query: 52  -----------------------PITNIRHIHSPLVQQADSIAQKA------CSLHELKS 82
                                   +       SP++   + IA          +L EL++
Sbjct: 80  ASNFQGQATAPPVPAAPIAAQIGAVPPASMGQSPVLPDREIIAAARDLAASAPTLDELRN 139

Query: 83  LLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQS 142
            L +F  C+L  T+   + A       LM +G  P   +++ G PF G++G +LD+ML +
Sbjct: 140 CLSAFEGCNLKLTAKKLVFADGNPEAKLMFVGEAPGRDEDLQGLPFVGRSGQLLDRMLAA 199

Query: 143 IEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFF 202
           I + R+  +I+ + PW PPGNR  +  E EIC+P I+RQIEL++P +L+F+G  +     
Sbjct: 200 IGLDRSSAYIANVVPWRPPGNRTPTPQETEICKPFILRQIELVNPDVLVFLGAASAKTLL 259

Query: 203 NNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
                   +  G+W         I  +AT HP  L++ PL K+ +W   + +K+ L  
Sbjct: 260 GVQ-DGIRKMRGRWMTYPCKGREISAIATYHPAYLLRSPLEKRLSWRDFLAIKQKLGE 316


>gi|94970801|ref|YP_592849.1| phage SPO1 DNA polymerase-related protein [Candidatus Koribacter
           versatilis Ellin345]
 gi|94552851|gb|ABF42775.1| phage SPO1 DNA polymerase-related protein [Candidatus Koribacter
           versatilis Ellin345]
          Length = 273

 Score =  212 bits (540), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 57/264 (21%), Positives = 102/264 (38%), Gaps = 10/264 (3%)

Query: 3   SKRILSQEQILTIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSP 62
             R L Q  +     FY + G+Y ++  P + AT  S+  E   +  +     +      
Sbjct: 1   MARTLDQNALSARLEFYREMGIYGLYRRPVD-ATAVSENPETPDEQYLPKKKEVTVTAEK 59

Query: 63  LVQQADSIAQKACSLHELKSLLRSFHDCHLCS-TSLSTICATQTEGQDLMIIGYTPSDSD 121
            +        K   L  ++  L     C L        +        +LM +G  P   +
Sbjct: 60  TLNVLQPTLSKPDGLKAIREDLGDCTRCVLHKQGRKQIVFGVGNPSAELMFVGEGPGADE 119

Query: 122 NISGKPFSGKTGNML-DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMR 180
           +  G PF G+ G +L + +   + + R  ++I+ +    PPGNR     E + C P + R
Sbjct: 120 DEQGIPFIGRAGQLLTNMITNGMGLKREDVYIANVVKCRPPGNRTPEREECDTCSPFLFR 179

Query: 181 QIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSI------IPTLATVHP 234
           QIE+I PK+++ +G          + +   +  G+  +  TP            + T HP
Sbjct: 180 QIEVIQPKMIVALGAVAAKTLLGVN-EAMARLRGQIYDFSTPRRPGSDLYDGKLVVTYHP 238

Query: 235 QELIQYPLIKKNTWHALITLKKAL 258
             L++ P  K   W  L  + + L
Sbjct: 239 AYLLRDPRQKSEAWKDLQIVMRYL 262


>gi|114777353|ref|ZP_01452350.1| phage SPO1 DNA polymerase domain protein [Mariprofundus
           ferrooxydans PV-1]
 gi|114552135|gb|EAU54637.1| phage SPO1 DNA polymerase domain protein [Mariprofundus
           ferrooxydans PV-1]
          Length = 252

 Score =  212 bits (539), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 60/249 (24%), Positives = 100/249 (40%), Gaps = 15/249 (6%)

Query: 18  FYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKA--- 74
           +  + GV      P +  +  +Q  +  +  A QP        + L  Q  + A  A   
Sbjct: 11  YLREIGV----QTPVSLLSL-AQETQPPVAPAAQPSPVESEPAAALESQVSTPAPAADTV 65

Query: 75  --CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKT 132
              SL EL +   +   C L  T    +        DL+ IG  P   +++ G+PF G+ 
Sbjct: 66  VFKSLDELSATASTCRLCSLADTRTQVVFGVGNPQADLVFIGEAPGRDEDLQGEPFVGRA 125

Query: 133 GNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLF 192
           G +LD+M+ +I + R  ++I       PP NR+    E++ C     +Q++ + PK++  
Sbjct: 126 GQLLDRMMAAIGLDRDAVYIMNTIKCRPPNNRDPRADEVKACNLWFEQQLDALQPKMICL 185

Query: 193 IGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALI 252
           +G          DA       G W         IP   T HP  L++ P  K+  W  L 
Sbjct: 186 LGRVAAQTVLGTDATL-GALRGAWHEY----HGIPVWVTYHPAYLLRSPQQKQKGWQDLC 240

Query: 253 TLKKALKNL 261
            L    ++L
Sbjct: 241 LLADRYRDL 249


>gi|114705011|ref|ZP_01437919.1| hypothetical protein FP2506_08741 [Fulvimarina pelagi HTCC2506]
 gi|114539796|gb|EAU42916.1| hypothetical protein FP2506_08741 [Fulvimarina pelagi HTCC2506]
          Length = 308

 Score =  212 bits (539), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 80/295 (27%), Positives = 128/295 (43%), Gaps = 44/295 (14%)

Query: 10  EQILTIALFYADSGVYWVF-DEPNNEATYESQRKEKSIDSAIQPITNIRHIHS------- 61
            Q + +  FY+++G+   + D P +         E+       P T  +           
Sbjct: 12  NQAIALLNFYSEAGIDTFWGDHPRDRFAETRAEIERRSGGRGSPATTTQPTRRNEEASPQ 71

Query: 62  --------------------------------PLVQQADSIAQKACSLHELKSLLRSFHD 89
                                             +  A   A+ A SL EL+  LRSF  
Sbjct: 72  ASPAAASAPVRDARLDEAQAGFPAPSLPISGDAAIADARERARSAASLAELEDALRSFEG 131

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C L  T+ S +     E  DLM++G  P   +++ G+PF GK+G +LD+ML SI + R  
Sbjct: 132 CALRVTAKSCVFGNGREDADLMLVGEAPGRDEDLEGEPFVGKSGQLLDRMLLSIGLEREA 191

Query: 150 IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKT 209
           + ++   PW PPGNR  + +E  +C P + R IEL+ PKIL+ +GN       +   +  
Sbjct: 192 VRVTNTVPWRPPGNRQPTPVETAMCLPFLQRHIELVRPKILVALGNPASIALLDAK-EGI 250

Query: 210 YQNLGKWSNLCTP---HSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
            +  GKW +       +  IP +A +HP  L++ P  K+  W  L+ LK  L++L
Sbjct: 251 LRLRGKWKSYTMGLGENDQIPAMAMLHPAYLLRNPAQKRLAWRDLLMLKAKLEDL 305


>gi|227821368|ref|YP_002825338.1| DNA polymerase [Sinorhizobium fredii NGR234]
 gi|227340367|gb|ACP24585.1| DNA polymerase [Sinorhizobium fredii NGR234]
          Length = 293

 Score =  212 bits (539), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 86/292 (29%), Positives = 138/292 (47%), Gaps = 35/292 (11%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVF-DEPNNEATY--------------ESQRKEKS 45
           M S   LS  ++  +  F+A++GV W+  DEP +                     R+   
Sbjct: 1   MISANDLSASELAALLAFHAEAGVEWLLEDEPVDRLAEFEAMKAKRADARAAPPVRQATP 60

Query: 46  I-------------------DSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRS 86
                                +A      +       V +A   A+ A SL EL++ + +
Sbjct: 61  PEVQGGRVQPATSGKARDARPAAPSVPPTVAIPDEQAVSEARFAAESARSLAELRTAMEA 120

Query: 87  FHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIM 146
           F  C+L +++ + + A       +M++G  P   D+  G+PF+G+ G+ML++ML  I + 
Sbjct: 121 FTGCNLKNSARNLVFADGNAASGIMVVGPMPYAEDDRDGQPFAGRHGDMLERMLSGIGLS 180

Query: 147 RTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDA 206
           R+ I ++ + PW PPGNR  S  E +ICRP I RQI L  P+ +L +GN T  FFF  + 
Sbjct: 181 RSDILLTNVVPWRPPGNRVPSGREADICRPFIERQIALAEPRHMLLLGNFTARFFFGTNE 240

Query: 207 QKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
               Q  G+W  L     ++P LAT+HPQ+LI  P+ K+  W  L+  K  +
Sbjct: 241 TIH-QTRGQWRELSAGGHLVPALATLHPQDLISAPVNKRFAWQDLLAFKARI 291


>gi|149200965|ref|ZP_01877940.1| uracil-DNA glycosylase [Roseovarius sp. TM1035]
 gi|149145298|gb|EDM33324.1| uracil-DNA glycosylase [Roseovarius sp. TM1035]
          Length = 267

 Score =  211 bits (537), Expect = 8e-53,   Method: Composition-based stats.
 Identities = 63/270 (23%), Positives = 116/270 (42%), Gaps = 18/270 (6%)

Query: 3   SKRILSQEQILTIALFYADSGV-YWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHS 61
            + +LS    L   ++  + G    + D P N      +  + +     +         S
Sbjct: 1   MESMLSPHDALASLIWQIELGATEAIGDAPINRYELPEKVAKPAAVPKTEAKPAALTAPS 60

Query: 62  -----PLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYT 116
                  V+ A + A  A  L  L++ L ++  C L   + + +         +MIIG  
Sbjct: 61  LGAGVDPVEVARAAAAAAMDLEGLRAALGAYPHCDLRRGARNLVFGDGNPAARVMIIGEA 120

Query: 117 PSDSDNISGKPFSGKTGNMLDKMLQSIEIMR------TQIHISMISPWHPPGNRNLSNIE 170
           P   ++  GKPF G+ G +LD+M+Q+I + R        ++I+ + PW PP NR+ +  E
Sbjct: 121 PGRDEDQQGKPFVGRAGQLLDRMVQAIGLSRGAQAPQDAVYITNVLPWRPPQNRDPNAEE 180

Query: 171 MEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLA 230
           + + RP + R + L++P +++ +GN +             +  G+W+         P L 
Sbjct: 181 IAMMRPFVARHVALVNPAVIVLMGNISCEAGLGQRG--ITRLRGQWAEAYGK----PALP 234

Query: 231 TVHPQELIQYPLIKKNTWHALITLKKALKN 260
             HP  L++ P  K+  W  L+ LK  L+ 
Sbjct: 235 MFHPAYLLRNPAAKREAWADLLALKARLRE 264


>gi|126740581|ref|ZP_01756268.1| uracil-DNA glycosylase [Roseobacter sp. SK209-2-6]
 gi|126718382|gb|EBA15097.1| uracil-DNA glycosylase [Roseobacter sp. SK209-2-6]
          Length = 264

 Score =  211 bits (536), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 62/261 (23%), Positives = 110/261 (42%), Gaps = 10/261 (3%)

Query: 3   SKRILSQEQILTIALFYADSGV-YWVFDEPNNEATYESQRKEKSIDSAIQPITNI--RHI 59
            +  L       +  +  + G    + + P +  + +    +K+  +  +       +  
Sbjct: 1   MESALDYWSAKALLEWQVELGATEALSEAPIDRYSLQPSAPQKTASNKSRTPEPAVEKPK 60

Query: 60  HSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSD 119
               V  A   AQ A SL  LK  +  F  C L   + + + +    G ++M+IG  P  
Sbjct: 61  PVDPVAVARKAAQAASSLPALKEAIAGFEHCGLKRGARNLVFSDGQAGANVMVIGEAPGR 120

Query: 120 SDNISGKPFSGKTGNMLDKMLQSIEIMRTQI-HISMISPWHPPGNRNLSNIEMEICRPII 178
            +++ GKPF G+ G MLD+ML +I + R++  +I+ + PW PP NR+    E+ +  P +
Sbjct: 121 DEDLQGKPFVGRAGQMLDRMLTAIGLSRSENVYITNVLPWRPPQNRDPQAEEIAMMMPFL 180

Query: 179 MRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELI 238
            R + L  P  L+ +GN +             +  G W          P +   HP  L+
Sbjct: 181 ERHVALAQPDFLVLMGNISCQAVLGKRG--ITRLRGNW----DQAWGKPVMPMFHPAFLL 234

Query: 239 QYPLIKKNTWHALITLKKALK 259
           + P  K+  W  L+ LK  L 
Sbjct: 235 RQPHQKRQAWADLLELKARLN 255


>gi|15888330|ref|NP_354011.1| DNA polymerase [Agrobacterium tumefaciens str. C58]
 gi|15156000|gb|AAK86796.1| DNA polymerase [Agrobacterium tumefaciens str. C58]
          Length = 296

 Score =  210 bits (534), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 90/296 (30%), Positives = 135/296 (45%), Gaps = 37/296 (12%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVFDE-PNNEATYESQRKEKSIDSAIQPITNI--- 56
           M +   LS  ++  +  F+AD+GV W+ +E P +     +  +      A  P       
Sbjct: 1   MIAAHDLSPAELAALLHFHADAGVDWMLEEAPVDRFAEFAAARPMPGQDAATPARQAQSP 60

Query: 57  --------------------------------RHIHSPLVQQADSIAQKACSLHELKSLL 84
                                                  V  A   A+ A SL EL++ L
Sbjct: 61  ADRRTDAPQRQAPGRSAPARGAPAAPAIQQNVAMPDEQAVSAARFAAESARSLGELRTAL 120

Query: 85  RSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIE 144
             F+ C+L +++ +TI +       +M+IG  P   D+  G PF+GKTG +L++ML +I 
Sbjct: 121 EGFNGCNLKNSARNTIFSEGDPASAIMVIGPMPDADDDREGTPFAGKTGQLLERMLAAIG 180

Query: 145 IMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNN 204
           + R+ I I  + PW PPGNR  +  EM+ICRP I RQI L  PK LL +GN T  FFF  
Sbjct: 181 LERSAIMIGNVVPWRPPGNRPPTQAEMDICRPFIERQIALAEPKHLLLLGNFTARFFFGG 240

Query: 205 DAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
                    G+W ++   H I+P LA++HPQEL+  P  K   W  L+  +  +  
Sbjct: 241 TGTIHT-LRGQWRDVAAGHLILPALASLHPQELLNAPASKSLAWQDLLAFQTKITE 295


>gi|88606724|ref|YP_505870.1| uracil-DNA glycosylase [Anaplasma phagocytophilum HZ]
 gi|88597787|gb|ABD43257.1| uracil-DNA glycosylase, family 4 [Anaplasma phagocytophilum HZ]
          Length = 290

 Score =  210 bits (534), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 65/283 (22%), Positives = 122/283 (43%), Gaps = 25/283 (8%)

Query: 1   MTSK-RILSQEQI---LTIALFYADSGVYWVFD---EPNNEATYESQRKEKSIDSAIQPI 53
           MT +    + E I     +  FY DSGV    +    P++  +  +  K   +    +  
Sbjct: 1   MTDEHNKPNVEDIKMFAEVLRFYHDSGVTHTLNDDLHPDDTLSPANFEKSPVVPDRAKTR 60

Query: 54  TNIRHIHS--------------PLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLST 99
            +   + +                V++A   A     L EL++ + +F  C +   +++T
Sbjct: 61  ESQEIVLNKTSNKKSSSNANMLQWVEEARKAAANCVDLAELRAAVCAFEGCEIKKAAVNT 120

Query: 100 ICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPW 158
           + +       +M+IG  P  +++  G PF G +G +LDKM  +I + R + I+IS    W
Sbjct: 121 VFSDGNPKSKIMLIGEAPGSTEDREGIPFCGASGQLLDKMFAAINLNRSSNIYISNTVFW 180

Query: 159 HPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSN 218
            PPGNR  ++ E+E+CRP + + I L+ P +++ +G+               +  GK+  
Sbjct: 181 RPPGNRKPTDFELEVCRPFVEKHISLVDPDVVVMVGSTACYSLLQ-TPDNISRLRGKFYE 239

Query: 219 LCTPH--SIIPTLATVHPQELIQYPLIKKNTWHALITLKKALK 259
                    I  +   HP  L++ P  K+  W  L  L+  ++
Sbjct: 240 YTNSFLSRSITAMVIFHPAYLLRQPQQKRLAWEDLKMLRAYIE 282


>gi|126734673|ref|ZP_01750419.1| phage SPO1 DNA polymerase-related protein [Roseobacter sp. CCS2]
 gi|126715228|gb|EBA12093.1| phage SPO1 DNA polymerase-related protein [Roseobacter sp. CCS2]
          Length = 263

 Score =  210 bits (534), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 60/257 (23%), Positives = 112/257 (43%), Gaps = 17/257 (6%)

Query: 14  TIALFYADSGV-YWVFDEPNNEATYESQRKEKSIDSAIQP----ITNIRHIHSPLVQQAD 68
            +  +  + G    + D P +    E+ +    + +A +         +      V  A 
Sbjct: 12  ALLEWQVELGATDAILDAPVDRYALEAAKPAPKVAAATEKPAAAPVPTKAPEVDAVALAR 71

Query: 69  SIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPF 128
           + A+ A  L+ L S +++F  C L   + S +         +MIIG  P   ++ +G+PF
Sbjct: 72  TAAETAGDLNALSSAMQAFEHCELKKGARSFVFCDGNPAARVMIIGEAPGREEDRAGRPF 131

Query: 129 SGKTGNMLDKMLQSIEIMR------TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQI 182
            G+ G +LD+ML++I++ R        ++I+ + PW PP NR     E+ +  P + R +
Sbjct: 132 VGRAGQLLDRMLEAIQMGRAADDAARSVYITNVLPWRPPSNRTPDKDEIAMMLPFLERHV 191

Query: 183 ELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPL 242
            L  P+I++ +GN               +  G W ++       P L   HP  L++ P+
Sbjct: 192 ALADPEIVVLMGNTPCQALLGRTG--ITRMRGNWVDVLGK----PCLPMFHPAYLLRNPI 245

Query: 243 IKKNTWHALITLKKALK 259
            K+  W  L+ L   L+
Sbjct: 246 AKREAWADLLDLNARLR 262


>gi|213018713|ref|ZP_03334521.1| putative DNA glycosylase [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|212995664|gb|EEB56304.1| putative DNA glycosylase [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 211

 Score =  209 bits (532), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 61/203 (30%), Positives = 111/203 (54%), Gaps = 3/203 (1%)

Query: 60  HSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSD 119
            S  + +A  +A +  S+ EL+S ++SF  C +  T+ +T+ +       +M++G  P  
Sbjct: 3   PSDWIIEARKLASECGSVDELRSAVKSFEGCEIKKTATNTVFSDGNPNAKIMLVGEAPGA 62

Query: 120 SDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIM 179
           ++++ G PF G +G +LDKML +I + RT+++IS    W PPGNR  +++E+++CRP + 
Sbjct: 63  NEDLKGIPFCGASGMLLDKMLGAINLDRTKVYISNTVFWRPPGNRKPTDLELDMCRPFVE 122

Query: 180 RQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPH--SIIPTLATVHPQEL 237
           + I L+ P+IL+F+G        + + +      GK+      +    I T A  HP  L
Sbjct: 123 KHIALVLPQILIFVGGIACYSLLD-NTKTISNLRGKFHTYTNQYLSHAITTAAIFHPAYL 181

Query: 238 IQYPLIKKNTWHALITLKKALKN 260
           ++ P  K+  W  L  +++ L N
Sbjct: 182 LRQPAQKRLAWEDLKKIREYLDN 204


>gi|116251217|ref|YP_767055.1| uracil-DNA glycosylase [Rhizobium leguminosarum bv. viciae 3841]
 gi|115255865|emb|CAK06946.1| putative uracil-DNA glycosylase [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 299

 Score =  209 bits (531), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 93/295 (31%), Positives = 142/295 (48%), Gaps = 35/295 (11%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVFDEP-NNEATY---------------------- 37
           M S   LS  ++  +  F+AD+GV W+ +E   +                          
Sbjct: 1   MISANDLSPAELAALLHFHADAGVEWLLEEEAIDRFAEFEAMKAARRPAAQAQQQRPAAG 60

Query: 38  -----------ESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRS 86
                       +     +                  VQQA  +A+ A SL ELK+ + S
Sbjct: 61  ERPAPGQAQVRPNAAVRPAPAERAASGPQPAIPDGEAVQQARFVAETARSLVELKTAIES 120

Query: 87  FHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIM 146
           F+ C+L  ++ STI A+      +M+IG  PS  D+  G PFSGK+G + DKML +I + 
Sbjct: 121 FNGCNLKHSARSTIFASGDAESGIMVIGSAPSAEDDREGMPFSGKSGQLFDKMLAAIGLT 180

Query: 147 RTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDA 206
           R+ I ++ + PW PPGNR  S  EM+ICRP I RQI L  PK +L +GN +  FFF  + 
Sbjct: 181 RSAILLTQVIPWRPPGNRAPSAAEMDICRPFIERQIALAEPKAILLLGNFSARFFFGEND 240

Query: 207 QKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
                  G+W  +     +IP +A++HPQ+L+  P+ K+  W+ L+  +  LK+L
Sbjct: 241 TIHG-LRGRWKEIAAADCVIPAIASLHPQDLLTAPVNKRLAWNDLLAFQAKLKSL 294


>gi|254461237|ref|ZP_05074653.1| uracil-DNA glycosylase [Rhodobacterales bacterium HTCC2083]
 gi|206677826|gb|EDZ42313.1| uracil-DNA glycosylase [Rhodobacteraceae bacterium HTCC2083]
          Length = 263

 Score =  209 bits (531), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 65/257 (25%), Positives = 114/257 (44%), Gaps = 11/257 (4%)

Query: 7   LSQEQILTIALFYADSGVYW-VFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLV- 64
           L       +  +  + GV   + + P N    + + K+ +  +A   I       +  V 
Sbjct: 9   LDYHTARALLEWQVEFGVDETMSENPVNRFEVKPEPKKTAPVAAPPKIEAGIAPVADKVD 68

Query: 65  --QQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDN 122
               A  +A  A  +  LK+ L  F  C L   + + + A  T G  +M+IG  PS  ++
Sbjct: 69  GAALARDVAMAAQDIGALKTALEGFEACELKRGARNMVFADGTFGGRVMVIGEAPSRDED 128

Query: 123 ISGKPFSGKTGNMLDKMLQSIEIMRTQI-HISMISPWHPPGNRNLSNIEMEICRPIIMRQ 181
            SG PF+G TG +LD ML+SI++ R +  +++ + PW  P   ++S  ++ +  P + R 
Sbjct: 129 HSGLPFTGDTGVLLDNMLKSIDLSRAETVYLTNVLPWRLPRGADVSEADLAMMMPFVERH 188

Query: 182 IELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
           + L  P IL+ +GN               +  G+W         +P ++  HP+ L+  P
Sbjct: 189 VALAKPDILVLMGNVACQAVLGKRG--ITRLRGQW----GEAMGLPVISMYHPEFLLNNP 242

Query: 242 LIKKNTWHALITLKKAL 258
             K+  W  L+ LK  L
Sbjct: 243 AKKREAWADLLALKAKL 259


>gi|294675958|ref|YP_003576573.1| uracil-DNA glycosylase [Rhodobacter capsulatus SB 1003]
 gi|294474778|gb|ADE84166.1| uracil-DNA glycosylase [Rhodobacter capsulatus SB 1003]
          Length = 270

 Score =  208 bits (530), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 66/272 (24%), Positives = 117/272 (43%), Gaps = 19/272 (6%)

Query: 3   SKRILSQEQILTIALFYADSGV-YWVFDEPNNEATY-----ESQRKEKSIDSAIQPITNI 56
               +S +  L    +  + G    V D P N               ++   A +P   +
Sbjct: 5   PAPEISYDAALAAFEWLIELGATDPVGDAPVNRYDLVTPEPAPAPPPQAETRAPRPAPVL 64

Query: 57  RHIHS-PLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGY 115
             + +   V  A  +A +A +L +L+  +  F  C L   + +T+         +M+IG 
Sbjct: 65  APVETVDPVAVARGLAARAATLDDLREAILGFDHCPLKRGARNTVFCDGNPKARVMLIGE 124

Query: 116 TPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQI------HISMISPWHPPGNRNLSNI 169
            P   ++  GKPF G+ G +LD+ML ++ + R         +I+ + PW PPGNR     
Sbjct: 125 APGKDEDAQGKPFVGRAGQLLDRMLAAVGLDRAAPDPGTAVYITNVMPWRPPGNREPEPA 184

Query: 170 EMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTL 229
           E+ +  P + R +EL+ P +++ +GN       N+      +  G W+         P L
Sbjct: 185 EIAMMGPFLARHVELVDPDLIVLMGNTACAAALNSRG--ITRLRGSWTQAF----GRPAL 238

Query: 230 ATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
            T+HP  L++ P+ K+  W  L+ L+  L  L
Sbjct: 239 PTLHPANLLRTPINKRLVWADLLELRAKLNAL 270


>gi|86356942|ref|YP_468834.1| DNA polymerase bacteriophage-type (uracil-DNA glycosylase) protein
           [Rhizobium etli CFN 42]
 gi|86281044|gb|ABC90107.1| probable DNA polymerase bacteriophage-type (uracil-DNA glycosylase)
           protein [Rhizobium etli CFN 42]
          Length = 297

 Score =  208 bits (530), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 92/293 (31%), Positives = 143/293 (48%), Gaps = 33/293 (11%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVFDEP-NNEATYESQ------------RKEKSID 47
           M S   LS  ++  +  F+AD+GV W+ +E   +                   ++    +
Sbjct: 1   MISVNDLSPAELAALLHFHADAGVEWLQEEEAVDRFAEFEAMKAARRPAAQAQQERPIAE 60

Query: 48  SAIQPITN-------------------IRHIHSPLVQQADSIAQKACSLHELKSLLRSFH 88
               P                              VQQA  +A+ A SL ELK+ + +F+
Sbjct: 61  ERPLPGQRQTSPRPSAAARPAPASGPQPAIPDGEAVQQARFVAEAARSLSELKTAIEAFN 120

Query: 89  DCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRT 148
            C+L  ++ STI A+      +M+IG  PS  D+  G PFSGK+G + DKML +I + R+
Sbjct: 121 GCNLKHSARSTIFASGDADSGIMMIGSAPSAEDDREGTPFSGKSGQLFDKMLAAIGLSRS 180

Query: 149 QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQK 208
            + ++ + PW PPGNR  S  EM+ICRP I RQI L  P+ +L +GN    FFF  +   
Sbjct: 181 SVLLTQVIPWRPPGNRAASPAEMDICRPFIERQIALAEPQAILLLGNFAARFFFGENDTI 240

Query: 209 TYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
                G+W  +     IIPT+A++HPQ+L+  P+ K+  W+ L+  +  L +L
Sbjct: 241 HG-LRGRWREIAVAGRIIPTIASLHPQDLLTAPVNKRLAWNDLLVFQAKLNSL 292


>gi|312114358|ref|YP_004011954.1| phage SPO1 DNA polymerase-related protein [Rhodomicrobium vannielii
           ATCC 17100]
 gi|311219487|gb|ADP70855.1| phage SPO1 DNA polymerase-related protein [Rhodomicrobium vannielii
           ATCC 17100]
          Length = 289

 Score =  208 bits (529), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 77/271 (28%), Positives = 125/271 (46%), Gaps = 26/271 (9%)

Query: 15  IALFYADSGVYWVFDEPNNEATYESQRKEKSID------------------------SAI 50
           +  +Y   GV     +   +   E  R E+ +                         +A 
Sbjct: 17  LLEWYRAMGVDETIADETRDWLSEIPRAEQPLPKGIDVDANVNRKPLTRERADLTHLAAP 76

Query: 51  QPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDL 110
                +    S  V  A  +A+ A SL EL++LL SF  C L +T+     +  +    L
Sbjct: 77  TRAAPVELPASNDVMAARELARSAKSLEELRALLESFEGCGLKATASRLCLSRGSPSAPL 136

Query: 111 MIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIE 170
           M+IG  P   ++  G+PF G+ G +LD+ML +I +     +I+ I  W PPGNR  S  E
Sbjct: 137 MLIGEAPGKDEDRLGQPFVGRAGQLLDRMLAAIGLTEADFYITNIVFWRPPGNRTPSPEE 196

Query: 171 MEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLA 230
           + +C+P + RQIEL++P+I++F+GN               +  GKW  L   H  +  +A
Sbjct: 197 VLVCQPFVERQIELLAPRIVVFLGNAAARQLTGATEGIM-KLRGKWLELP-GHPGVRAMA 254

Query: 231 TVHPQELIQYPLIKKNTWHALITLKKALKNL 261
           T+HP  L++ P+ K+  W  L+ ++ AL  L
Sbjct: 255 TLHPAYLLRTPIAKRLAWRDLLAVRAALDAL 285


>gi|58697041|ref|ZP_00372503.1| putative phage DNA polymerase [Wolbachia endosymbiont of Drosophila
           simulans]
 gi|58536691|gb|EAL59977.1| putative phage DNA polymerase [Wolbachia endosymbiont of Drosophila
           simulans]
          Length = 249

 Score =  208 bits (528), Expect = 9e-52,   Method: Composition-based stats.
 Identities = 60/203 (29%), Positives = 110/203 (54%), Gaps = 3/203 (1%)

Query: 60  HSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSD 119
            S  + +A  +A K  S+ EL+S ++SF  C +  T+ +T+ +       +M++G  P  
Sbjct: 41  PSDWIIEARKLAGKCGSVDELRSAVKSFEGCEIKKTATNTVFSDGNPNAKIMLVGEAPGA 100

Query: 120 SDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIM 179
           ++++ G PF G +G +LDKML +I + RT+++IS    W PPGNR  +++E+++CRP + 
Sbjct: 101 NEDLQGIPFCGASGMLLDKMLNAINLDRTKVYISNTVFWRPPGNRKPTDLELDMCRPFVE 160

Query: 180 RQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPH--SIIPTLATVHPQEL 237
           + I L+SP+IL+ +G        ++         G++      +  + I T A  HP  L
Sbjct: 161 KHIALVSPQILILVGGIACYSLLDSTK-TISNLRGRFHTYTNQYLSNSITTAAIFHPAYL 219

Query: 238 IQYPLIKKNTWHALITLKKALKN 260
           ++ P  K+  W     +++ L N
Sbjct: 220 LRQPAQKRLAWEDSKKIREYLDN 242


>gi|15964784|ref|NP_385137.1| hypothetical protein SMc02375 [Sinorhizobium meliloti 1021]
 gi|307309672|ref|ZP_07589324.1| phage SPO1 DNA polymerase-related protein [Sinorhizobium meliloti
           BL225C]
 gi|15073962|emb|CAC45603.1| Putative DNA polymerase bacteriophage-type [Sinorhizobium meliloti
           1021]
 gi|306899884|gb|EFN30507.1| phage SPO1 DNA polymerase-related protein [Sinorhizobium meliloti
           BL225C]
          Length = 286

 Score =  207 bits (527), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 91/287 (31%), Positives = 140/287 (48%), Gaps = 31/287 (10%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVFDE-PNNEATYESQRKEKSIDSAIQPITNIRH- 58
           M S   LS+ ++  +  F+A++GV W+ +E P +        K +   S   P T     
Sbjct: 1   MISANDLSRSELAALLAFHAEAGVEWLLEEEPVDRLAEFEAMKSRRAQSRAVPQTGATAA 60

Query: 59  ---------------------------IHSPLVQQADSIAQKACSLHELKSLLRSFHDCH 91
                                           +++A  +A  A SL EL++ + +F  C+
Sbjct: 61  EPQQSAPPAAARERRPAPPAPPPVVAIPDEQAIKEAQFVADAARSLGELRTAMEAFAGCN 120

Query: 92  LCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIH 151
           L +++ + + A  +    +MIIG  P   D+  G+PF+G+ G ML++ML  I + R  + 
Sbjct: 121 LRNSARNLVFAEGSAASGVMIIGPMPYADDDRDGRPFAGRHGEMLERMLSGIGLSREDVL 180

Query: 152 ISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQ 211
           ++   PW PPGNR  S  E +ICRP I RQI L  PK LL +GN T  FFF    +  +Q
Sbjct: 181 LANAVPWRPPGNRVPSAREADICRPFIERQIALAEPKQLLLLGNFTARFFFG--GETIHQ 238

Query: 212 NLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
             G+W  L    + IPTLAT+HPQ+L+  P+ K+  W  L+  K  L
Sbjct: 239 LRGEWRELTFGGTSIPTLATLHPQDLVAAPINKRFAWLDLLAFKSRL 285


>gi|84684257|ref|ZP_01012159.1| hypothetical protein 1099457000262_RB2654_17451 [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84668010|gb|EAQ14478.1| hypothetical protein RB2654_17451 [Rhodobacterales bacterium
           HTCC2654]
          Length = 264

 Score =  207 bits (527), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 63/268 (23%), Positives = 111/268 (41%), Gaps = 16/268 (5%)

Query: 3   SKRILSQEQILTIALFYADSGV-YWVFDEPNNEATYESQRKEKSIDSAIQPITNIR---H 58
            +  L   Q   +  +Y + GV   V + P +    + +        A  P         
Sbjct: 1   MESALDWHQAKALLEWYVELGVTDAVAEAPIDRYELKPEPPRTPAAPAPVPEGPTPLREV 60

Query: 59  IHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPS 118
             +  V  A   A  A SL  L   ++++    L   + S + +       +MI+G  P 
Sbjct: 61  PRTDWVAVAKEHAAGAGSLEALAEAMQAYDGSPLKKGARSFVFSDGNPAARVMIVGEGPG 120

Query: 119 DSDNISGKPFSGKTGNMLDKMLQSIEIMRTQI------HISMISPWHPPGNRNLSNIEME 172
             ++  GKPF G  G +LD+M  +I + R         +I+ + P+ PPGNRN +  E+ 
Sbjct: 121 AEEDREGKPFVGPAGRLLDQMFAAIGLNRATPDAQNALYITNVVPYRPPGNRNPTPEEIA 180

Query: 173 ICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATV 232
           +  P ++R IEL  P I++ +GN       +       +  G W+ +       P L   
Sbjct: 181 MFTPFLLRHIELADPDIIIPMGNIALTALLDRQG--ITKLRGTWTEVLGK----PALPMF 234

Query: 233 HPQELIQYPLIKKNTWHALITLKKALKN 260
           HP  L++ P+ K+  W  L+ ++  L+ 
Sbjct: 235 HPSYLLRNPISKREAWADLLDIQAKLRA 262


>gi|241203823|ref|YP_002974919.1| phage SPO1 DNA polymerase-related protein [Rhizobium leguminosarum
           bv. trifolii WSM1325]
 gi|240857713|gb|ACS55380.1| phage SPO1 DNA polymerase-related protein [Rhizobium leguminosarum
           bv. trifolii WSM1325]
          Length = 299

 Score =  207 bits (526), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 94/295 (31%), Positives = 143/295 (48%), Gaps = 35/295 (11%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVFDEP-NNEATYESQRK----------------- 42
           M S   LS  ++  +  F+AD+GV W+ +E   +        K                 
Sbjct: 1   MISANDLSPAELAALLHFHADAGVEWLLEEEAIDRFAEFEAMKAARRPAAQAQQQRPAAG 60

Query: 43  EKSIDSAI----------------QPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRS 86
           E+                                   VQQA  +A+ A SL ELK+ + +
Sbjct: 61  ERPAPGQSPARPNAAARPAPAERAASGPQPAIPDGEAVQQARFVAETARSLVELKTAIET 120

Query: 87  FHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIM 146
           F+ C+L  ++ STI A+      +M+IG  PS  D+  G PFSGK+G + DKML +I + 
Sbjct: 121 FNGCNLKHSARSTIFASGDTESGIMVIGSAPSAEDDREGLPFSGKSGQLFDKMLAAIGLT 180

Query: 147 RTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDA 206
           R+ I ++ + PW PPGNR  S  EM+ICRP I RQI L  PK +L +GN +  FFF  + 
Sbjct: 181 RSTILLTQVIPWRPPGNRAPSAAEMDICRPFIERQIALAEPKAILLLGNFSARFFFGEND 240

Query: 207 QKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
                  G+W  +     +IP +A++HPQ+L+  P+ K+  W+ L+  +  LK+L
Sbjct: 241 TIHG-LRGRWKEIAAADCVIPAIASLHPQDLLTAPVNKRLAWNDLLAFQAKLKSL 294


>gi|260575952|ref|ZP_05843947.1| phage SPO1 DNA polymerase-related protein [Rhodobacter sp. SW2]
 gi|259021878|gb|EEW25179.1| phage SPO1 DNA polymerase-related protein [Rhodobacter sp. SW2]
          Length = 262

 Score =  207 bits (526), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 63/260 (24%), Positives = 120/260 (46%), Gaps = 17/260 (6%)

Query: 7   LSQEQILTIALFYADSGV-YWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQ 65
           +  +  L    +  D G    + D P N         +    + +Q    +   ++  V 
Sbjct: 10  MDGQVALAALAWQVDLGATEAIGDAPVNRYEM----PDAVAVAKVQSAPVVAAPYADPVA 65

Query: 66  QADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISG 125
            A + A  A +L EL++ + +F  C L   + +T+ A       +M+IG  P   ++  G
Sbjct: 66  VARAAAAGAGTLAELRAAMEAFDLCDLKRGARNTVFADGNPNARVMLIGEAPGRDEDAEG 125

Query: 126 KPFSGKTGNMLDKMLQSIEIMRTQI------HISMISPWHPPGNRNLSNIEMEICRPIIM 179
           +PF G+ G +LD+ML +I + R         +I+ + PW PP NR+ +  E+ + +P + 
Sbjct: 126 RPFVGRAGQLLDRMLAAIGLSRQSPDPAAAVYITNVLPWRPPQNRDPAPDEIAMMQPFLA 185

Query: 180 RQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ 239
           R +EL +P++++ +GN +             +  G+W+         P L  +HP  L++
Sbjct: 186 RHVELAAPELIVLMGNISCQAVLGQRG--ITRLRGQWTEAF----GHPALPMLHPAYLLR 239

Query: 240 YPLIKKNTWHALITLKKALK 259
            P  K+++W  L+ LK  L+
Sbjct: 240 TPAAKRDSWADLLALKARLR 259


>gi|307319469|ref|ZP_07598896.1| phage SPO1 DNA polymerase-related protein [Sinorhizobium meliloti
           AK83]
 gi|306894841|gb|EFN25600.1| phage SPO1 DNA polymerase-related protein [Sinorhizobium meliloti
           AK83]
          Length = 286

 Score =  207 bits (526), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 91/287 (31%), Positives = 140/287 (48%), Gaps = 31/287 (10%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVFDE-PNNEATYESQRKEKSIDSAIQPITNIRH- 58
           M S   LS+ ++  +  F+A++GV W+ +E P +        K +   S   P T     
Sbjct: 1   MISANDLSRSELAALLAFHAEAGVEWLLEEEPVDRLAEFEAMKSRRAQSRAVPQTGATAA 60

Query: 59  ---------------------------IHSPLVQQADSIAQKACSLHELKSLLRSFHDCH 91
                                           +++A  +A  A SL EL++ + +F  C+
Sbjct: 61  EPQQSAPPAAARERRPAPPAPPPVVAIPDEQAIKEAQFVADAARSLGELRTAMEAFAGCN 120

Query: 92  LCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIH 151
           L +++ + + A  +    +MIIG  P   D+  G+PF+G+ G ML++ML  I + R  + 
Sbjct: 121 LRNSARNLVFAEGSAAPGVMIIGPMPYADDDRDGRPFAGRHGEMLERMLSGIGLSREDVL 180

Query: 152 ISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQ 211
           ++   PW PPGNR  S  E +ICRP I RQI L  PK LL +GN T  FFF    +  +Q
Sbjct: 181 LANAVPWRPPGNRVPSAREADICRPFIERQIALAEPKQLLLLGNFTARFFFG--GETIHQ 238

Query: 212 NLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
             G+W  L    + IPTLAT+HPQ+L+  P+ K+  W  L+  K  L
Sbjct: 239 LRGEWRELTFGGTSIPTLATLHPQDLVAAPINKRFAWLDLLAFKSRL 285


>gi|88608041|ref|YP_506799.1| uracil-DNA glycosylase [Neorickettsia sennetsu str. Miyayama]
 gi|88600210|gb|ABD45678.1| uracil-DNA glycosylase, family 4 [Neorickettsia sennetsu str.
           Miyayama]
          Length = 255

 Score =  206 bits (525), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 66/260 (25%), Positives = 110/260 (42%), Gaps = 19/260 (7%)

Query: 8   SQEQILTIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQA 67
           S+   L I  FY   G+  +           +     +  S  Q       +       A
Sbjct: 3   SKSSYLMILKFYDRLGMDTM----------TADISSPNQASITQVGGMPIDMKESAESTA 52

Query: 68  DSIAQKACSLH------ELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSD 121
                    L       ELK+L+ +F  C L  ++ +T+         +M+IG  P + +
Sbjct: 53  RKHKTPERDLTYVTTLGELKALVYNFEGCQLKKSAKNTVFCDGNPDAKIMLIGEAPGEQE 112

Query: 122 NISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQ 181
           +  G PF G++GN+LDKMLQ+I + RT+++I+    W PPGNR  +  E+EIC+P +   
Sbjct: 113 DKLGIPFCGRSGNLLDKMLQAIGLDRTKVYITNAVFWRPPGNRRPTPEEIEICKPFLEHH 172

Query: 182 IELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPH--SIIPTLATVHPQELIQ 239
           I L+ PK+++ +G+   +        +      K      P     I T    HP  L++
Sbjct: 173 IRLVLPKLIVLLGSTAASSVLK-SQDRISTLRNKLHEYKNPFIREGITTTVMFHPSYLLR 231

Query: 240 YPLIKKNTWHALITLKKALK 259
            P  KK  W  L  ++  + 
Sbjct: 232 QPAQKKLAWEDLKLIRSYID 251


>gi|260429553|ref|ZP_05783530.1| uracil-DNA glycosylase [Citreicella sp. SE45]
 gi|260420176|gb|EEX13429.1| uracil-DNA glycosylase [Citreicella sp. SE45]
          Length = 263

 Score =  206 bits (525), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 56/268 (20%), Positives = 112/268 (41%), Gaps = 15/268 (5%)

Query: 3   SKRILSQEQILTIALFYADSGVYWVF-DEPNNEATYESQRKEKSIDSA-------IQPIT 54
               +          +  + G      + P +   +E + +     SA         P  
Sbjct: 1   MDSGMDWHWARAALDWQIELGADEAIGETPVDRFAHEVEAQAARAVSAAPAGGRGATPPI 60

Query: 55  NIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIG 114
            +       V  A   A  A +L EL++ + ++  C L   + + + +       +MI+G
Sbjct: 61  PVADAGPDPVVVAQEAAAAASTLDELRAAIGAYEHCALKRGARNLVFSDGAPDARVMIVG 120

Query: 115 YTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEI 173
             P   +++ G+PF G+ G +LD+ML  + + R   ++I+ + PW PP NR+    E+ +
Sbjct: 121 EAPGRDEDLQGRPFVGRAGQLLDRMLAPLGLSRAENVYITNVLPWRPPQNRDPRPDEIAM 180

Query: 174 CRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVH 233
            +P + R I L+ P +L+ +GN + +           +  G W+         P +   H
Sbjct: 181 MKPFLARHIALVDPDLLVIMGNISCDALLGRRG--ITRLRGNWAEAE----GRPAMPMFH 234

Query: 234 PQELIQYPLIKKNTWHALITLKKALKNL 261
           P  L++ P +K+  W  ++ +   L+ L
Sbjct: 235 PAYLLRQPQMKREAWADMLAIGAKLRAL 262


>gi|170750469|ref|YP_001756729.1| phage SPO1 DNA polymerase-related protein [Methylobacterium
           radiotolerans JCM 2831]
 gi|170656991|gb|ACB26046.1| phage SPO1 DNA polymerase-related protein [Methylobacterium
           radiotolerans JCM 2831]
          Length = 295

 Score =  206 bits (523), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 71/293 (24%), Positives = 125/293 (42%), Gaps = 36/293 (12%)

Query: 2   TSKRILSQEQILTIALFYADSGVYWVFDE-PNNEATYESQRKE----------KSIDSAI 50
                 +Q  ++    F+ ++G     DE P++  +                 ++ +  +
Sbjct: 1   MPSSTDAQADLIAYLDFHVEAGADAALDEHPHDRFSEADAPAPTLRAPRRAAPRAAEQPV 60

Query: 51  QPITN------------------------IRHIHSPLVQQADSIAQKACSLHELKSLLRS 86
            P+ N                                   A + A++A SL EL+ +L  
Sbjct: 61  SPVANTLVPPPGSAPPAPPAAAPRTFGRAASAQPDEAASDARARARQAKSLDELERILAD 120

Query: 87  FHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIM 146
           F  C L  T+ + + A       +M +G  P   ++  GKPF G++G +LDKM++++ + 
Sbjct: 121 FDACPLRFTAKNLVFADGNPEARVMFLGEAPGADEDRIGKPFMGRSGQLLDKMMKAVGLD 180

Query: 147 RTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDA 206
           RT  +I  I PW PPGNRN +  E+ +CRP + RQIEL+ P I++ +G            
Sbjct: 181 RTSAYIGNIVPWRPPGNRNPTPQEVAVCRPFVERQIELVDPDIIVCLGAPATQTLTGTK- 239

Query: 207 QKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALK 259
               +  G+      P+  +  LAT+HP  L++ P+ K+  W    +L+  L 
Sbjct: 240 DGILRTRGRLFPYKLPNREVKLLATLHPAFLLRQPVQKRLAWRDFRSLRALLD 292


>gi|157826560|ref|YP_001495624.1| Uracil-DNA glycosylase [Rickettsia bellii OSU 85-389]
 gi|157801864|gb|ABV78587.1| Uracil-DNA glycosylase [Rickettsia bellii OSU 85-389]
          Length = 263

 Score =  206 bits (523), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 63/252 (25%), Positives = 121/252 (48%), Gaps = 9/252 (3%)

Query: 17  LFYADSGV-YWVFDEPNNEATYESQRKEKSIDSAIQPIT----NIRHIHSPLVQQADSIA 71
            +    GV Y+  + P      ++ +  +   +   P      N+       +  A S+A
Sbjct: 7   KWLNAIGVEYYCSEHPPKLKVSDNTKLAEKPQAKPTPQKENGFNMNDKTHDNISLARSLA 66

Query: 72  QKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGK 131
            KA ++ ELK  L +F+ C L   + +T+         +M+IG  P  ++++ G PF G+
Sbjct: 67  DKANNIAELKESLLNFNGCDLKKLATNTVFGDGNPAAKIMLIGEAPGSNEDLKGIPFCGE 126

Query: 132 TGNMLDKMLQSIEIMRTQI-HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKIL 190
           +GN+LD ML++I I R    +I+    W PP NR  +  E+++CRP + + I L++PK++
Sbjct: 127 SGNLLDNMLRAIGISRKDNAYITNTVFWRPPANRQPTLEEVDVCRPFVEKHIALVNPKLI 186

Query: 191 LFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPT--LATVHPQELIQYPLIKKNTW 248
           + +G+         +A    +   ++      +   P    A  HP  L++ P  K+ +W
Sbjct: 187 ILVGSTAATSLLGKNA-GITKIRQEYYFYTNKYLAAPIQTTAMFHPAYLLRQPSQKRTSW 245

Query: 249 HALITLKKALKN 260
           + L+ +K  L++
Sbjct: 246 YDLLKIKDYLES 257


>gi|91206062|ref|YP_538417.1| Uracil-DNA glycosylase [Rickettsia bellii RML369-C]
 gi|91069606|gb|ABE05328.1| Uracil-DNA glycosylase [Rickettsia bellii RML369-C]
          Length = 262

 Score =  205 bits (522), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 63/252 (25%), Positives = 121/252 (48%), Gaps = 9/252 (3%)

Query: 17  LFYADSGV-YWVFDEPNNEATYESQRKEKSIDSAIQPIT----NIRHIHSPLVQQADSIA 71
            +    GV Y+  + P      ++ +  +   +   P      N+       +  A S+A
Sbjct: 6   KWLNAIGVEYYCSEHPPKLKVSDNTKLAEKPQAKPTPQKENGFNMNDKTHDNISLARSLA 65

Query: 72  QKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGK 131
            KA ++ ELK  L +F+ C L   + +T+         +M+IG  P  ++++ G PF G+
Sbjct: 66  DKADNIAELKESLLNFNGCDLKKLATNTVFGDGNPAAKIMLIGEAPGSNEDLKGIPFCGE 125

Query: 132 TGNMLDKMLQSIEIMRTQI-HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKIL 190
           +GN+LD ML++I I R    +I+    W PP NR  +  E+++CRP + + I L++PK++
Sbjct: 126 SGNLLDNMLRAIGISRKDNAYITNTVFWRPPANRQPTLEEVDVCRPFVEKHIALVNPKLI 185

Query: 191 LFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPT--LATVHPQELIQYPLIKKNTW 248
           + +G+         +A    +   ++      +   P    A  HP  L++ P  K+ +W
Sbjct: 186 ILVGSTAATSLLGKNA-GITKIRQEYYFYTNKYLAAPIQTTAMFHPAYLLRQPSQKRTSW 244

Query: 249 HALITLKKALKN 260
           + L+ +K  L++
Sbjct: 245 YDLLKIKDYLES 256


>gi|222056605|ref|YP_002538967.1| phage SPO1 DNA polymerase-related protein [Geobacter sp. FRC-32]
 gi|221565894|gb|ACM21866.1| phage SPO1 DNA polymerase-related protein [Geobacter sp. FRC-32]
          Length = 256

 Score =  205 bits (521), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 48/251 (19%), Positives = 103/251 (41%), Gaps = 12/251 (4%)

Query: 10  EQILTIALFYADSGVYWV-FDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQAD 68
             +        +SG+  + + E      + +     +   A              V    
Sbjct: 12  ASLCVYLEDLQESGIDGLAYGESAPAVDHGNDYHSATSPPASVEPAPAEGSPPDPVSAEK 71

Query: 69  SIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPF 128
                  +L +++  L +   C L  T  + +         L+ +G  P   +++ G+PF
Sbjct: 72  E------TLDKVRLDLGNCTRCGLSGTRTNLVFGIGNPAARLVFVGEAPGRDEDLQGEPF 125

Query: 129 SGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPK 188
            G+ G +L K++ +++  R+ ++I  I    PPGNRN    E+E C+P ++RQ+  ++P+
Sbjct: 126 VGEAGQLLTKIIGAMQFKRSDVYICNILKCRPPGNRNPQQEEIEQCQPFLLRQLHAVNPE 185

Query: 189 ILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTW 248
            ++ +G            +   +  G++ +       IP + T HP  L++ P +K+  W
Sbjct: 186 AIVCLGTFAAQTLLQTK-EPISKLRGRFHDY----HGIPLMPTFHPAFLLRNPAMKREVW 240

Query: 249 HALITLKKALK 259
             +  + + L 
Sbjct: 241 EDMQKVMRLLD 251


>gi|300024378|ref|YP_003756989.1| phage SPO1 DNA polymerase-related protein [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299526199|gb|ADJ24668.1| phage SPO1 DNA polymerase-related protein [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 275

 Score =  203 bits (515), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 78/276 (28%), Positives = 118/276 (42%), Gaps = 30/276 (10%)

Query: 12  ILTIALFYADSGVYWVFDEPNNEATYESQRKE------KSIDSAIQPITNIRHIHSPLVQ 65
           +L +  ++   G     DE + +                  D A   +          V 
Sbjct: 1   MLALLDWFQAMGADAAVDETSCDWLARGPTPPGAAFAWPRPDDAPARVPPESAPSRRPVS 60

Query: 66  Q-----------------------ADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICA 102
           Q                       A  IA++A SL  L++ L+ F  C L +T+      
Sbjct: 61  QNPTADVTRPRAATPLGASEAETGARRIAREAQSLEALEAALKGFDGCGLKATATKLCFY 120

Query: 103 TQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPG 162
                 DLMI+G  P   +++ GKPF G+ G +LDKML +I +  + +HI+ I  W PPG
Sbjct: 121 RGAPAADLMIVGEAPGRDEDLEGKPFVGRAGRLLDKMLAAIGLSESDVHITNIVYWRPPG 180

Query: 163 NRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTP 222
           NR  +  E   CRP + RQIEL++PKI++ +G       F   A+   +  GKW  L   
Sbjct: 181 NRTPTPQEALACRPFLERQIELVAPKIVVAVGGSAAKELFGV-AEGIMRLRGKWRELTVG 239

Query: 223 HSIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
              I  LAT+HP  L++ P  K   W  L+ ++  L
Sbjct: 240 DRKIQALATLHPAYLLRTPAAKNLAWLDLLQIRSKL 275


>gi|86139051|ref|ZP_01057622.1| uracil-DNA glycosylase [Roseobacter sp. MED193]
 gi|85824282|gb|EAQ44486.1| uracil-DNA glycosylase [Roseobacter sp. MED193]
          Length = 266

 Score =  203 bits (515), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 62/268 (23%), Positives = 109/268 (40%), Gaps = 18/268 (6%)

Query: 3   SKRILSQEQILTIALFYADSGV-YWVFDEPNNEATYESQRKEKSIDSAIQPITNIRH--- 58
            +  +       +  +  + G    + +EP N     +   +             +    
Sbjct: 1   MESAIDYWSAKALLEWQVELGATEALCEEPVNRYELAAPAPKGRQGQQAGQQPGQKPGMP 60

Query: 59  -------IHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLM 111
                       V +A   A  A  L  L++ +  +  C L   + + + A    G  +M
Sbjct: 61  PPVAPKPKPVDPVAEARKAAAAAAELPSLRAAMAEYRHCDLKMGARNLVFADGQPGARVM 120

Query: 112 IIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQI-HISMISPWHPPGNRNLSNIE 170
           +IG  P   ++  GKPF G  G +LD+MLQ+I++ R +  +I+ + PW P  NR+ S  E
Sbjct: 121 VIGEAPGRDEDQQGKPFVGAAGQLLDRMLQAIDLGRDKNVYITNVLPWRPQQNRDPSPEE 180

Query: 171 MEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLA 230
           +++  P + R +EL  P+IL+ +GN +             +  G W+         P L 
Sbjct: 181 IDMMLPFLERHVELAQPEILVLMGNISCQAVLGKRG--ITRLRGTWAEAWGK----PVLP 234

Query: 231 TVHPQELIQYPLIKKNTWHALITLKKAL 258
             HP  L++ P  K+  W  L+ LK  L
Sbjct: 235 MFHPAYLLRQPDQKRAAWADLLELKARL 262


>gi|67459732|ref|YP_247356.1| uracil-DNA glycosylase [Rickettsia felis URRWXCal2]
 gi|67005265|gb|AAY62191.1| Uracil-DNA glycosylase, family 4 [Rickettsia felis URRWXCal2]
          Length = 262

 Score =  202 bits (514), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 66/253 (26%), Positives = 122/253 (48%), Gaps = 9/253 (3%)

Query: 16  ALFYADSGV-YWVFDEPNNEA----TYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSI 70
             + +  GV Y+  + P        T  +++ +  + S  +   N+       +  A S+
Sbjct: 5   LKWLSAIGVEYYCLEHPPKLKVCNNTELTEKPQVKLMSTKETAFNMNDKVHDNITLARSL 64

Query: 71  AQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSG 130
           A KA ++ ELK  L +F+ C L   + +T+         +M+IG  P  ++++ G PF G
Sbjct: 65  ADKANNIEELKESLLNFNGCELKKFATNTVFGDGNLEAKIMLIGEAPGSTEDLKGIPFCG 124

Query: 131 KTGNMLDKMLQSIEIMRTQI-HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKI 189
           ++GN+LD ML +I I R    +I+    W PP NR  +  E++ICRP + + I LI+PK+
Sbjct: 125 ESGNLLDNMLYAIGISRKNNAYITNTVFWRPPANRQPTLEEVDICRPFVEKHIALINPKL 184

Query: 190 LLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPT--LATVHPQELIQYPLIKKNT 247
           ++ +G+               +   ++      +   P    A  HP  L++ P+ K+ +
Sbjct: 185 IILVGSTAATSLLG-KNSGITKIRQEYYFYTNKYLSAPIQTTAIFHPAYLLRQPMQKRTS 243

Query: 248 WHALITLKKALKN 260
           W+ L+ +K+ L N
Sbjct: 244 WYDLLKIKEYLVN 256


>gi|23014826|ref|ZP_00054624.1| COG1573: Uracil-DNA glycosylase [Magnetospirillum magnetotacticum
           MS-1]
          Length = 279

 Score =  201 bits (512), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 70/266 (26%), Positives = 111/266 (41%), Gaps = 20/266 (7%)

Query: 14  TIALFYADSGVYW-VFDEPNNEATYES----------------QRKEKSIDSAIQPITNI 56
            I  +Y ++GV   + +EP +                       R        +   T  
Sbjct: 12  DILRWYLEAGVDESMGEEPVDRYATSRRAVESRAAAAAPAVAPPRHSPRQAEPMAAPTGA 71

Query: 57  RHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYT 116
               S L   A  +A     L  L+  +  F    L   + ST+         +M IG  
Sbjct: 72  SLSASALPGTAAHLAASCADLQALRHAMEGFEGLPLKQAASSTVFGDGNPEASVMCIGEA 131

Query: 117 PSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRP 176
           P   ++  G PF G +G +LD+ML SI + RT  +I+ + PW PP NR  +  E+ +C P
Sbjct: 132 PGQEEDRRGLPFVGPSGKLLDRMLASIGLDRTSCYITNVVPWRPPANRKPTPDEVAVCMP 191

Query: 177 IIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPH--SIIPTLATVHP 234
            + R IEL+ P++L+ +G           A    +  G+W    +P     IP LAT HP
Sbjct: 192 FLTRHIELVDPQVLILLGGAAAAAV-LAKADGINRLRGQWFEFNSPGLPRPIPALATFHP 250

Query: 235 QELIQYPLIKKNTWHALITLKKALKN 260
             L++ P  K++ W  L+ + K L +
Sbjct: 251 AYLLRTPDAKRDAWRDLLMIAKKLAS 276


>gi|114762038|ref|ZP_01441506.1| uracil-DNA glycosylase [Pelagibaca bermudensis HTCC2601]
 gi|114545062|gb|EAU48065.1| uracil-DNA glycosylase [Roseovarius sp. HTCC2601]
          Length = 264

 Score =  201 bits (512), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 61/268 (22%), Positives = 112/268 (41%), Gaps = 16/268 (5%)

Query: 3   SKRILSQEQILTIALFYADSGVYWVF-DEPNNEATYESQRKEKSIDSAI--------QPI 53
               L          +  + G      D   +    E + +     +A+           
Sbjct: 1   MDSGLDWHYARAALEWQLELGADEAIGDTAVDRFAAEIELQAAREAAAVAQAPARGGAMP 60

Query: 54  TNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMII 113
                     V  A   A  A +L +L+  + +F  C L   + + + +       +MI+
Sbjct: 61  PPKIDEGPDPVAVAQQAAAAAATLDDLREAMAAFEHCELRRGARNLVFSDGVAQARVMIV 120

Query: 114 GYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEME 172
           G  P   +++ GKPF G+ G +LD+ML +I + R   ++I+ + PW PP NR+    E+ 
Sbjct: 121 GEAPGRDEDLQGKPFVGRAGQLLDRMLGAIGLSRAENVYITNVLPWRPPQNRDPKPDEIA 180

Query: 173 ICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATV 232
           +  P + R I L++P++L+ +GN + +           +  GKW+        +P L   
Sbjct: 181 MLTPFLARHIALVAPEVLVVMGNISCDALLGRRG--ITRLRGKWAEAQ----GLPALPMF 234

Query: 233 HPQELIQYPLIKKNTWHALITLKKALKN 260
           HP  L++ P +K+  W  L+ LK  L+ 
Sbjct: 235 HPAYLLRQPQMKREAWADLLELKAKLRA 262


>gi|332559474|ref|ZP_08413796.1| Phage SPO1 DNA polymerase-related protein [Rhodobacter sphaeroides
           WS8N]
 gi|332277186|gb|EGJ22501.1| Phage SPO1 DNA polymerase-related protein [Rhodobacter sphaeroides
           WS8N]
          Length = 259

 Score =  201 bits (512), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 59/250 (23%), Positives = 108/250 (43%), Gaps = 14/250 (5%)

Query: 18  FYADSGV-YWVFDEPNNEATYESQRKEKSIDSAIQPITNIRH-IHSPLVQQADSIAQKAC 75
           +  D G    + D P N       +      +A+     +     +  V++A   A  A 
Sbjct: 15  WQVDLGATEAILDAPVNRYELGDAQPVPKAAAAVAATAALDPVAAADPVEEARRAAAAAP 74

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L  L+  + ++  C L   + +T+ +       LM+IG  P   ++ +G+PF G+ G +
Sbjct: 75  TLEALREAMAAYDHCDLKRGARNTVFSDGHPAARLMLIGEAPGREEDAAGRPFVGRAGQL 134

Query: 136 LDKMLQSIEIMRTQI------HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKI 189
           LD+M  +I + RT        +I+ + PW PP NR+ S  E+ +  P + R +EL +P +
Sbjct: 135 LDRMFAAIGLSRTSPDAETALYITNVMPWRPPQNRDPSPEEVAMMTPFLARHVELAAPDL 194

Query: 190 LLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWH 249
           ++  GN               +  G+W+         P +   HP  L++ P  K+  W 
Sbjct: 195 IVVTGNTACAALLGRTG--ITRLRGRWAEAW----GRPVMPMCHPAYLLRNPEAKREAWA 248

Query: 250 ALITLKKALK 259
            L+ +K  L 
Sbjct: 249 DLLEVKARLA 258


>gi|221640492|ref|YP_002526754.1| Phage SPO1 DNA polymerase-related protein [Rhodobacter sphaeroides
           KD131]
 gi|221161273|gb|ACM02253.1| Phage SPO1 DNA polymerase-related protein [Rhodobacter sphaeroides
           KD131]
          Length = 260

 Score =  201 bits (512), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 60/251 (23%), Positives = 107/251 (42%), Gaps = 15/251 (5%)

Query: 18  FYADSGV-YWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHI--HSPLVQQADSIAQKA 74
           +  D G    + D P N       +      +A    T        +  V++A   A  A
Sbjct: 15  WQVDLGATEAILDAPVNRYELGDAQPVPKAAAAAVAATAALDPVAAADPVEEARRAAAAA 74

Query: 75  CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
            +L  L+  + ++  C L   + +T+ +       LM+IG  P   ++ +G+PF G+ G 
Sbjct: 75  PTLEALREAMAAYDHCDLKRGARNTVFSDGHPAARLMLIGEAPGREEDAAGRPFVGRAGQ 134

Query: 135 MLDKMLQSIEIMRTQI------HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPK 188
           +LD+M  +I + RT        +I+ + PW PP NR+ S  E+ +  P + R +EL +P 
Sbjct: 135 LLDRMFAAIGLSRTSPDAETALYITNVMPWRPPQNRDPSPEEVAMMTPFLARHVELAAPD 194

Query: 189 ILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTW 248
           +++  GN               +  G+W+         P +   HP  L++ P  K+  W
Sbjct: 195 LIVVTGNTACAALLGRTG--ITRLRGRWAEAW----GRPVMPMCHPAYLLRNPEAKREAW 248

Query: 249 HALITLKKALK 259
             L+ +K  L 
Sbjct: 249 ADLLEVKARLA 259


>gi|126463421|ref|YP_001044535.1| phage SPO1 DNA polymerase-related protein [Rhodobacter sphaeroides
           ATCC 17029]
 gi|126105085|gb|ABN77763.1| phage SPO1 DNA polymerase-related protein [Rhodobacter sphaeroides
           ATCC 17029]
          Length = 260

 Score =  201 bits (511), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 60/251 (23%), Positives = 108/251 (43%), Gaps = 15/251 (5%)

Query: 18  FYADSGV-YWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHI--HSPLVQQADSIAQKA 74
           +  D G    + D P N       +      +A    T        +  V++A   A  A
Sbjct: 15  WQVDLGATEAILDAPVNRYELGDAQPVPKAAAAAVAATAALDPVAAADPVEEARRAAAAA 74

Query: 75  CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
            +L  L+  + ++  C L   + +T+ +       LM+IG  P   ++ +G+PF G+ G 
Sbjct: 75  PTLEALREAMAAYDHCDLKRGARNTVFSDGHPAARLMLIGEAPGREEDAAGRPFVGRAGQ 134

Query: 135 MLDKMLQSIEIMRTQ------IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPK 188
           +LD+M  +I + RT       ++I+ + PW PP NR+ S  E+ +  P + R +EL +P 
Sbjct: 135 LLDRMFAAIGLSRTSLDAETALYITNVMPWRPPQNRDPSPEEVAMMTPFLARHVELAAPD 194

Query: 189 ILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTW 248
           +++  GN               +  G+W+         P +   HP  L++ P  K+  W
Sbjct: 195 LIVVTGNTACAALLGRTG--ITRLRGRWAEAW----GRPVMPMCHPAYLLRNPEAKREAW 248

Query: 249 HALITLKKALK 259
             L+ +K  L 
Sbjct: 249 ADLLEVKARLA 259


>gi|148260066|ref|YP_001234193.1| phage SPO1 DNA polymerase-related protein [Acidiphilium cryptum
           JF-5]
 gi|146401747|gb|ABQ30274.1| phage SPO1 DNA polymerase-related protein [Acidiphilium cryptum
           JF-5]
          Length = 276

 Score =  201 bits (511), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 69/238 (28%), Positives = 105/238 (44%), Gaps = 10/238 (4%)

Query: 21  DSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHEL 80
           + G      E   +    S +   +  +   P T +R   +P        A  A SL EL
Sbjct: 25  EWGADEALLETPPDRAAASPQHRPASPAPAAPGTVVRLPTAPS-------APGAASLAEL 77

Query: 81  KSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKML 140
           ++ L +F  C L  T+   + A   E   +MIIG  P   ++  G+PF G  G +LDKML
Sbjct: 78  RAALDAFDQCALKRTATQLVFADGAEDARIMIIGEAPGGEEDRIGRPFVGPAGQLLDKML 137

Query: 141 QSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNF 200
            SI + R  + I  + PW PPGNR  S+ E+  C P + R I L+ P+ L+ +G      
Sbjct: 138 GSIGLDRGTVRIVNVVPWRPPGNRTPSDTEIAQCLPFLHRHIALVRPERLVLLGAVAVRA 197

Query: 201 FFNNDAQKTYQNLGKWSNLCTPH--SIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
                     +  GKW  +        +  L T HP  L++ P  K+  W  L+ L++
Sbjct: 198 LIGGK-DGITRLRGKWREVTIEGLDQTLRALPTYHPAYLLRQPAAKRLAWADLLELRR 254


>gi|254419584|ref|ZP_05033308.1| uracil-DNA glycosylase, family 4, putative [Brevundimonas sp. BAL3]
 gi|196185761|gb|EDX80737.1| uracil-DNA glycosylase, family 4, putative [Brevundimonas sp. BAL3]
          Length = 265

 Score =  201 bits (510), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 58/264 (21%), Positives = 109/264 (41%), Gaps = 8/264 (3%)

Query: 2   TSKRILSQEQILTIALFYADSGVYWVF-DEPNNEATYESQRKEKSIDSAIQPI--TNIRH 58
            + +      + ++  F+ D+GV   + D P +          K++  A   +       
Sbjct: 1   MNAQPHDIAAVESLLAFWRDAGVDACYGDAPVDHTHLAPPPALKAVQKATASVVMPLAGP 60

Query: 59  IHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCS-TSLSTICATQTEGQDLMIIGYTP 117
                + +A  +A  A +L +L + + +F  C L    +  ++         +M+IG  P
Sbjct: 61  SAQDALAEARRLATGASTLQDLAAAVAAFEGCPLRGMGASQSVFGRGNPNAPVMVIGEGP 120

Query: 118 SDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPI 177
              ++  G+PF G+ G +LD+ML +  +   ++ I+    W PPGNR  +  E  +C P 
Sbjct: 121 GADEDRLGQPFVGRAGKLLDRMLAAAGLT-DKVFITNTVFWRPPGNRTPTPQEQAVCAPF 179

Query: 178 IMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSII--PTLATVHPQ 235
           + R   L+ PK +L +G          +     +  G+W         +  P L T+HP 
Sbjct: 180 VERAFALLQPKAVLLLGAAAAKSVLQTEDGIM-KMRGQWREWRLAEGGVSAPALPTLHPA 238

Query: 236 ELIQYPLIKKNTWHALITLKKALK 259
            L++ P  K+  W  L+     L 
Sbjct: 239 FLLRQPQAKRQVWADLLAFAAKLD 262


>gi|15893232|ref|NP_360946.1| N-terminus of bacteriophage-type DNA polymerase [Rickettsia conorii
           str. Malish 7]
 gi|15620449|gb|AAL03847.1| N-terminus of bacteriophage-type DNA polymerase [Rickettsia conorii
           str. Malish 7]
          Length = 279

 Score =  201 bits (510), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 65/253 (25%), Positives = 122/253 (48%), Gaps = 9/253 (3%)

Query: 16  ALFYADSGV-YWVFDEPN----NEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSI 70
             + +  GV Y+  + P        T  +++ +  + S  +   N+       +  A S+
Sbjct: 23  LKWLSAIGVEYYCHEHPPQLKVRNNTELTEKPQVKLMSTKETAFNMNDKVHDNITLARSL 82

Query: 71  AQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSG 130
           A KA ++ ELK  L +F+ C L   + +T+         +M+IG  P  ++++ G PF G
Sbjct: 83  ADKANNIEELKESLLNFNGCELKKFATNTVFGDGNLEAKIMLIGEAPGSTEDLKGIPFYG 142

Query: 131 KTGNMLDKMLQSIEIMRTQI-HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKI 189
           ++GN+LD ML +I I R    +I+    W PP NR  +  E++ICRP + + I LI+P++
Sbjct: 143 ESGNLLDNMLHAIGISRKNNAYITNTVFWRPPANRQPTFEEVDICRPFVEKHIALINPQL 202

Query: 190 LLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPT--LATVHPQELIQYPLIKKNT 247
           ++ +G+               +   ++      +   P    A  HP  L++ P+ K+ +
Sbjct: 203 IILVGSTAATSLLG-KNSGITKIRQEYYFYTNKYLSAPIQTTAIFHPAYLLRQPMQKRTS 261

Query: 248 WHALITLKKALKN 260
           W+ L+ +K+ L N
Sbjct: 262 WYDLLKIKEYLVN 274


>gi|34581100|ref|ZP_00142580.1| N-terminus of bacteriophage-type DNA polymerase [Rickettsia
           sibirica 246]
 gi|238651090|ref|YP_002916948.1| N-terminus of bacteriophage-type DNA polymerase [Rickettsia
           peacockii str. Rustic]
 gi|28262485|gb|EAA25989.1| N-terminus of bacteriophage-type DNA polymerase [Rickettsia
           sibirica 246]
 gi|238625188|gb|ACR47894.1| N-terminus of bacteriophage-type DNA polymerase [Rickettsia
           peacockii str. Rustic]
          Length = 261

 Score =  201 bits (510), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 65/253 (25%), Positives = 122/253 (48%), Gaps = 9/253 (3%)

Query: 16  ALFYADSGV-YWVFDEPN----NEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSI 70
             + +  GV Y+  + P        T  +++ +  + S  +   N+       +  A S+
Sbjct: 5   LKWLSAIGVEYYCHEHPPQLKVRNNTELTEKPQVKLMSTKETAFNMNDKVHDNITLARSL 64

Query: 71  AQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSG 130
           A KA ++ ELK  L +F+ C L   + +T+         +M+IG  P  ++++ G PF G
Sbjct: 65  ADKANNIEELKESLLNFNGCELKKFATNTVFGDGNLEAKIMLIGEAPGSTEDLKGIPFYG 124

Query: 131 KTGNMLDKMLQSIEIMRTQI-HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKI 189
           ++GN+LD ML +I I R    +I+    W PP NR  +  E++ICRP + + I LI+P++
Sbjct: 125 ESGNLLDNMLHAIGISRKNNAYITNTVFWRPPANRQPTFEEVDICRPFVEKHIALINPQL 184

Query: 190 LLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPT--LATVHPQELIQYPLIKKNT 247
           ++ +G+               +   ++      +   P    A  HP  L++ P+ K+ +
Sbjct: 185 IILVGSTAATSLLG-KNSGITKIRQEYYFYTNKYLSAPIQTTAIFHPAYLLRQPMQKRTS 243

Query: 248 WHALITLKKALKN 260
           W+ L+ +K+ L N
Sbjct: 244 WYDLLKIKEYLVN 256


>gi|157829143|ref|YP_001495385.1| N-terminus of bacteriophage-type DNA polymerase [Rickettsia
           rickettsii str. 'Sheila Smith']
 gi|165933872|ref|YP_001650661.1| uracil DNA glycosylase superfamily protein [Rickettsia rickettsii
           str. Iowa]
 gi|157801624|gb|ABV76877.1| N-terminus of bacteriophage-type DNA polymerase [Rickettsia
           rickettsii str. 'Sheila Smith']
 gi|165908959|gb|ABY73255.1| uracil DNA glycosylase superfamily protein [Rickettsia rickettsii
           str. Iowa]
          Length = 261

 Score =  200 bits (509), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 65/253 (25%), Positives = 122/253 (48%), Gaps = 9/253 (3%)

Query: 16  ALFYADSGV-YWVFDEPN----NEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSI 70
             + +  GV Y+  + P        T  +++ +  + S  + + N+       +  A S+
Sbjct: 5   LKWLSAIGVEYYCHEHPPQLKVRNNTELTEKPQVKLMSTKETVFNMNDKVHDNITLARSL 64

Query: 71  AQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSG 130
           A KA ++ ELK  L  F+ C L   + +T+         +M+IG  P  ++++ G PF G
Sbjct: 65  ADKANNIEELKESLLHFNGCELKKFATNTVFGDGNLEAKIMLIGEAPGSTEDLKGIPFYG 124

Query: 131 KTGNMLDKMLQSIEIMRTQI-HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKI 189
           ++GN+LD ML +I I R    +I+    W PP NR  +  E++ICRP + + I LI+P++
Sbjct: 125 ESGNLLDNMLHAIGISRKNNAYITNTVFWRPPANRQPTFEEVDICRPFVEKHIALINPQL 184

Query: 190 LLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPT--LATVHPQELIQYPLIKKNT 247
           ++ +G+               +   ++      +   P    A  HP  L++ P+ K+ +
Sbjct: 185 IILVGSTAATSLLG-KNSGITKIRQEYYFYTNKYLSAPIQTTAIFHPAYLLRQPMQKRTS 243

Query: 248 WHALITLKKALKN 260
           W+ L+ +K+ L N
Sbjct: 244 WYDLLKIKEYLVN 256


>gi|84500233|ref|ZP_00998499.1| uracil-DNA glycosylase [Oceanicola batsensis HTCC2597]
 gi|84392167|gb|EAQ04435.1| uracil-DNA glycosylase [Oceanicola batsensis HTCC2597]
          Length = 257

 Score =  200 bits (508), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 61/265 (23%), Positives = 109/265 (41%), Gaps = 15/265 (5%)

Query: 3   SKRILSQEQILTIALFYADSGVYWVF-DEPNNEATYESQRKEKSIDSAIQPITNIRHIHS 61
            +  L       +  +  + G      D P +   +       +      P   +R    
Sbjct: 1   MESALDWHSAYALLDWQVELGADEAIGDTPVDRFAHVE--PPSAAKRKAAPEQPVRRKEI 58

Query: 62  PLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSD 121
             V+ A   AQ A SL  L+  L ++  C L   + + + +       ++I+G  P   +
Sbjct: 59  DAVEVARQAAQAAGSLDALREALGAYEHCALKRGARNLVFSDGHPAARVLILGEAPDRDE 118

Query: 122 NISGKPFSGKTGNMLDKMLQSIEIMR------TQIHISMISPWHPPGNRNLSNIEMEICR 175
           +  G+PF G+ G +LD+ML +I++ R        ++I+ + PW P  NR+    E+ +  
Sbjct: 119 DREGRPFVGRAGRLLDRMLAAIDLDRTGETPDRAVYITNVLPWRPLQNRDPEPEEIAMML 178

Query: 176 PIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQ 235
           P + + IEL+ P  ++ +GN               +  G W+         PTL   HP 
Sbjct: 179 PFVQKHIELVDPAFVILMGNIACRAALGKQG--ILRLRGTWTEAF----GRPTLPMTHPT 232

Query: 236 ELIQYPLIKKNTWHALITLKKALKN 260
            L+Q P  K+  W  L++LK  L +
Sbjct: 233 YLLQQPRAKREAWADLLSLKVRLSS 257


>gi|159045630|ref|YP_001534424.1| uracil-DNA glycosylase [Dinoroseobacter shibae DFL 12]
 gi|157913390|gb|ABV94823.1| uracil-DNA glycosylase [Dinoroseobacter shibae DFL 12]
          Length = 265

 Score =  200 bits (508), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 62/268 (23%), Positives = 112/268 (41%), Gaps = 17/268 (6%)

Query: 3   SKRILSQEQILTIALFYADSGV-YWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHS 61
            ++ L    +     +  + G    + D P +        + K+  +A    +       
Sbjct: 1   MEQELDYHTLRAALEWQVELGATEAISDAPVDRTVAVEPERPKAPAAAPAAPSVAAAPAP 60

Query: 62  PLVQ----QADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTP 117
              +     A   A ++ SL  L+  L ++  C L   + + + +    G  +MI+G  P
Sbjct: 61  DGPEMAVTAARGAAAQSGSLEALRDALAAYPHCELRKGARNLVFSDGRPGARVMILGEAP 120

Query: 118 SDSDNISGKPFSGKTGNMLDKMLQSIEIMR------TQIHISMISPWHPPGNRNLSNIEM 171
              ++  G+PF G+ G +LDKML +I + R        ++I+ I PW PP NR+    E+
Sbjct: 121 GRDEDREGRPFVGRAGQLLDKMLAAIGLARDAPDPGHAVYITNILPWRPPQNRDPRPDEI 180

Query: 172 EICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLAT 231
            +  P + R + L  P+IL+ +GN +             +  G+W+         P L  
Sbjct: 181 AMMMPFVQRHVTLADPEILVLMGNISCQAVLGRKG--ITRLRGQWTEAMDR----PALPM 234

Query: 232 VHPQELIQYPLIKKNTWHALITLKKALK 259
            HP  L++ P  K+  W  L+ L+  LK
Sbjct: 235 FHPAFLLRQPAQKRAAWADLLDLQARLK 262


>gi|229587212|ref|YP_002845713.1| Uracil-DNA glycosylase, family 4 [Rickettsia africae ESF-5]
 gi|228022262|gb|ACP53970.1| Uracil-DNA glycosylase, family 4 [Rickettsia africae ESF-5]
          Length = 279

 Score =  199 bits (507), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 65/253 (25%), Positives = 121/253 (47%), Gaps = 9/253 (3%)

Query: 16  ALFYADSGV-YWVFDEPN----NEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSI 70
             + +  GV Y+  + P        T  +++ +  + S  +   N+       +  A S+
Sbjct: 23  LKWLSAIGVEYYCHEHPPQLKVRNNTELTEKPQVKLMSTKETAFNMNDKVHDNITLARSL 82

Query: 71  AQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSG 130
           A KA ++ ELK  L +F+ C L   + +T+         +M+IG  P   +++ G PF G
Sbjct: 83  ADKADNIEELKESLLNFNGCELKKFATNTVFGDGNLEAKIMLIGEAPGSIEDLKGIPFYG 142

Query: 131 KTGNMLDKMLQSIEIMRTQI-HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKI 189
           ++GN+LD ML +I I R    +I+    W PP NR  +  E++ICRP + + I LI+P++
Sbjct: 143 ESGNLLDNMLHAIGISRKNNAYITNTVFWRPPANRQPTFEEVDICRPFVEKHIALINPQL 202

Query: 190 LLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPT--LATVHPQELIQYPLIKKNT 247
           ++ +G+               +   ++      +   P    A  HP  L++ P+ K+ +
Sbjct: 203 IILVGSTAATSLLG-KNSGITKIRQEYYFYTNKYLSAPIQTTAIFHPAYLLRQPMQKRTS 261

Query: 248 WHALITLKKALKN 260
           W+ L+ +K+ L N
Sbjct: 262 WYDLLKIKEYLVN 274


>gi|149913413|ref|ZP_01901946.1| cytosine deaminase [Roseobacter sp. AzwK-3b]
 gi|149812533|gb|EDM72362.1| cytosine deaminase [Roseobacter sp. AzwK-3b]
          Length = 266

 Score =  199 bits (507), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 59/269 (21%), Positives = 112/269 (41%), Gaps = 18/269 (6%)

Query: 3   SKRILSQEQILTIALFYADSGV-YWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHS 61
            +          +  +  + G    + D P N           +  +  +    +    +
Sbjct: 1   MESTFDPHAAKALLDWQIELGATEAIGDLPVNRYELPDTPPAAAAATKPRAAQAVAASVA 60

Query: 62  PLVQQADSIAQKAC-----SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYT 116
           P          +A      +L  L+  L  +  C L   + + + A       +MIIG  
Sbjct: 61  PAPAADPLAEARAAAGAAGTLDALREALAGYEHCDLKRGARNLVFADGQPSARVMIIGEA 120

Query: 117 PSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQI------HISMISPWHPPGNRNLSNIE 170
           P   +++ G+PF G+ G +LD+ML++I++ RT        +I+ + PW PP NR+    E
Sbjct: 121 PGRDEDLQGRPFVGRAGQLLDRMLEAIDMSRTAPEAGQAVYITNVMPWRPPQNRDPKPEE 180

Query: 171 MEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLA 230
           + +  P + R ++L+ P+I++ +GN +             +  G+W+         PTL 
Sbjct: 181 IAMMLPFVQRHVDLVDPEIVVLMGNISCQAGLGRQG--ITRLRGQWTESY----GRPTLP 234

Query: 231 TVHPQELIQYPLIKKNTWHALITLKKALK 259
            VHP  L++ P  K+  W  L+ L+  L+
Sbjct: 235 MVHPAYLLRNPNAKREAWADLLELQARLR 263


>gi|188583952|ref|YP_001927397.1| phage SPO1 DNA polymerase-related protein [Methylobacterium populi
           BJ001]
 gi|179347450|gb|ACB82862.1| phage SPO1 DNA polymerase-related protein [Methylobacterium populi
           BJ001]
          Length = 309

 Score =  199 bits (506), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 76/301 (25%), Positives = 122/301 (40%), Gaps = 43/301 (14%)

Query: 1   MTSKRILS--QEQILTIALFYADSGVYWVFDE---------------------------- 30
           MT+    S  +  +++   F+ ++G+    DE                            
Sbjct: 4   MTANHADSDARADLISYLDFHVEAGIDAALDERPHDRFAEAEAVQAAAPRAEPAPRREPP 63

Query: 31  -----------PNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHE 79
                      P         R     +                   A + A +  +L E
Sbjct: 64  PRREAPPGEDAPLEFRRELPSRDPPPREPPRTYGNAAGAKPGEAADDARARAAQMQTLEE 123

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKM 139
           L++LLR F  C L  T+ + + A       +M +G  P   ++  GKPF G++G +LD+M
Sbjct: 124 LEALLRGFEGCTLRFTAKNLVFADGNPQARVMFVGEAPGADEDRIGKPFMGRSGQLLDRM 183

Query: 140 LQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKN 199
           + +I + RT  +IS + PW PPGNRN +  E+ ICRP + RQIEL +P IL+ +G     
Sbjct: 184 MAAIGLDRTSAYISNVVPWRPPGNRNPTPQEISICRPFVERQIELANPDILVCLGAPATQ 243

Query: 200 FFFNNDAQKTYQNLGKWSNLC-TPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
                      +  G++     +    I  LAT+HP  L++ P+ K+  W     LK AL
Sbjct: 244 TLTGTK-DGILKARGRFYPYRLSDGREIRALATLHPAYLLRQPVQKRLAWRDFRMLKTAL 302

Query: 259 K 259
            
Sbjct: 303 D 303


>gi|150395871|ref|YP_001326338.1| phage SPO1 DNA polymerase-like protein [Sinorhizobium medicae
           WSM419]
 gi|150027386|gb|ABR59503.1| phage SPO1 DNA polymerase-related protein [Sinorhizobium medicae
           WSM419]
          Length = 289

 Score =  199 bits (506), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 89/287 (31%), Positives = 138/287 (48%), Gaps = 31/287 (10%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVF-DEPNNEAT----------------------- 36
           M S   LS  ++  +  F+A++GV W+  +EP +                          
Sbjct: 1   MISANDLSPSELAALLAFHAEAGVEWLIEEEPLDRLAEFEAMRMRRTESRAAPQANEMAA 60

Query: 37  ------YESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDC 90
                  E+  +E++  +       +       +++A  +A  A SL EL++ + +F  C
Sbjct: 61  ERRQPVPETTARERAQAAPTARPPVVAIPDEQAIKEAQFVAGAARSLGELRTAMEAFSGC 120

Query: 91  HLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQI 150
           +L +++ + + A  +    +MIIG  P   D+  G PF+G+ G ML++ML  I + R  +
Sbjct: 121 NLRNSARNLVFAEGSAASGVMIIGPMPYADDDRDGHPFAGRHGQMLERMLFGIGLSRDDV 180

Query: 151 HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTY 210
            ++   PW PPGNR  S  E +ICRP I RQIEL  PK LL +GN T  FFF        
Sbjct: 181 LLTNTVPWRPPGNRVPSAREADICRPFIERQIELAEPKQLLLLGNFTARFFFGGAEMIH- 239

Query: 211 QNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKA 257
           Q  G+W  L    + IP LAT+HPQ+LI  P+ K+  W  L+  K  
Sbjct: 240 QLRGEWRELTFAGTSIPALATLHPQDLIAAPINKRFAWLDLLAFKSR 286


>gi|163853643|ref|YP_001641686.1| phage SPO1 DNA polymerase-related protein [Methylobacterium
           extorquens PA1]
 gi|163665248|gb|ABY32615.1| phage SPO1 DNA polymerase-related protein [Methylobacterium
           extorquens PA1]
          Length = 323

 Score =  199 bits (506), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 77/315 (24%), Positives = 122/315 (38%), Gaps = 57/315 (18%)

Query: 1   MTSKRILSQE--QILTIALFYADSGVYWVFDE---------------------PNNEATY 37
           MT+    +     +++   F+  +GV    DE                     P      
Sbjct: 4   MTANHADTDARGDLISFLDFHVAAGVDAALDEQPHDRFAEAESVRADAASQAEPATRREP 63

Query: 38  ESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKA----------------------- 74
              R+E     +  P  +      P +     +  +                        
Sbjct: 64  LEPRREPLPPRSEPPRRDAPSAEEPPLAFRRELPSRDAPTREPPRTYGNAAGAKPGEAAD 123

Query: 75  ---------CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISG 125
                     +L EL+ LLR F  C L  T+ + + A       +M +G  P   ++  G
Sbjct: 124 DARARAAQMKTLDELEELLRGFEGCGLRFTAKNLVFADGNPQARVMFVGEAPGADEDRIG 183

Query: 126 KPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELI 185
           KPF G++G +LD+M+ +I + RT  +IS + PW PPGNRN +  E+ ICRP + RQIEL 
Sbjct: 184 KPFMGRSGQLLDRMMAAIGLDRTSAYISNVVPWRPPGNRNPTPQEISICRPFVERQIELA 243

Query: 186 SPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTP-HSIIPTLATVHPQELIQYPLIK 244
           +P IL+ +G                +  G++          I  LAT+HP  L++ P+ K
Sbjct: 244 NPDILVCLGAPATQTLTGTK-DGILKARGRFYPYRLGDGREIRALATLHPAYLLRQPVQK 302

Query: 245 KNTWHALITLKKALK 259
           +  W     LK AL 
Sbjct: 303 RLAWRDFRMLKSALD 317


>gi|114328513|ref|YP_745671.1| uracil DNA glycosylase superfamily protein [Granulibacter
           bethesdensis CGDNIH1]
 gi|114316687|gb|ABI62747.1| uracil DNA glycosylase superfamily protein [Granulibacter
           bethesdensis CGDNIH1]
          Length = 282

 Score =  199 bits (505), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 70/281 (24%), Positives = 116/281 (41%), Gaps = 33/281 (11%)

Query: 11  QILTIALFYADSGVYWVF-DEPNNEATYESQRKEK---------SIDSAIQPITNIRHIH 60
             L       + G      D P +  T  +   +              A  P      + 
Sbjct: 2   DALAALHLQLEWGADEALGDSPVDRFTIVTAPAQAHSGIAPAELQTVPAAAPHPEPHSVP 61

Query: 61  SPLVQQADSIAQKAC-------------------SLHELKSLLRSFHDCHLCSTSLSTIC 101
              VQ+    A  A                    +L  L++ +  F  C L +T+   + 
Sbjct: 62  VQAVQRPAPFAGTASLLPQQGAARLAADIAAEASTLDALRAAMEQFDACPLKATATQLVF 121

Query: 102 ATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIH-ISMISPWHP 160
           +  T    LM+IG  P   ++ +GKPF G +G  LD+ML S  + R +   I+ + PW P
Sbjct: 122 SDGTYEAGLMLIGEAPGAEEDRAGKPFVGPSGKFLDRMLASAGMTRERDFVIANLIPWRP 181

Query: 161 PGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLC 220
           PGNRN +  E+  C P ++R I L  P++L+ +G  +      +      +  GKW+++ 
Sbjct: 182 PGNRNPTETEILQCLPFLLRHIALARPRMLVCLGGVSAKALTGST-VGIRRLRGKWTDIT 240

Query: 221 TPHS--IIPTLATVHPQELIQYPLIKKNTWHALITLKKALK 259
            P     +P L  +HP  L++ P  K+  W  ++TL+KAL 
Sbjct: 241 IPGLDSPLPMLPMLHPAYLLRNPGAKREAWADILTLRKALD 281


>gi|254797255|ref|YP_003082097.1| uracil-DNA glycosylase, family 4 [Neorickettsia risticii str.
           Illinois]
 gi|254590499|gb|ACT69861.1| uracil-DNA glycosylase, family 4 [Neorickettsia risticii str.
           Illinois]
          Length = 247

 Score =  199 bits (505), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 63/247 (25%), Positives = 111/247 (44%), Gaps = 7/247 (2%)

Query: 15  IALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKA 74
           I  FY   G+         + +  +Q     +      +       +   +  +      
Sbjct: 2   ILKFYDRLGIGVTT----ADISSPNQASITRVTGMPIDMKEFTESTACKYKTPERDLTCV 57

Query: 75  CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
            +L ELK+L+ +F  C L + + +T+         +M+IG  P + ++  G PF G++GN
Sbjct: 58  TTLDELKTLVSNFEGCQLKNNAKNTVFCDGNPDAKIMLIGEAPGEQEDKLGIPFCGRSGN 117

Query: 135 MLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           +LDKMLQ+I + RT+++I+    W PPGNR  +  E+EICRP +   I L+ PK+++ +G
Sbjct: 118 LLDKMLQAIGLDRTKVYITNAVFWRPPGNRRPTPEEIEICRPFLEHHIRLVLPKLIVLLG 177

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPH--SIIPTLATVHPQELIQYPLIKKNTWHALI 252
           +   +        +      K+     P     I T    HP  L++ P  KK  W  L 
Sbjct: 178 STATSSVLK-SQDRISILRNKFYEYKNPFIREGITTTVMFHPSYLLRQPAQKKLAWEDLK 236

Query: 253 TLKKALK 259
            ++  + 
Sbjct: 237 LIRSYID 243


>gi|254471665|ref|ZP_05085066.1| bacteriophage-type DNA polymerase N-terminal domain protein
           [Pseudovibrio sp. JE062]
 gi|211958867|gb|EEA94066.1| bacteriophage-type DNA polymerase N-terminal domain protein
           [Pseudovibrio sp. JE062]
          Length = 331

 Score =  198 bits (504), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 70/329 (21%), Positives = 129/329 (39%), Gaps = 71/329 (21%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVFD----------------------------EPN 32
           M+   + +  ++     F +  GV    +                             P 
Sbjct: 1   MSEVPVANAAELEAYLEFLSAVGVDCAMEDAPIDRFAQTQAQMEKQAQARPAPQQNFAPT 60

Query: 33  NEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQK------------------- 73
           N        + +  + ++ P    R++    V   D +  +                   
Sbjct: 61  NSFASPEPTQSQPKNLSVSPAEMARNLRENGVSADDKMKARQILERQRAAKESAVQTVMP 120

Query: 74  -----------------------ACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDL 110
                                  A SL EL+ +L  F  C+L  T+ + +    +    +
Sbjct: 121 NAADNAVVPNAETVGSARSAASSAQSLDELRKILSGFEGCNLRLTAKNLVFGDGSSKARV 180

Query: 111 MIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIE 170
           M +G  P   ++I G PF G++G++LD+ML+++ + R+ ++I+ + PW PPGNR  +  E
Sbjct: 181 MFVGEAPGREEDIQGVPFVGRSGHLLDRMLKAVGLDRSNVYIANVVPWRPPGNRTPTPHE 240

Query: 171 MEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLA 230
            EICRP I RQIEL+ P+I++F+G  +             +  GKW       +    +A
Sbjct: 241 TEICRPFIQRQIELVDPEIVVFLGAASAKTLSGAR-DGIRKLRGKWLTYNGEGTQRKAIA 299

Query: 231 TVHPQELIQYPLIKKNTWHALITLKKALK 259
           T HP  L++ P  K+  W  ++ ++  L+
Sbjct: 300 TYHPAYLLRSPAEKRYAWRDMLQIRAELE 328


>gi|297183987|gb|ADI20107.1| uracil-DNA glycosylase [uncultured alpha proteobacterium
           EB080_L06A09]
          Length = 264

 Score =  198 bits (504), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 65/270 (24%), Positives = 120/270 (44%), Gaps = 18/270 (6%)

Query: 3   SKRILSQEQILTIALFYADSGVYWVF-DEPNNEATYESQRKEKSIDSA-----IQPITNI 56
                S  +      +  + GV     D P N    E+   E  I+       +  + +I
Sbjct: 1   MSNSQSFYEAKLALEWQYEFGVDEAISDAPINRYEIETVPPELKINPKSNIAHVSSMPDI 60

Query: 57  RHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYT 116
                     A  +A+   +L EL+  +  F  C L   + + + +       +M+IG  
Sbjct: 61  LSSRETASDVAKILAKNCDNLTELRDAIGLFEMCSLKKGAKNLVFSDGPSNSRVMVIGEA 120

Query: 117 PSDSDNISGKPFSGKTGNMLDKMLQSIEIMRT------QIHISMISPWHPPGNRNLSNIE 170
           P+  ++  GKPF G  G ++DKM Q+I + R        I+I+   PW PP +R+ S+ E
Sbjct: 121 PTREEDSEGKPFVGAEGELVDKMFQAIGLSRRASDPNDAIYITTAIPWRPPQSRDPSSDE 180

Query: 171 MEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLA 230
           + +  P + R IELI+P  ++ +GN   +   N       +  G+W+           + 
Sbjct: 181 IAMMVPFLKRHIELINPDFIVLMGNIACSAVLNKVGIN--KFRGEWTEALGK----KIIP 234

Query: 231 TVHPQELIQYPLIKKNTWHALITLKKALKN 260
            +HP+ L++ P+ K++ W+ L++LK+ L +
Sbjct: 235 MLHPRSLLRDPMRKRDAWNDLLSLKEQLNS 264


>gi|162455919|ref|YP_001618286.1| DNA-directed DNA polymerase [Sorangium cellulosum 'So ce 56']
 gi|161166501|emb|CAN97806.1| DNA-directed DNA polymerase [Sorangium cellulosum 'So ce 56']
          Length = 215

 Score =  198 bits (504), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 50/209 (23%), Positives = 87/209 (41%), Gaps = 4/209 (1%)

Query: 50  IQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQD 109
             P               D+  ++A  L  L   +R+   C L      T+ +      +
Sbjct: 3   AAPAHRADTAARASATLPDTKEERAARLSLLAEEVRTCQKCPLHEGRTHTVFSRGDPSSE 62

Query: 110 LMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNI 169
           ++ +G  P   +++ G+PF G  G +LDKM+ ++   R +++I  I    PP NR     
Sbjct: 63  VVFVGEGPGAEEDLQGQPFVGAAGQLLDKMIAAMGYHRDEVYICNIVKCRPPKNRKPEPA 122

Query: 170 EMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTL 229
           EM  C P +  Q+ LI PK+++ +G           ++   +  G W         IP +
Sbjct: 123 EMAACSPYLTAQLALIKPKVIVALGATAVQGLIG-TSEGITKLRGTWKLYK---GSIPIM 178

Query: 230 ATVHPQELIQYPLIKKNTWHALITLKKAL 258
            T HP  L++ P  K+  W  L  + + L
Sbjct: 179 PTFHPAYLLRQPSAKREVWSDLKEVMRHL 207


>gi|209966444|ref|YP_002299359.1| uracil-DNA glycosylase, family 4 protein, putative [Rhodospirillum
           centenum SW]
 gi|209959910|gb|ACJ00547.1| uracil-DNA glycosylase, family 4 protein, putative [Rhodospirillum
           centenum SW]
          Length = 298

 Score =  198 bits (503), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 68/287 (23%), Positives = 120/287 (41%), Gaps = 40/287 (13%)

Query: 14  TIALFYADSGVYWVF-DEPNNEAT---------YESQRKEK------------------- 44
               F A+ G      D P +             E+ R                      
Sbjct: 9   AALRFLAEIGADEAVNDRPTDWTAIAARGRAVGPETDRPSAAVPPRAPGPARPGAARPAA 68

Query: 45  --SIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICA 102
                +     +      +   Q A + A  A +L ELK+ L +F  C L  T+ S + A
Sbjct: 69  SGPATAGAVSASPPPLGAAESSQTARAAAAAAATLPELKAALAAFEGCALRHTATSLVFA 128

Query: 103 TQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQI------HISMIS 156
                  +M++G  P + ++  G+PF G  G +LD+ML +I + R         +I+ + 
Sbjct: 129 DGDPAARVMLVGEAPGEQEDRQGRPFVGPAGLLLDRMLAAIGLDRRADTPDRAVYITNVV 188

Query: 157 PWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKW 216
            W PPGNR+ ++ E+  C P + R I+L++P +L+F+G  +         +   +  G+W
Sbjct: 189 NWRPPGNRSPTDGEIAACLPFVQRHIDLVNPAVLVFLGGISAKSLLQRT-EGITRLRGRW 247

Query: 217 SNLCTPH--SIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
            +  +P     +P L  +HP  L++ P  K+  W  L+ L++ L+ L
Sbjct: 248 FDYASPGLSRPLPALPMLHPAYLLRNPAAKREAWKDLLALQERLEAL 294


>gi|157964995|ref|YP_001499819.1| uracil-DNA glycosylase [Rickettsia massiliae MTU5]
 gi|157844771|gb|ABV85272.1| Uracil-DNA glycosylase, family 4 [Rickettsia massiliae MTU5]
          Length = 294

 Score =  198 bits (502), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 64/253 (25%), Positives = 122/253 (48%), Gaps = 9/253 (3%)

Query: 16  ALFYADSGV-YWVFDEP----NNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSI 70
             + +  GV Y+  + P        T  +++ +  + S  +   N+       +  + S+
Sbjct: 38  LKWLSAIGVEYYCHEHPTQLKVRNNTELTEKPQVKLKSTKETAFNMNDKVHENITLSRSL 97

Query: 71  AQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSG 130
           A KA ++ ELK  L +F+ C L   + +T+         +M+IG  P  ++++ G PF G
Sbjct: 98  ADKANNIEELKESLLNFNGCELKKFATNTVFGDGNLEAKIMLIGEAPGSTEDLKGIPFYG 157

Query: 131 KTGNMLDKMLQSIEIMRTQI-HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKI 189
           ++GN+LD ML +I I R    +I+    W PP NR  +  E++ICRP + + I LI+PK+
Sbjct: 158 ESGNLLDNMLHAIGISRKNNAYITNTVFWRPPANRQPTFEEVDICRPFVEKHIALINPKL 217

Query: 190 LLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPT--LATVHPQELIQYPLIKKNT 247
           ++ +G+               +   ++      +   P    A  HP  L++ P+ K+ +
Sbjct: 218 IILVGSTAATSLLG-KNSGITKIRQEYYFYTNKYLSAPIQTTAIFHPAYLLRQPMQKRTS 276

Query: 248 WHALITLKKALKN 260
           W+ L+ +K+ + N
Sbjct: 277 WYDLLKIKEYVVN 289


>gi|85704408|ref|ZP_01035510.1| hypothetical protein ROS217_04999 [Roseovarius sp. 217]
 gi|85670816|gb|EAQ25675.1| hypothetical protein ROS217_04999 [Roseovarius sp. 217]
          Length = 264

 Score =  198 bits (502), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 63/267 (23%), Positives = 114/267 (42%), Gaps = 15/267 (5%)

Query: 3   SKRILSQEQILTIALFYADSGV-YWVFDEPNNEATYESQRKEKSIDSAI--QPITNIRHI 59
            +  L     L   ++  + G    + D P N      +  + +       +P   +   
Sbjct: 1   MESTLRPHDALASLVWQIELGATEAICDAPINRYDLPDKVAKPAAAPKAEGRPAAPVAPE 60

Query: 60  HSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSD 119
            S  V  A + A  A     L++ L ++  C L   + + +         +MIIG  P  
Sbjct: 61  SSDPVAVARASATAAPDRDALRAALGAYPHCDLKRGARNLVFCDGNPAARVMIIGEAPGR 120

Query: 120 SDNISGKPFSGKTGNMLDKMLQSIEIMR------TQIHISMISPWHPPGNRNLSNIEMEI 173
            +++ G PF G+ G +LD+ML +I + R        ++I+ + PW PP NR+ S  E+ +
Sbjct: 121 DEDLQGLPFVGRAGQLLDRMLAAIGLTRGADAPQEAVYITNVLPWRPPQNRDPSTEEIAM 180

Query: 174 CRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVH 233
            RP + R ++LI+P +++ +GN + +           +  G W+         P L   H
Sbjct: 181 MRPFVARHVDLIAPDLIVLMGNISCDAGLGKRG--ITRLRGTWAEAYGK----PALPMFH 234

Query: 234 PQELIQYPLIKKNTWHALITLKKALKN 260
           P  L++ P  K+  W  L+ LK  L+ 
Sbjct: 235 PAYLLRTPAAKREAWADLLALKARLRE 261


>gi|16125582|ref|NP_420146.1| phage SPO1 DNA polymerase-like protein [Caulobacter crescentus
           CB15]
 gi|221234331|ref|YP_002516767.1| uracil DNA glycosylase superfamily protein [Caulobacter crescentus
           NA1000]
 gi|13422678|gb|AAK23314.1| phage SPO1 DNA polymerase-related protein [Caulobacter crescentus
           CB15]
 gi|220963503|gb|ACL94859.1| uracil DNA glycosylase superfamily protein [Caulobacter crescentus
           NA1000]
          Length = 273

 Score =  197 bits (501), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 67/265 (25%), Positives = 114/265 (43%), Gaps = 14/265 (5%)

Query: 7   LSQEQILTIALFYADSGVYWVF-DEPNNEATYESQRKEKSIDSAIQPITN----IRHIHS 61
           + Q  + ++  F+AD+GV  ++ D P +     +            P       +  + S
Sbjct: 5   VDQRAVESLLAFWADAGVEALYADAPIDRLAEGAAMLRAKSQPPPPPAPVARPGMAMVRS 64

Query: 62  PLVQQADSIAQK----ACSLHELKSLLRSFHDCHLC-STSLSTICATQTEGQDLMIIGYT 116
           P +  A + A+        L  L + + +F  C L    +   + +       LMIIG  
Sbjct: 65  PDIASAVAAAKAAAAACNDLESLAAAIAAFEGCPLKSQGAKQAVFSRGVSDAQLMIIGEG 124

Query: 117 PSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRP 176
           P   ++  G+PF G+ G +LD+ML++  +   ++ I+    W PPGNR  +  E   C P
Sbjct: 125 PGADEDAQGQPFVGRAGKLLDRMLKAAGLEE-RVFITNTVFWRPPGNRTPTPQEQATCAP 183

Query: 177 IIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSI--IPTLATVHP 234
            + R I L+ PK+LL  G  +       D        G+W    +      +P + T+HP
Sbjct: 184 FVERAIALVKPKMLLLAGGASAKAMLKRDEGILT-MRGRWFEWVSEDQSLELPAMPTLHP 242

Query: 235 QELIQYPLIKKNTWHALITLKKALK 259
             L++ P  KK  W  L+TL + L 
Sbjct: 243 AFLLRTPAQKKKAWQDLLTLTERLD 267


>gi|328948441|ref|YP_004365778.1| phage SPO1 DNA polymerase-related protein [Treponema succinifaciens
           DSM 2489]
 gi|328448765|gb|AEB14481.1| phage SPO1 DNA polymerase-related protein [Treponema succinifaciens
           DSM 2489]
          Length = 289

 Score =  197 bits (501), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 58/234 (24%), Positives = 98/234 (41%), Gaps = 4/234 (1%)

Query: 26  WVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLR 85
            + +  ++    E   + K+ + A       +         A+    +  +L  + + + 
Sbjct: 45  EIPEFEDDIEIPEEHEEIKTQEHAQVQPNTFQIPAEQ--NSAEKAPSQGATLESIATKIA 102

Query: 86  SFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEI 145
           S  +C LC    +T+     E   +M+IG  P + ++ +G+PF GK G +LDKML +I +
Sbjct: 103 SCKNCILCKARTNTVPGEGVENPYVMVIGEGPGEDEDKTGRPFVGKAGQLLDKMLAAISL 162

Query: 146 MR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNN 204
            R T  +I+ I    PP NR     E   C   +  QI ++ PK +L +G        + 
Sbjct: 163 GRTTNCYIANIVKCRPPMNRTPMPDEAHACSGYLQAQIHILKPKYILAMGRTAVQNLLDT 222

Query: 205 DAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
                    GKW       + IP LAT HP  L++    K+  W  L   K  +
Sbjct: 223 QEGINS-LRGKWLEYSLGETKIPLLATYHPSALLRNESFKRPAWEDLKVFKSRI 275


>gi|326402981|ref|YP_004283062.1| uracil-DNA glycosylase [Acidiphilium multivorum AIU301]
 gi|325049842|dbj|BAJ80180.1| uracil-DNA glycosylase [Acidiphilium multivorum AIU301]
          Length = 276

 Score =  197 bits (500), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 68/238 (28%), Positives = 104/238 (43%), Gaps = 10/238 (4%)

Query: 21  DSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHEL 80
           + G      E   +    S+    +  +   P T +R   +P        A  A S  EL
Sbjct: 25  EWGADEALLETPPDRAAASRPASPAPAAPSAPGTVVRLPTAPS-------APGAASFAEL 77

Query: 81  KSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKML 140
           ++ L +F  C L  T+   + A   E   +MIIG  P   ++  G+PF G  G +LDKML
Sbjct: 78  RAALEAFDQCALKRTATQLVFADGAEDARIMIIGEAPGGEEDRIGRPFVGPAGQLLDKML 137

Query: 141 QSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNF 200
            SI + R  + I  + PW PPGNR  S+ E+  C P + R I L+ P+ L+ +G      
Sbjct: 138 GSIGLDRGTVRIVNVVPWRPPGNRTPSDTEIAQCLPFLHRHIALVRPERLVLLGAVAVRA 197

Query: 201 FFNNDAQKTYQNLGKWSNLCTPH--SIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
                     +  GKW  +        +  L T HP  L++ P  K+  W  L+ L++
Sbjct: 198 LIGGK-DGITRLRGKWREVTIEGLDQTLRALPTYHPAYLLRQPAAKRLAWADLLELRR 254


>gi|283779751|ref|YP_003370506.1| phage SPO1 DNA polymerase-like protein [Pirellula staleyi DSM 6068]
 gi|283438204|gb|ADB16646.1| phage SPO1 DNA polymerase-related protein [Pirellula staleyi DSM
           6068]
          Length = 292

 Score =  197 bits (500), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 54/289 (18%), Positives = 103/289 (35%), Gaps = 38/289 (13%)

Query: 3   SKRILSQEQILTIALFYADSGVYWVFD--------------EPNNEATYESQRKEKSIDS 48
              +++++ +L      A +GV  +                   +              +
Sbjct: 1   MDELVTRKLLLQSLESLARAGVDQLQRGVPLGVLPAPAATAARPDSPAASMPLPSPPAAT 60

Query: 49  AIQPITNIRHIHSPLVQQADSIAQKACSLH------------------ELKSLLRSFHDC 90
           A +P+       +P   +          L                   +LK+ +     C
Sbjct: 61  ADRPMPTRLAAPTPPPFEPRLAVPATSDLEPVMAKKSAAKSAACASLDDLKAEVAGCKLC 120

Query: 91  -HLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
             L  T   T+         ++I G  P   ++ +G+PF G+ G +L K++++    R +
Sbjct: 121 KELARTRKQTVFGIGNPQPRVVIFGEAPGADEDRTGEPFVGRAGQLLTKIIEACGWKREE 180

Query: 150 IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKT 209
           ++I  +    PP NR     E+E CRP   RQIEL++P+ ++ +G            +  
Sbjct: 181 VYILNVLKCRPPDNRTPVEEEIENCRPFFERQIELLAPEYIVCVGTVPSQALL-RTKEPV 239

Query: 210 YQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
            +  G++            L T HP  L++ P  KK  W  +  L K +
Sbjct: 240 GRLRGRFHEYN----GRSVLVTYHPSYLLRNPSAKKFVWDDMQMLLKKM 284


>gi|329890553|ref|ZP_08268896.1| uracil-DNA glycosylase [Brevundimonas diminuta ATCC 11568]
 gi|328845854|gb|EGF95418.1| uracil-DNA glycosylase [Brevundimonas diminuta ATCC 11568]
          Length = 282

 Score =  197 bits (500), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 62/263 (23%), Positives = 106/263 (40%), Gaps = 7/263 (2%)

Query: 2   TSKRILSQEQILTIALFYADSGVYWVFD-EPNNEATYESQRKEK-SIDSAIQPITNIRHI 59
            +   L       +  F+ D+GV   F+ EP +   + +    K                
Sbjct: 14  MNAPSLDMAAAEALFAFWRDAGVDACFEAEPVDRTVFVAPVAAKGPATITPLRAPGAPPS 73

Query: 60  HSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCS-TSLSTICATQTEGQDLMIIGYTPS 118
                 +A  +A  A +L EL   + +F  C L +  +  ++ A       LMI+G  P 
Sbjct: 74  VDEAAVEARRLAACATTLDELAEAVAAFEGCPLRAMGARQSVFARGNPQGSLMIVGEGPG 133

Query: 119 DSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPII 178
             +++ G+PF G+ G +LD++L +  +      I+    W  PGNR  +  E  +C P +
Sbjct: 134 AEEDVRGQPFVGQAGQLLDRILTAAGL-LDDAFITNTVFWKTPGNRTPTPQEQAVCAPFL 192

Query: 179 MRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSII--PTLATVHPQE 236
            R   L+ PK +L +G          D     +  G+W         I  P +AT+HP  
Sbjct: 193 ERAAALLKPKAVLLVGAAAAKAVLKTDDGIM-RTRGQWREWRLSEDGIAAPVMATLHPAF 251

Query: 237 LIQYPLIKKNTWHALITLKKALK 259
           L++ P  K   W  ++ L   L+
Sbjct: 252 LLRQPQAKGLVWKDILDLSARLR 274


>gi|325292366|ref|YP_004278230.1| DNA polymerase bacteriophage-type [Agrobacterium sp. H13-3]
 gi|325060219|gb|ADY63910.1| putative DNA polymerase bacteriophage-type [Agrobacterium sp.
           H13-3]
          Length = 299

 Score =  197 bits (500), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 88/299 (29%), Positives = 133/299 (44%), Gaps = 40/299 (13%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVFDE-PNNEA------------------------ 35
           M +   LS  ++  +  F+AD+GV W+ ++ P +                          
Sbjct: 1   MIAAHDLSPAELAALLHFHADAGVDWLLEDGPVDRFAEFAASRPARPAARQESSAPAHQM 60

Query: 36  --------------TYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELK 81
                         T       +    A     N+       V  A   A+ A SL ELK
Sbjct: 61  DSGTERRADAPQRQTAGRSAPTRGAPPAPALQQNVAMPDEQAVAAARFAAESARSLSELK 120

Query: 82  SLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQ 141
             L  F  C+L +++ +T+         +M+IG  P   D+  G+ F+GKTG +LD+ML 
Sbjct: 121 IALEGFSGCNLKNSARNTVFTEGDPACAVMVIGPMPDADDDREGQLFAGKTGLLLDRMLA 180

Query: 142 SIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFF 201
           +I + R +I +  + PW PPGNR  +  EM+ICRP I RQI L  PK LL +GN T  FF
Sbjct: 181 AIGLDRARIMLGNVVPWRPPGNRPPTQAEMDICRPFIERQIALAEPKHLLLLGNLTARFF 240

Query: 202 FNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
           F           G+W ++   H ++P LA++HPQEL+  P  K   W  L+  +  +  
Sbjct: 241 FGGTGTIHT-LRGQWRDVAAGHLVLPALASLHPQELLNAPASKSLAWQDLLAFQAKISE 298


>gi|86158792|ref|YP_465577.1| phage SPO1 DNA polymerase-like protein [Anaeromyxobacter
           dehalogenans 2CP-C]
 gi|85775303|gb|ABC82140.1| phage SPO1 DNA polymerase-related protein [Anaeromyxobacter
           dehalogenans 2CP-C]
          Length = 245

 Score =  196 bits (499), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 50/223 (22%), Positives = 86/223 (38%), Gaps = 5/223 (2%)

Query: 36  TYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCST 95
                    +               +     A      + +L +++  L     C L   
Sbjct: 21  APVGTAPVTTPPPGQDTPPAGTQEATSRPSAAGEKGCGSEALVQVRDALGDCRRCKLAGG 80

Query: 96  SLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMI 155
             + +        +L+ +G  P   ++  G+PF GK G +L KM+Q++   R Q++I+ +
Sbjct: 81  RTTLVFGVGNPHAELVFVGEGPGADEDREGEPFVGKAGQLLTKMIQAMGYQREQVYIANV 140

Query: 156 SPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGK 215
               PPGNRN    E+E C P +  Q+  I P++++ +G          D     +  G 
Sbjct: 141 VKCRPPGNRNPEPDEIEACEPFLRAQLAAIRPRVVVALGKFAAQTLL-RDTTPITRLRGG 199

Query: 216 WSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
           W         I  + T HP  L++ P  KK  W  L  + K L
Sbjct: 200 WREYE----GIRLMPTFHPAYLLRSPEEKKKAWEDLQLVMKEL 238


>gi|77464581|ref|YP_354085.1| hypothetical protein RSP_1001 [Rhodobacter sphaeroides 2.4.1]
 gi|77388999|gb|ABA80184.1| hypothetical protein RSP_1001 [Rhodobacter sphaeroides 2.4.1]
          Length = 260

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 59/250 (23%), Positives = 106/250 (42%), Gaps = 15/250 (6%)

Query: 18  FYADSGV-YWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLV--QQADSIAQKA 74
           +  D G    + D P N       +      +A    T      +     ++A   A  A
Sbjct: 15  WQVDLGATEAILDAPVNRYELGDAQPVPKAAAAAVAATAAPDPVAAADPVEEARRAAAAA 74

Query: 75  CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
            +L  L+  + ++  C L   + +T+ +       LM+IG  P   ++ +G+PF G+ G 
Sbjct: 75  PTLEALREAMAAYDHCDLKRGARNTVFSDGHPAARLMLIGEAPGREEDAAGRPFVGRAGQ 134

Query: 135 MLDKMLQSIEIMRTQI------HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPK 188
           +LD+M  +I + RT        +I+ + PW PP NR+ S  E+ +  P + R +EL +P 
Sbjct: 135 LLDRMFAAIGLSRTSPDAETALYITNVMPWRPPQNRDPSAEEVAMMTPFLARHVELAAPD 194

Query: 189 ILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTW 248
           +++  GN               +  G+W+         P +   HP  L++ P  K+  W
Sbjct: 195 LIVVTGNTACAALLGRTG--ITRLRGRWAEAW----GRPVMPMCHPAYLLRNPEAKREAW 248

Query: 249 HALITLKKAL 258
             L+ +K  L
Sbjct: 249 ADLLEVKARL 258


>gi|108760490|ref|YP_632566.1| uracil-DNA glycosylase [Myxococcus xanthus DK 1622]
 gi|108464370|gb|ABF89555.1| uracil-DNA glycosylase, family 4 [Myxococcus xanthus DK 1622]
          Length = 186

 Score =  196 bits (498), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 49/182 (26%), Positives = 85/182 (46%), Gaps = 5/182 (2%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L E++  L     C+LCST  + +  +     +L+ +G  P +++++ G PF G  G++L
Sbjct: 2   LDEIRRELGDCQRCNLCSTRKNLVFGSGNPRAELVFVGEGPGENEDLQGVPFVGAAGDLL 61

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
            KM+ ++   R  ++I  +    PPGNRN    E+  C P +  Q+  I PK+++ +G  
Sbjct: 62  TKMIGAMGYRRDDVYICNVVKCRPPGNRNPEPEEVAACEPFLRAQLAAIQPKVVVALGKF 121

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
                   D+    +  G W         I  + T HP  L++ P  K+  W  L  + K
Sbjct: 122 AAQTLL-RDSTPITRLRGNWRTYE----GIQLMPTFHPAYLLRSPAEKRKAWEDLQAVMK 176

Query: 257 AL 258
            L
Sbjct: 177 VL 178


>gi|144897951|emb|CAM74815.1| Uracil DNA glycosylase [Magnetospirillum gryphiswaldense MSR-1]
          Length = 250

 Score =  196 bits (498), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 59/192 (30%), Positives = 98/192 (51%), Gaps = 3/192 (1%)

Query: 70  IAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFS 129
           +  K   L +L+  + +F    L  T++ST+ A      D+M IG  P   ++  G PF 
Sbjct: 57  LGGKVSDLAQLRQAMEAFDALPLKRTAMSTVFADGNPDADIMCIGEAPGQEEDRQGLPFV 116

Query: 130 GKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKI 189
           GK+G +LD+ML SI + R  ++IS + PW P  NR  +  E+ +C P I R IEL+ PK+
Sbjct: 117 GKSGKLLDRMLASIGLDRGSVYISNVVPWRPVDNRKPTADEVAVCLPFITRHIELVDPKL 176

Query: 190 LLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIP--TLATVHPQELIQYPLIKKNT 247
           L+  G    +      ++   +  G+W +  +P    P   + T HP  L++ P  K+  
Sbjct: 177 LILFGGAAASALLG-RSEGINRLRGRWFDYSSPGLPRPVAVMPTFHPAYLLRTPAAKREA 235

Query: 248 WHALITLKKALK 259
           W  L+ ++K + 
Sbjct: 236 WRDLLAVRKRID 247


>gi|148264964|ref|YP_001231670.1| phage SPO1 DNA polymerase-related protein [Geobacter uraniireducens
           Rf4]
 gi|146398464|gb|ABQ27097.1| phage SPO1 DNA polymerase-related protein [Geobacter uraniireducens
           Rf4]
          Length = 259

 Score =  196 bits (498), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 49/249 (19%), Positives = 104/249 (41%), Gaps = 8/249 (3%)

Query: 10  EQILTIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADS 69
             +        ++GV  +   P  E    S        +              +   +++
Sbjct: 12  ASLRAYLEELQETGVDGL---PFAETAPSSAAGPLKKSAPDSIAFPASAPGMSVKTPSEA 68

Query: 70  IAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFS 129
              K  +L EL+  L +   C L  T  + +         L+ +G  P   +++ G+PF 
Sbjct: 69  AGGKGETLEELRLELAACSRCKLGETRTNLVFGVGNPHARLVFVGEAPGRDEDLQGEPFV 128

Query: 130 GKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKI 189
           G+ G +L K++++++  R +++I  +    PP NRN    E+E C+P ++RQ++ I P++
Sbjct: 129 GEAGQLLTKIIEAMQFKRNEVYICNVLKCRPPNNRNPQQDEIEQCQPFLLRQLKAIGPEV 188

Query: 190 LLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWH 249
           ++ +G            +   +  G++ +       IP + T HP  L++   +K+  W 
Sbjct: 189 IVCLGTFAAQTLL-ETKEPISKMRGRFHDY----HGIPLMPTFHPAYLLRNAGMKREVWS 243

Query: 250 ALITLKKAL 258
            +  +   L
Sbjct: 244 DMQQVMNLL 252


>gi|51474012|ref|YP_067769.1| DNA polymerase [Rickettsia typhi str. Wilmington]
 gi|51460324|gb|AAU04287.1| DNA polymerase, bacteriophage-type [Rickettsia typhi str.
           Wilmington]
          Length = 258

 Score =  196 bits (497), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 63/252 (25%), Positives = 119/252 (47%), Gaps = 6/252 (2%)

Query: 14  TIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHS--PLVQQADSIA 71
            I  +    GV +   E   +    +    +     +   T     ++    +  + S+A
Sbjct: 3   DIFKWLNAIGVEYYCYEHTPQKIPNNTELTEKQQVELMHTTEAACNNNVHDNITLSRSLA 62

Query: 72  QKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGK 131
            KA ++ EL+  L +F+ C L   + +T+         +M+IG  P +++++ G PF G+
Sbjct: 63  DKANNIAELRESLLNFNGCELKKFATNTVFGDGNPQAKIMLIGEAPGNTEDLKGIPFCGE 122

Query: 132 TGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKIL 190
           +GN+LD ML +I I R    +I+ +  W PP NR  +  E++ICRP + + I LI+PK+L
Sbjct: 123 SGNLLDNMLYAIGISRKNNFYITNMVFWRPPANRQPTLEEVDICRPFVEKHIALINPKLL 182

Query: 191 LFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPT--LATVHPQELIQYPLIKKNTW 248
           + +G+               +   ++      +   P    A  HP  L++ P+ K+ +W
Sbjct: 183 ILVGSTAATSLLG-KNSCITKIRQEYYFYTNKYISTPIQTTAIFHPAYLLRQPMQKRTSW 241

Query: 249 HALITLKKALKN 260
           + L+ +K+ L N
Sbjct: 242 YDLLKIKEYLVN 253


>gi|78223867|ref|YP_385614.1| Phage SPO1 DNA polymerase-related protein [Geobacter
           metallireducens GS-15]
 gi|78195122|gb|ABB32889.1| Phage SPO1 DNA polymerase-related protein [Geobacter
           metallireducens GS-15]
          Length = 253

 Score =  196 bits (497), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 51/251 (20%), Positives = 102/251 (40%), Gaps = 13/251 (5%)

Query: 8   SQEQILTIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQA 67
           +   +        ++GV  +       A    + +      A+ P +           QA
Sbjct: 7   TIASLRRYLEELKETGVDEI-----PRAAASREEQPVPPPEAVAPASVPASSAPVAEPQA 61

Query: 68  DSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKP 127
            +  +   +L +++  L     C L     + +         L+ IG  P   +++ G+P
Sbjct: 62  ATAGE---TLDDIRRDLGECVRCQLGKQRTNLVFGVGNPRARLVFIGEAPGRDEDLKGEP 118

Query: 128 FSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISP 187
           F G+ G +L K++Q++   R +++I  +    PPGNRN  + E+  C P ++RQ+  I P
Sbjct: 119 FVGEAGQLLTKIIQAMGFARDEVYICNVLKCRPPGNRNPHHDEIVQCAPFMLRQVRAIGP 178

Query: 188 KILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNT 247
           + ++ +G            +      G++ +       IP + T HP  L++YP  K+  
Sbjct: 179 EAVVALGTFAAQTLLATK-EPISALRGRFHDY----HGIPLMPTFHPAFLVRYPERKREV 233

Query: 248 WHALITLKKAL 258
           W  +  +   L
Sbjct: 234 WDDMKQVMALL 244


>gi|15604675|ref|NP_221193.1| hypothetical protein RP845 [Rickettsia prowazekii str. Madrid E]
 gi|3861370|emb|CAA15269.1| unknown [Rickettsia prowazekii]
 gi|292572506|gb|ADE30421.1| Uracil-DNA glycosylase, family 4 [Rickettsia prowazekii Rp22]
          Length = 258

 Score =  195 bits (496), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 63/252 (25%), Positives = 122/252 (48%), Gaps = 6/252 (2%)

Query: 14  TIALFYADSGV-YWVFDEPNNEATYESQRKEKSIDSAIQPITNI--RHIHSPLVQQADSI 70
            +  +    GV Y+ ++         +    +     +   T     +     +  + S+
Sbjct: 3   DMFKWLNAIGVEYYCYEHTPQLKISHNTAITEKKQVKLMHTTEAVFNNNVHDNITLSRSL 62

Query: 71  AQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSG 130
           A KA ++ EL+  L +F+ C L   + +T+        ++M+IG  P +++++ G PF G
Sbjct: 63  ADKANNIVELRESLLNFNGCELKKFATNTVFGDGNPQANIMLIGEAPGNTEDLKGIPFCG 122

Query: 131 KTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKIL 190
           ++GN+LD ML +I I R   +I+ +  W PP NR  +  E++ICRP + + I LI+PK+L
Sbjct: 123 ESGNLLDNMLYAIGISRNNFYITNMVFWRPPANRQPTLEEVDICRPFVEKHIALINPKLL 182

Query: 191 LFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPT--LATVHPQELIQYPLIKKNTW 248
           + +G+         +A    +   ++      +   P    A  HP  L++ P+ K+ +W
Sbjct: 183 ILVGSTAATSLLGKNA-CITKIRQEYYFYTNKYISTPIQTTAIFHPAYLLRQPMQKRTSW 241

Query: 249 HALITLKKALKN 260
           + L+ +K+ L N
Sbjct: 242 YDLLKIKEYLVN 253


>gi|295689039|ref|YP_003592732.1| phage SPO1 DNA polymerase-like protein [Caulobacter segnis ATCC
           21756]
 gi|295430942|gb|ADG10114.1| phage SPO1 DNA polymerase-related protein [Caulobacter segnis ATCC
           21756]
          Length = 272

 Score =  195 bits (495), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 67/268 (25%), Positives = 111/268 (41%), Gaps = 13/268 (4%)

Query: 3   SKRILSQEQILTIALFYADSGVYWVF-DEPNNEATYESQ---RKEKSIDSAIQPITNIRH 58
               + Q  + ++  F+AD+GV   + D P +           K +           +  
Sbjct: 1   MSPAVDQRAVESLLAFWADAGVEVSYADAPIDRLAEGVAMLRAKSQPPPPPPPTRPGLAA 60

Query: 59  IHSPLV----QQADSIAQKACSLHELKSLLRSFHDCHLC-STSLSTICATQTEGQDLMII 113
           +  P V      A + A     L  L + + +F  C L    +   + +       LMII
Sbjct: 61  VRGPDVGAAIAAAKAAAAACQDLDSLAAAIAAFDGCALKTQGAKQAVFSRGVADAPLMII 120

Query: 114 GYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEI 173
           G  P   ++  G PF G+ G +LD+ML++  +   ++ I+    W PPGNR  +  E  +
Sbjct: 121 GEGPGADEDAQGAPFVGRAGKLLDRMLKAAGL-EGRVFITNTVFWRPPGNRTPTPQEQAV 179

Query: 174 CRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHS--IIPTLAT 231
           C P + R I L+ PK+LL  G  +       D        G+W    +      +P + T
Sbjct: 180 CAPFVERAIALVKPKMLLLAGGASAKAMLKRDEGILS-MRGRWFEWLSEDKATELPAMPT 238

Query: 232 VHPQELIQYPLIKKNTWHALITLKKALK 259
           +HP  L++ P  KK  W  L+TL + L 
Sbjct: 239 LHPAFLLRTPAQKKKAWQDLLTLTERLD 266


>gi|146276280|ref|YP_001166439.1| phage SPO1 DNA polymerase-related protein [Rhodobacter sphaeroides
           ATCC 17025]
 gi|145554521|gb|ABP69134.1| phage SPO1 DNA polymerase-related protein [Rhodobacter sphaeroides
           ATCC 17025]
          Length = 259

 Score =  195 bits (495), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 59/249 (23%), Positives = 105/249 (42%), Gaps = 14/249 (5%)

Query: 18  FYADSGV-YWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACS 76
           +  D GV   + D P N     + +      +       +    +         A  A +
Sbjct: 15  WQVDLGVTEAICDAPVNRYELVAAQPVPKATAVAVATVALDPAAAADPVAEARRAAAAAT 74

Query: 77  -LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
            L  L+  + ++  C L   + +T+         LM+IG  P   ++ +G+PF G+ G +
Sbjct: 75  DLGSLREAMAAYEHCDLKRGARNTVFCDGNASARLMLIGEAPGREEDAAGRPFVGRAGQL 134

Query: 136 LDKMLQSIEIMRTQI------HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKI 189
           LD+M  +I I RT        +I+ + PW PP NR+ S  E+ +  P + R +EL +P +
Sbjct: 135 LDRMFAAIGIARTSPDPAGALYITNVMPWRPPQNRDPSAEEVAMMTPFLERHVELAAPDL 194

Query: 190 LLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWH 249
           ++ +GN   +           +  G+W+         P +   HP  L++ P  K+  W 
Sbjct: 195 IVVMGNTACSAVLGRTG--ITRLRGRWAEAW----GRPVMPMCHPAYLLRNPEAKREAWA 248

Query: 250 ALITLKKAL 258
            L+ LK  L
Sbjct: 249 DLLELKARL 257


>gi|218532502|ref|YP_002423318.1| phage SPO1 DNA polymerase-related protein [Methylobacterium
           chloromethanicum CM4]
 gi|218524805|gb|ACK85390.1| phage SPO1 DNA polymerase-related protein [Methylobacterium
           chloromethanicum CM4]
          Length = 334

 Score =  194 bits (494), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 80/329 (24%), Positives = 129/329 (39%), Gaps = 71/329 (21%)

Query: 1   MTSKRILSQE--QILTIALFYADSGVYWVFDE-PNNEATYE------------------- 38
           MT+    +     +++   F+  +GV  V DE P++                        
Sbjct: 1   MTANHADTDARGDLISYLDFHVAAGVDAVLDEQPHDRFAEAESVRADAASQAEPATRREP 60

Query: 39  -------------------------SQRKEKSIDSAIQPI----TNIRHIHSPLVQQADS 69
                                    S+  ++   SA +P       +    +P  +   +
Sbjct: 61  LESRREPLEPRREPLPPRREALEPRSEPPQRDAPSAEEPPLAFRRELPSRDAPAREPPRT 120

Query: 70  IAQKA------------------CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLM 111
               A                   +L EL+ LLR F  C L  T+ + + A       +M
Sbjct: 121 YGNAAGAKPGEAADDARARAAQMKTLDELEELLRGFEGCGLRFTAKNLVFADGNPQARVM 180

Query: 112 IIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEM 171
            +G  P   ++  GKPF G++G +LD+M+ +I + RT  +IS + PW PPGNRN +  E+
Sbjct: 181 FVGEAPGADEDRIGKPFMGRSGQLLDRMMAAIGLDRTSAYISNVVPWRPPGNRNPTPQEI 240

Query: 172 EICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTP-HSIIPTLA 230
            ICRP + RQIEL +P IL+ +G                +  G++          I  LA
Sbjct: 241 SICRPFVERQIELANPDILVCLGAPATQTLTGTK-DGILKARGRFYPYRLGDGREIRALA 299

Query: 231 TVHPQELIQYPLIKKNTWHALITLKKALK 259
           T+HP  L++ P+ K+  W     LK AL 
Sbjct: 300 TLHPAYLLRQPVQKRLAWRDFRMLKSALD 328


>gi|251772271|gb|EES52841.1| Uracil-DNA glycosylase, family 4 [Leptospirillum ferrodiazotrophum]
          Length = 251

 Score =  194 bits (493), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 59/259 (22%), Positives = 101/259 (38%), Gaps = 14/259 (5%)

Query: 1   MTSKRILS-QEQILTIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHI 59
           M     L   E +     +  ++        P+ E         + + S + P       
Sbjct: 1   MKEGHPLDGPEGLAVYLRYLQETVPDLALPRPSAETGEIRMAGGERVGSPLSPS------ 54

Query: 60  HSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSD 119
                  A S   ++ SL  L  ++     C L ST    +         LM +G  P  
Sbjct: 55  -----LSAGSSPGESGSLESLAKVVSECRLCVLSSTRTFAVFGEGNPDARLMFVGEGPGA 109

Query: 120 SDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIM 179
            ++ SG+PF G+ G +L +M+ ++   R  ++I+ +    PPGNR     E   C P + 
Sbjct: 110 DEDASGRPFVGRAGELLTRMIGAMGYRREDVYIANVVKCRPPGNRVPEESERASCLPYLK 169

Query: 180 RQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ 239
           RQI LISPK ++ +G        + + +   +  G+ ++L      I  + T HP  L++
Sbjct: 170 RQIGLISPKAMVLLGQTAAVSLLSRN-EGISRLRGRETSLP-EFPGIRVMPTYHPAYLLR 227

Query: 240 YPLIKKNTWHALITLKKAL 258
            P  K   W  L  +   L
Sbjct: 228 NPAAKAQVWEDLQQVMGWL 246


>gi|77919605|ref|YP_357420.1| phage SpO1 DNA polymerase-like protein [Pelobacter carbinolicus DSM
           2380]
 gi|77545688|gb|ABA89250.1| phage SpO1 DNA polymerase-related protein [Pelobacter carbinolicus
           DSM 2380]
          Length = 224

 Score =  194 bits (493), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 49/216 (22%), Positives = 91/216 (42%), Gaps = 7/216 (3%)

Query: 45  SIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQ 104
              S    +       +     +    Q+A  L E+++ L     C L       +    
Sbjct: 13  PWPSDADVLPVCPLPSAADGDTSKPCRQEA--LEEVRADLGDCRRCALSKKRKHIVFGGG 70

Query: 105 TEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNR 164
            E   L+ +G  P   ++  G PF G+ G +LD+ML ++ + R +++I  +    PPGNR
Sbjct: 71  NEKARLVFVGEAPGRDEDEQGIPFVGEAGRLLDRMLFAMGLDRDEVYICNVQKCRPPGNR 130

Query: 165 NLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHS 224
           +    E+E C P + RQ+  I P++++ +G          + +   +  G W        
Sbjct: 131 DPLPEEIEACEPFLRRQLAAIRPRVIVTLGRFAAQTLL-REREAISRLRGHWHAYE---- 185

Query: 225 IIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
            +P + T HP  L++ P  K+  W  L  +   L++
Sbjct: 186 GVPLMPTYHPAYLLRNPASKREVWEDLKQVMGRLRD 221


>gi|121997486|ref|YP_001002273.1| phage SPO1 DNA polymerase-like protein [Halorhodospira halophila
           SL1]
 gi|121588891|gb|ABM61471.1| phage SPO1 DNA polymerase-related protein [Halorhodospira halophila
           SL1]
          Length = 294

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 52/220 (23%), Positives = 83/220 (37%), Gaps = 5/220 (2%)

Query: 43  EKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICA 102
                      T            A     +      L++ +   H C LC     T+  
Sbjct: 78  SAGGAEPASAPTTAPEPGGAPQAAAPEAGCEDLDWDALEARVAGCHACKLCEGRTQTVFG 137

Query: 103 TQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQS--IEIMRTQIHISMISPWHP 160
                 DL+IIG  P   ++  G+PF G+ G +LD ML +      R  ++I  I    P
Sbjct: 138 VGDRQADLVIIGEGPGAEEDRQGEPFVGRAGQLLDAMLAAIDRGRDRGGVYIGNIVKCRP 197

Query: 161 PGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLC 220
           PGNR+    E+  C P + RQ+EL+ PK ++ +G                +  G+  +  
Sbjct: 198 PGNRDPRPDEVAACTPYLRRQLELLEPKAIVALGRVAAQQLL-ETKSPLAKLRGRVHHY- 255

Query: 221 TPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
                IP   T HP  L++ P  K   W  L  ++  ++ 
Sbjct: 256 -GAQSIPVWVTYHPAYLLRSPGEKAKVWQDLKRIRGLVEE 294


>gi|194289838|ref|YP_002005745.1| uracil-DNA glycosylase,phage-related protein [Cupriavidus
           taiwanensis LMG 19424]
 gi|193223673|emb|CAQ69680.1| putative uracil-DNA glycosylase,phage-related protein [Cupriavidus
           taiwanensis LMG 19424]
          Length = 289

 Score =  193 bits (491), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 52/224 (23%), Positives = 93/224 (41%), Gaps = 6/224 (2%)

Query: 34  EATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLC 93
           EA  ++   + + D  + P        +  VQ     A        L + +     C LC
Sbjct: 62  EALPDAAVAQPAADEQVAPEPVPAGPGAADVQGEREAAIATMDWPALDAAVAGCTACGLC 121

Query: 94  STSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHI 152
            T  +T+        + M++G  P +++++ G+PF G+ G +LD ML ++ + R   + I
Sbjct: 122 RTRTNTVFGVGARQAEWMLVGEAPGENEDLQGEPFVGQAGKLLDNMLGALGLARGRNVFI 181

Query: 153 SMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQN 212
           + +    PPGNRN    E+  C P + RQI L+ P++++ +G                + 
Sbjct: 182 ANVLKCRPPGNRNPEPEEVAQCEPFLRRQIALVRPRVIVVLGRFAAQSLL-RTTTPIGKL 240

Query: 213 LGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
            G           IP + T HP  L++    K   W  L   ++
Sbjct: 241 RGTVHVYE----GIPVVVTYHPAYLLRTLTDKARAWEDLCLARE 280


>gi|115378583|ref|ZP_01465737.1| phage SPO1 DNA polymerase domain protein [Stigmatella aurantiaca
           DW4/3-1]
 gi|310822001|ref|YP_003954359.1| phage spo1 DNA polymerase domain-containing protein [Stigmatella
           aurantiaca DW4/3-1]
 gi|115364411|gb|EAU63492.1| phage SPO1 DNA polymerase domain protein [Stigmatella aurantiaca
           DW4/3-1]
 gi|309395073|gb|ADO72532.1| Phage SPO1 DNA polymerase domain protein [Stigmatella aurantiaca
           DW4/3-1]
          Length = 323

 Score =  193 bits (491), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 48/201 (23%), Positives = 86/201 (42%), Gaps = 5/201 (2%)

Query: 56  IRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGY 115
            +            +  +  +L +++  L     C LC+   + +        DL+ +G 
Sbjct: 118 PQQAPRYPGPLPGVVEGERPTLDQIRRELGDCRRCKLCTGRKNIVFGVGNPRADLVFVGE 177

Query: 116 TPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICR 175
            P ++++I G PF G  G +L KM+Q++   R +I+I  +    PPGNRN    E+  C 
Sbjct: 178 GPGENEDIQGVPFVGAAGELLTKMIQAMGFSRDEIYICNVVKCRPPGNRNPEADEIAACE 237

Query: 176 PIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQ 235
           P +  Q+  I PK+++ +G          D     +  G+W         +  + T HP 
Sbjct: 238 PFLRSQLLAIQPKVIVALGKFAAQTLL-RDTTPITRLRGQWREYQ----GVKLMPTFHPA 292

Query: 236 ELIQYPLIKKNTWHALITLKK 256
            L++ P  K+  W  L  + K
Sbjct: 293 YLLRSPAEKRKAWEDLQQVMK 313


>gi|322436205|ref|YP_004218417.1| phage SPO1 DNA polymerase-related protein [Acidobacterium sp.
           MP5ACTX9]
 gi|321163932|gb|ADW69637.1| phage SPO1 DNA polymerase-related protein [Acidobacterium sp.
           MP5ACTX9]
          Length = 290

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 52/289 (17%), Positives = 105/289 (36%), Gaps = 36/289 (12%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVFDEPNNEATYESQRKE-----KSIDSAIQPITN 55
           M  ++     ++     ++ D GVY  +     +A   +  +      +S+ +       
Sbjct: 1   MAVEKQAGHAEVRAYLEYFRDMGVYDFYRNGEPQAIEAATMEAVVERVESVRATPVAPVV 60

Query: 56  IRHIHSPLVQQADSIA-----QKACSLHEL--------------------KSLLRSFHDC 90
                 P V    + A      K  S  +L                    ++ +     C
Sbjct: 61  AVVETGPSVPATQAAAVGFDIAKPVSFDDLAPLPEVRVAAGDRAAALAVIRADIGDCTRC 120

Query: 91  HL-CSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
            L      + +         LM +G  P   ++  G PF GK+G +L+ M+ ++ + R Q
Sbjct: 121 PLAYGGRRNIVFGDGDAKARLMFVGEGPGADEDEQGLPFVGKSGQLLNNMIGAMGLSREQ 180

Query: 150 IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKT 209
           ++I+ I    PP NR    +E   C   ++RQ++++ P+ ++ +G     +         
Sbjct: 181 VYIANIVKCRPPANRAPEPVEANTCTQFLVRQMDVVQPEYVVALGATAATYLLGVKQSLA 240

Query: 210 YQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
               G+W ++         + T HP  L++ P  K   W  L  +  A+
Sbjct: 241 S-LRGRWHDV----RGAKAVVTYHPAFLLRDPRQKGEAWKDLQMVMAAM 284


>gi|167619562|ref|ZP_02388193.1| putative phage-related DNA polymerase [Burkholderia thailandensis
           Bt4]
          Length = 263

 Score =  193 bits (489), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 49/211 (23%), Positives = 89/211 (42%), Gaps = 6/211 (2%)

Query: 51  QPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDL 110
           +P              A + +       EL++ +     C LC    +T+     E  D 
Sbjct: 50  EPGVEPAPPDVAAEPAARAPSVAELGWDELRARVADCERCRLCEKRTNTVFGVGDERADW 109

Query: 111 MIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNI 169
           M++G  P ++++  G+PF G+ G +LD ML+++ + R   ++I+ +    PPGNRN    
Sbjct: 110 MLVGEAPGENEDKQGEPFVGQAGKLLDNMLRALALKRGENVYIANVIKCRPPGNRNPEPD 169

Query: 170 EMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTL 229
           E+  C P + RQ+ L+ PK+++ +G          D        G+          +P +
Sbjct: 170 EVARCEPYLQRQVALVKPKLIVALGRFAAQTLLKTDGSIAS-MRGRVHEYE----GVPVI 224

Query: 230 ATVHPQELIQYPLIKKNTWHALITLKKALKN 260
            T HP  L++    K   W  L       ++
Sbjct: 225 VTYHPAYLLRSLQDKAKAWSDLCLANDTYRS 255


>gi|297184210|gb|ADI20328.1| uracil-DNA glycosylase [uncultured alpha proteobacterium
           EB080_L27A02]
          Length = 264

 Score =  192 bits (488), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 64/261 (24%), Positives = 121/261 (46%), Gaps = 18/261 (6%)

Query: 11  QILTIALFYADSGVYWVF-DEPNNEATYESQRKEKSIDSA-----IQPITNIRHIHSPLV 64
              +   +  + GV     D P N    ++   +  I +      +  + ++        
Sbjct: 9   DAKSALEWQYEIGVDETISDLPINRYEIQNIPPKLKISAKSNIAHVAVMPDMLSSKETAS 68

Query: 65  QQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNIS 124
             A  +A+K  +L EL+  +  F  C L   +   + +       +M+IG +PS  ++I 
Sbjct: 69  SVAKMLAEKCNNLSELRDAMGLFEMCSLKKGAKKLVFSDGLSKSRVMVIGESPSREEDIE 128

Query: 125 GKPFSGKTGNMLDKMLQSIEIMRTQI------HISMISPWHPPGNRNLSNIEMEICRPII 178
           GKPF G  G ++DKM Q+I + R         +I+   PW PP +R+ ++ E+ +  P +
Sbjct: 129 GKPFVGTEGELVDKMFQAIGLSRDSNEPNEAIYITTAIPWRPPQSRDPNSDEIAMMLPFL 188

Query: 179 MRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELI 238
            R IEL++P  ++ +GN   +   N       +  G+W+           L  +HP+ L+
Sbjct: 189 KRHIELVNPDFIVLMGNIACSAVLNKVGIN--KFRGEWTEAFGK----QILPMLHPRSLL 242

Query: 239 QYPLIKKNTWHALITLKKALK 259
           + P+ K++TW+ L++LK+ LK
Sbjct: 243 KDPMRKRDTWNDLLSLKERLK 263


>gi|291287466|ref|YP_003504282.1| phage SPO1 DNA polymerase-related protein [Denitrovibrio
           acetiphilus DSM 12809]
 gi|290884626|gb|ADD68326.1| phage SPO1 DNA polymerase-related protein [Denitrovibrio
           acetiphilus DSM 12809]
          Length = 210

 Score =  192 bits (488), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 51/191 (26%), Positives = 84/191 (43%), Gaps = 6/191 (3%)

Query: 67  ADSIAQKACS-LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISG 125
           A    QK  +    L   + +   C L  T L+ +        DLM +G  P   ++  G
Sbjct: 20  AQECEQKPENPFEALYKEVSTCKKCRLHETRLNIVFGVGDPAADLMFVGEGPGAEEDKQG 79

Query: 126 KPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELI 185
            PF G+ G +L KM++++   R  ++I+ I    PP NRN    E   C P + RQIE +
Sbjct: 80  IPFVGRAGQLLTKMIEAMGFTRDTVYIANIVKCRPPENRNPFEDESNTCIPYLYRQIEYV 139

Query: 186 SPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKK 245
            PK+++ +G+     F         +  G++  L      +  + T HP  L++ P +KK
Sbjct: 140 KPKVIVCLGSVAAQNFLKTKL-GITKIRGEFVELN----GVKVMPTYHPAYLLRNPKMKK 194

Query: 246 NTWHALITLKK 256
             W  L  +  
Sbjct: 195 PCWEDLQKVMA 205


>gi|291279806|ref|YP_003496641.1| uracil-DNA glycosylase [Deferribacter desulfuricans SSM1]
 gi|290754508|dbj|BAI80885.1| uracil-DNA glycosylase [Deferribacter desulfuricans SSM1]
          Length = 207

 Score =  192 bits (488), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 45/177 (25%), Positives = 84/177 (47%), Gaps = 5/177 (2%)

Query: 82  SLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQ 141
           + ++  + C L     + +        +LM +G  P   ++  G+PF G+ G +L KM++
Sbjct: 33  NEVKDCNKCRLAKNRTNLVFGEGDPNAELMFVGEGPGAEEDKQGRPFVGRAGQLLTKMIE 92

Query: 142 SIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFF 201
           ++++ R  ++I+ I    PP NR   N E+  C P + +QIE+I PK ++ +G+   +  
Sbjct: 93  AMKLKREDVYIANIVKCRPPNNRAPLNDEIGACIPYLHKQIEIIKPKYIICLGSIAASAL 152

Query: 202 FNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
            N       +  G +         I  + T HP  L++ P +KK  W  L  + K +
Sbjct: 153 LN-TTTAISKIRGSFREF----KGIKVMPTFHPAYLLRNPKMKKLAWEDLQLVMKEM 204


>gi|114771330|ref|ZP_01448750.1| hypothetical protein OM2255_08235 [alpha proteobacterium HTCC2255]
 gi|114548255|gb|EAU51142.1| hypothetical protein OM2255_08235 [alpha proteobacterium HTCC2255]
          Length = 264

 Score =  192 bits (488), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 64/261 (24%), Positives = 121/261 (46%), Gaps = 18/261 (6%)

Query: 11  QILTIALFYADSGVYWVF-DEPNNEATYESQRKEKSIDSA-----IQPITNIRHIHSPLV 64
              +   +  + GV     D P N    ++   +  I +      +  + ++        
Sbjct: 9   DAKSALEWQYEIGVDETISDLPINRYEIQNIPPKLKISAKSNIAHVAVMPDMLSSKETAS 68

Query: 65  QQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNIS 124
             A  +A+K  +L EL+  +  F  C L   +   + +       +M+IG +PS  ++I 
Sbjct: 69  SVAKMLAEKCNNLSELRDAMGLFEMCSLKKGAKKLVFSDGLSKSRVMVIGESPSREEDIE 128

Query: 125 GKPFSGKTGNMLDKMLQSIEIMRTQI------HISMISPWHPPGNRNLSNIEMEICRPII 178
           GKPF G  G ++DKM Q+I + R         +I+   PW PP +R+ ++ E+ +  P +
Sbjct: 129 GKPFVGTEGELVDKMFQAIGLSRDSNEPNEAIYITTAIPWRPPQSRDPNSDEIAMMLPFL 188

Query: 179 MRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELI 238
            R IEL++P  ++ +GN   +   N       +  G+W+           L  +HP+ L+
Sbjct: 189 KRHIELVNPDFIVLMGNIACSAVLNKVGIN--KFRGEWTEAFGK----QILPMLHPRSLL 242

Query: 239 QYPLIKKNTWHALITLKKALK 259
           + P+ K++TW+ L++LK+ LK
Sbjct: 243 KDPIRKRDTWNDLLSLKERLK 263


>gi|83721489|ref|YP_442527.1| phage SPO1 DNA polymerase domain-containing protein [Burkholderia
           thailandensis E264]
 gi|257138735|ref|ZP_05586997.1| phage SPO1 DNA polymerase domain-containing protein [Burkholderia
           thailandensis E264]
 gi|83655314|gb|ABC39377.1| phage SPO1 DNA polymerase domain protein [Burkholderia
           thailandensis E264]
          Length = 433

 Score =  192 bits (487), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 49/211 (23%), Positives = 89/211 (42%), Gaps = 6/211 (2%)

Query: 51  QPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDL 110
           +P              A + +       EL++ +     C LC    +T+     E  D 
Sbjct: 220 EPGVEPAPPDVAAEPAARAPSVAELGWDELRARVADCERCRLCEKRTNTVFGVGDERADW 279

Query: 111 MIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNI 169
           M++G  P ++++  G+PF G+ G +LD ML+++ + R   ++I+ +    PPGNRN    
Sbjct: 280 MLVGEAPGENEDKQGEPFVGQAGKLLDNMLRALALKRGENVYIANVIKCRPPGNRNPEPD 339

Query: 170 EMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTL 229
           E+  C P + RQ+ L+ PK+++ +G          D        G+          +P +
Sbjct: 340 EVARCEPYLQRQVALVKPKLIVALGRFAAQTLLKTDGSIAS-MRGRVHEYE----GVPVI 394

Query: 230 ATVHPQELIQYPLIKKNTWHALITLKKALKN 260
            T HP  L++    K   W  L       ++
Sbjct: 395 VTYHPAYLLRSLQDKAKAWSDLCLANDTYRS 425


>gi|153004366|ref|YP_001378691.1| phage SPO1 DNA polymerase-like protein [Anaeromyxobacter sp.
           Fw109-5]
 gi|152027939|gb|ABS25707.1| phage SPO1 DNA polymerase-related protein [Anaeromyxobacter sp.
           Fw109-5]
          Length = 255

 Score =  192 bits (487), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 55/228 (24%), Positives = 92/228 (40%), Gaps = 5/228 (2%)

Query: 31  PNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDC 90
           P       +    +    A+     +     P           + +L  L+  L     C
Sbjct: 26  PARGGAPAAGPSAERAAPALATPARVGPDAPPGGYTTADKGCGSPALLGLRGELGECTRC 85

Query: 91  HLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQI 150
            L  T    +    +   +LM +G  P   ++  G+PF GK G +L KM++++   R  +
Sbjct: 86  KLAGTRTHVVFGVGSPAAELMFVGEGPGADEDQQGEPFVGKAGQLLTKMIEAMGFRREDV 145

Query: 151 HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTY 210
           +I+ +    PPGNRN    E+  C P +  QI  ISPK+++ +G          D     
Sbjct: 146 YIANVVKCRPPGNRNPEPDELAACEPFLRAQIAAISPKVIVALGKFAAQTLL-RDTTPIS 204

Query: 211 QNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
           +  G+WS+       +  + T HP  L++ P  KK  W  L  + K L
Sbjct: 205 KLRGRWSSYE----GVKLMPTFHPAYLLRSPEEKKKAWEDLQLVMKEL 248


>gi|95929443|ref|ZP_01312186.1| phage SPO1 DNA polymerase-related protein [Desulfuromonas
           acetoxidans DSM 684]
 gi|95134559|gb|EAT16215.1| phage SPO1 DNA polymerase-related protein [Desulfuromonas
           acetoxidans DSM 684]
          Length = 243

 Score =  192 bits (487), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 42/188 (22%), Positives = 82/188 (43%), Gaps = 5/188 (2%)

Query: 73  KACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKT 132
           +  SL E++  L     C L     S +  +     +L+ +G  P   ++  G PF G+ 
Sbjct: 57  RPPSLEEIRQELGDCQRCGLAQGRKSIVFGSGNPHAELVFVGEGPGRDEDEQGVPFVGEA 116

Query: 133 GNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLF 192
           G +L+++L ++ + R Q++I  +    PP NRN    E+  C P + +Q+  + P++++ 
Sbjct: 117 GRLLERILFAMGLDREQVYICNVVKCRPPQNRNPQPDEIAACEPFLKQQLASLKPRVIVA 176

Query: 193 IGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALI 252
           +G                +  G W+        I  + T HP  L++ P  K++ W  + 
Sbjct: 177 LGKFAAQTLLQQQT-PISRLRGNWAAYQ----GIALMPTYHPAYLLRNPAGKRDVWEDMK 231

Query: 253 TLKKALKN 260
            +   L  
Sbjct: 232 AVMSRLAQ 239


>gi|258593155|emb|CBE69469.1| protein of unknown function [NC10 bacterium 'Dutch sediment']
          Length = 244

 Score =  192 bits (487), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 43/200 (21%), Positives = 90/200 (45%), Gaps = 5/200 (2%)

Query: 62  PLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSD 121
              ++A+ + + + +L +++  +     C L       +         L+ +G  P   +
Sbjct: 37  AWPERAEGLPEPSPTLTKVRETVGECTRCKLHKDRKHIVFGIGNPKAWLVFVGEAPGADE 96

Query: 122 NISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQ 181
           +  G+PF G+ G +L ++++++++ R Q++I  I    PP NRN    E+  C P ++ Q
Sbjct: 97  DEQGEPFVGRAGQLLTRIIEAMKLTREQVYICNIVKCRPPANRNPEPDEIAACEPFLVAQ 156

Query: 182 IELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
           ++ I PK++  +G            +   +  G++ +       I  L T HP  L++ P
Sbjct: 157 LQAIRPKLICALGTFAAQTLL-RTREPISKLRGRFHDY----HGILVLPTFHPAYLLRNP 211

Query: 242 LIKKNTWHALITLKKALKNL 261
             KK  W  +  L +  + L
Sbjct: 212 HEKKTVWEDMKLLMREYEQL 231


>gi|293603947|ref|ZP_06686361.1| family 4 uracil-DNA glycosylase [Achromobacter piechaudii ATCC
           43553]
 gi|292817640|gb|EFF76707.1| family 4 uracil-DNA glycosylase [Achromobacter piechaudii ATCC
           43553]
          Length = 329

 Score =  192 bits (487), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 52/219 (23%), Positives = 90/219 (41%), Gaps = 5/219 (2%)

Query: 37  YESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTS 96
                +       +        + +P +  A+++     +L EL+  + +   C LC   
Sbjct: 109 ASILNRTGPPPRPVPKTAEEEAVEAPRIPVAEAVKNA--NLDELREQVVACTACGLCQGR 166

Query: 97  LSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQI-HISMI 155
              +          +++G  P + ++  G PF G++G +LD ML ++ + R     I+ +
Sbjct: 167 RHAVFGHGATPTRWLVVGEAPGEQEDRQGHPFVGRSGQLLDAMLAAVGMSRDTDVFITNV 226

Query: 156 SPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGK 215
               PPGNRN    E+  C P +MRQI L+ P+ +L +G          DA       G+
Sbjct: 227 IKCRPPGNRNPKPEEIASCSPYLMRQIALLKPERILVLGRFAAQTLLGTDATIGS-LRGR 285

Query: 216 WSNLCTPHSI-IPTLATVHPQELIQYPLIKKNTWHALIT 253
              L T     IP + + HP  L++ P  K   W  L  
Sbjct: 286 VHTLKTEDGSEIPLIVSYHPAYLLRSPSEKARAWQDLKL 324


>gi|239948113|ref|ZP_04699866.1| uracil-DNA glycosylase, family 4 [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239922389|gb|EER22413.1| uracil-DNA glycosylase, family 4 [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 304

 Score =  191 bits (486), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 59/202 (29%), Positives = 103/202 (50%), Gaps = 4/202 (1%)

Query: 62  PLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSD 121
             +  A S+A KA ++ ELK  L +F+ C L   + +T+         +M+IG  P   +
Sbjct: 99  DNITLARSLADKANNIEELKESLLNFNGCELKKFATNTVFGDGNLEAKIMLIGEAPGSIE 158

Query: 122 NISGKPFSGKTGNMLDKMLQSIEIMRTQI-HISMISPWHPPGNRNLSNIEMEICRPIIMR 180
           ++ G PF G++GN+LD ML +I I R    +I+    W PP NR  +  E++ICRP + +
Sbjct: 159 DLKGIPFCGESGNLLDNMLHAIGISRKNNAYITNTVFWRPPANRQPTLEEVDICRPFVEK 218

Query: 181 QIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPT--LATVHPQELI 238
            I LI+PK+++ +G+               +   ++      +   P    A  HP  L+
Sbjct: 219 HIALINPKLIILVGSTAATSLLG-KNSGITKIRQEYYFYTNKYLSAPIQTTAIFHPAYLL 277

Query: 239 QYPLIKKNTWHALITLKKALKN 260
           + P+ K+ +W+ L+ +K+ L N
Sbjct: 278 RQPMQKRTSWYDLLKIKEYLVN 299


>gi|84515828|ref|ZP_01003189.1| hypothetical protein SKA53_14301 [Loktanella vestfoldensis SKA53]
 gi|84510270|gb|EAQ06726.1| hypothetical protein SKA53_14301 [Loktanella vestfoldensis SKA53]
          Length = 257

 Score =  191 bits (486), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 64/253 (25%), Positives = 107/253 (42%), Gaps = 15/253 (5%)

Query: 14  TIALFYADSGV-YWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQ 72
               +  + GV   + D P +    +      +  + + P    R +    V  A + A 
Sbjct: 12  AALEWQVELGVTDAILDAPVDRYALDPVPVRAAPVADVPPPAIAREL--DPVAIARAAAA 69

Query: 73  KACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKT 132
            A  L  L + + +F  C +   + + + A    G  +MI+G  P   ++ +GKPF G+ 
Sbjct: 70  AAPDLPALAAAMAAFEHCEIKRGARNAVFADGQPGARVMIVGEAPGREEDRAGKPFVGQA 129

Query: 133 GNMLDKMLQSIEIMRTQI------HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELIS 186
           G MLD+ML +I++ R         +I+ + PW PP NR     E+ +  P + R I L  
Sbjct: 130 GQMLDRMLAAIDLGRAHENTDRAVYITNVMPWRPPSNRTPDADEIAMMLPFLERHIALAD 189

Query: 187 PKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKN 246
           P+I++ +GN                  G W+ +       P L   HP  L++ P  K+ 
Sbjct: 190 PQIIVLMGNTPCQALLGQTG--ITALRGTWTEVLGK----PCLPMFHPAYLLRNPAAKRE 243

Query: 247 TWHALITLKKALK 259
            W  L+TL   LK
Sbjct: 244 AWADLLTLNARLK 256


>gi|281358066|ref|ZP_06244550.1| phage SPO1 DNA polymerase-related protein [Victivallis vadensis
           ATCC BAA-548]
 gi|281315439|gb|EFA99468.1| phage SPO1 DNA polymerase-related protein [Victivallis vadensis
           ATCC BAA-548]
          Length = 292

 Score =  191 bits (486), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 53/180 (29%), Positives = 82/180 (45%), Gaps = 5/180 (2%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L EL+ L  +  +C L     + +         LM IG  P   +++ G+PF G  G +L
Sbjct: 106 LDELRQLALACRNCPLAQGRHTVVFGEGNPEARLMFIGEGPGYQEDMQGRPFVGPAGQLL 165

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
            KM+Q+++  R +++I+ I    PP NRN    E   C   + RQIEL+ P+ ++ +G  
Sbjct: 166 TKMIQAMQFTREEVYIANIVKCRPPNNRNPEPDEAFACIGYLKRQIELVQPEAIVLLGAV 225

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
              F          +  GKW         IP + T HP  L++ P  KK  W  L  + K
Sbjct: 226 AVRFLLERPGGIM-RLRGKWLGYN----GIPVMPTFHPSYLLRDPSGKKLAWADLQMVMK 280


>gi|225872285|ref|YP_002753740.1| uracil-DNA glycosylase, family 4 [Acidobacterium capsulatum ATCC
           51196]
 gi|225793303|gb|ACO33393.1| uracil-DNA glycosylase, family 4 [Acidobacterium capsulatum ATCC
           51196]
          Length = 301

 Score =  191 bits (486), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 52/278 (18%), Positives = 98/278 (35%), Gaps = 34/278 (12%)

Query: 10  EQILTIALFYADSGVYWVFDE---------PNNEATYESQRKEKSIDSAIQPITNIRHIH 60
             +     +Y D GVY V+                +  +   +   +S  QP  +     
Sbjct: 11  ASLQARLRYYRDLGVYDVYRRGEPLAPAELAALLPSVAAPSPQPDPESTPQPAVSASPSV 70

Query: 61  S-------------------PLVQQADSIAQKACSLHELKSLLRSFHDCHLC-STSLSTI 100
           +                   P        AQ+  +L  L+  +     C L        +
Sbjct: 71  TVTRTEREEPALPPTVPHFMPSDSPIVPAAQRPEALRVLREEIGDCTRCQLAFEGRHKIV 130

Query: 101 CATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHP 160
                    LM +G  P   ++  G PF G+ G +L+ M+ ++ + R+Q++I+ I    P
Sbjct: 131 FGDGDPSARLMFVGEGPGADEDAQGLPFVGRAGQLLNNMIGAMGLERSQVYIANIVKCRP 190

Query: 161 PGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLC 220
           P NR     E   C   + RQ++++ P++++ +G+    +     +       G+     
Sbjct: 191 PQNRVPEPDEANTCTQFLFRQMQIVRPEMIVALGSTAATYLLGAKSPLKA-LRGRIHQA- 248

Query: 221 TPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
                   + T HP  L++ P  KK  W  L    + L
Sbjct: 249 ---HGSKLIVTYHPAYLLRDPNQKKEAWADLQIAMREL 283


>gi|317401956|gb|EFV82558.1| uracil-DNA glycosylase, family 4 [Achromobacter xylosoxidans C54]
          Length = 192

 Score =  191 bits (485), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 53/190 (27%), Positives = 88/190 (46%), Gaps = 3/190 (1%)

Query: 71  AQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSG 130
           A K  +L EL+  + +   C LCS     +     +    +++G  P + ++  G+PF G
Sbjct: 4   AVKNANLDELREQVVACTACGLCSGRRHAVFGHGGQPTRWLVVGEAPGEQEDRQGQPFVG 63

Query: 131 KTGNMLDKMLQSIEIMRTQI-HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKI 189
           ++G +LD ML ++ + R +   I+ +    PPGNRN    E+  C P +MRQI L+ P+ 
Sbjct: 64  RSGQLLDSMLSAVGMSRERDVFIANVIKCRPPGNRNPKPEEIAACSPYLMRQIALLKPER 123

Query: 190 LLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTP-HSIIPTLATVHPQELIQYPLIKKNTW 248
           +L +G          DA       G+   + T     IP + + HP  L++ P  K   W
Sbjct: 124 ILVLGRFAAQTLLGTDATIGS-LRGRVHQMKTEEGREIPVIVSYHPAYLLRSPAEKARAW 182

Query: 249 HALITLKKAL 258
             L    + L
Sbjct: 183 QDLKLAARQL 192


>gi|167581451|ref|ZP_02374325.1| phage SPO1 DNA polymerase domain protein [Burkholderia
           thailandensis TXDOH]
          Length = 237

 Score =  191 bits (485), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 49/211 (23%), Positives = 89/211 (42%), Gaps = 6/211 (2%)

Query: 51  QPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDL 110
           +P              A + +       EL++ +     C LC    +T+     E  D 
Sbjct: 24  EPGFEPAPPDVAAEPAARAPSVAELGWDELRARVADCERCRLCEKRTNTVFGVGDERADW 83

Query: 111 MIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNI 169
           M++G  P ++++  G+PF G+ G +LD ML+++ + R   ++I+ +    PPGNRN    
Sbjct: 84  MLVGEAPGENEDKQGEPFVGQAGKLLDNMLRALALKRGENVYIANVIKCRPPGNRNPEPD 143

Query: 170 EMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTL 229
           E+  C P + RQ+ L+ PK+++ +G          D        G+          +P +
Sbjct: 144 EVARCEPYLQRQVALVKPKLIVALGRFAAQTLLKTDGSIAS-MRGRVHEYE----GVPVI 198

Query: 230 ATVHPQELIQYPLIKKNTWHALITLKKALKN 260
            T HP  L++    K   W  L       ++
Sbjct: 199 VTYHPAYLLRSLQDKAKAWSDLCLANDTYRS 229


>gi|241662909|ref|YP_002981269.1| phage SPO1 DNA polymerase-like protein [Ralstonia pickettii 12D]
 gi|309782169|ref|ZP_07676899.1| arginine biosynthesis protein ArgJ [Ralstonia sp. 5_7_47FAA]
 gi|240864936|gb|ACS62597.1| phage SPO1 DNA polymerase-related protein [Ralstonia pickettii 12D]
 gi|308919235|gb|EFP64902.1| arginine biosynthesis protein ArgJ [Ralstonia sp. 5_7_47FAA]
          Length = 264

 Score =  191 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 55/238 (23%), Positives = 94/238 (39%), Gaps = 8/238 (3%)

Query: 24  VYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSL 83
           V     EP                        +  +      +A  IA  A    +L++ 
Sbjct: 30  VEVAAAEPVAVEVEADSFVAAESVPVRGEPPVMHALSDTAAPRAQRIA--AFDWAQLEAA 87

Query: 84  LRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSI 143
           + +   C LC    +T+        + M+IG  P + ++  G+PF G+ G +LD ML+SI
Sbjct: 88  VSNCTSCKLCERRTNTVFGVGDREAEWMLIGEAPGEQEDKQGEPFVGQAGKLLDSMLRSI 147

Query: 144 EIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFF 202
            + R + + I+ +    PPGNR+    E  +C P + RQI L+ P+I++ +G        
Sbjct: 148 GLSREKGVFIANVLKCRPPGNRDPEPDEAAMCDPYLKRQIALVKPRIIVVLGRIAAQNLL 207

Query: 203 NNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
                   +  GK   +      +P + T HP  L++    K   W  L   +K    
Sbjct: 208 Q-TQTPVGKLRGKVHEVE----GVPVVVTYHPAYLLRTLTDKARAWEDLCLARKIYAE 260


>gi|260893068|ref|YP_003239165.1| phage SPO1 DNA polymerase-related protein [Ammonifex degensii KC4]
 gi|260865209|gb|ACX52315.1| phage SPO1 DNA polymerase-related protein [Ammonifex degensii KC4]
          Length = 210

 Score =  191 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 51/185 (27%), Positives = 87/185 (47%), Gaps = 4/185 (2%)

Query: 74  ACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTG 133
             +L EL++++++   C L +   + +         LM IG  P   ++  G+PF G  G
Sbjct: 22  PQTLEELEAVVKNCRKCPLAAGRTNVVFGEGNPHALLMFIGEGPGAEEDRQGRPFVGPAG 81

Query: 134 NMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFI 193
            +LD++L +  I R +++I+ I    PPGNR  +  E E C P + RQIELI PKI++ +
Sbjct: 82  QLLDRILAACGIKREEVYIANIVKCRPPGNRVPTKEEAEACLPYLRRQIELIRPKIIVLL 141

Query: 194 GNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALIT 253
           G     +       +  +  G+W     P      + T HP  L++    K+  W     
Sbjct: 142 GATALQYLVG-SGARITKIRGQWL---GPLYGAQIMPTYHPAALLRDASKKRPAWEDFKK 197

Query: 254 LKKAL 258
           ++ A 
Sbjct: 198 VRDAY 202


>gi|71907612|ref|YP_285199.1| Phage SPO1 DNA polymerase-related protein [Dechloromonas aromatica
           RCB]
 gi|71847233|gb|AAZ46729.1| Phage SPO1 DNA polymerase-related protein [Dechloromonas aromatica
           RCB]
          Length = 260

 Score =  191 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 66/261 (25%), Positives = 105/261 (40%), Gaps = 18/261 (6%)

Query: 7   LSQEQILTIALFYADSGVY--WVFD--EPNNEATYESQRKEKSIDSAIQPITNIRHIHSP 62
           LS+EQ+L       + G+   WV     P   A   S + E    +  Q           
Sbjct: 3   LSREQMLA------EMGISPIWVLRDVAPPASAIESSPQMEAEAVTPPQVAEVPSAPIPA 56

Query: 63  LVQQADSIAQKACSLH--ELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDS 120
                 S A    +L    L   +     C LC      +        + + IG  P   
Sbjct: 57  QTPPPRSTAAAVDTLDWPALARQVAECRACSLCEQRKQAVLGVGDTNPEWLFIGEGPGAE 116

Query: 121 DNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIM 179
           +++ G+PF G+ G +LD ML S++I R  +++I+      PPGNR     EM  C P + 
Sbjct: 117 EDVKGEPFVGQAGKLLDNMLASLDIARGNRVYIANAVKCRPPGNRTPDAAEMAACWPYLE 176

Query: 180 RQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ 239
           RQI L+ PK+++ +G    +   ++D        GK   L      IP + T HP  L++
Sbjct: 177 RQIALLKPKVIVLLGKAAVHAVLHDDKSLAS-LRGKRFELA----GIPVVVTYHPAYLLR 231

Query: 240 YPLIKKNTWHALITLKKALKN 260
               K   W  L+  ++ L+ 
Sbjct: 232 NLPDKAKAWEDLLFARRTLRE 252


>gi|149174697|ref|ZP_01853322.1| DNA polymerase, bacteriophage-type [Planctomyces maris DSM 8797]
 gi|148846391|gb|EDL60729.1| DNA polymerase, bacteriophage-type [Planctomyces maris DSM 8797]
          Length = 295

 Score =  191 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 58/281 (20%), Positives = 104/281 (37%), Gaps = 38/281 (13%)

Query: 4   KRILSQEQILTIALFYADSGV--------------------YWVFDEPNNEATYESQRKE 43
            +  SQ  +  +   +  SGV                        ++P       +    
Sbjct: 5   AKTRSQRAVRQLLESWQRSGVTYLRQMEPLPELPAETTSPVEAPQEKPVQTVAPTTPLPR 64

Query: 44  KSIDSAIQPITNIRHIHSPLVQQADSIA------------QKACSLHELKSLLRSFHDCH 91
           +SI    QP            Q    ++             +   L  L + +     C 
Sbjct: 65  QSIVPPPQPTETSEEPTLESEQARKEMSVPRTTKSKMNKGDRQAELDILATQVSKCTRCP 124

Query: 92  -LCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQI 150
            L  T   T+         +M IG  P   ++  G+PF G+ G +LDK++++ ++ R+ I
Sbjct: 125 ELAETRTQTVFGVGNPRAKIMFIGEAPGADEDKQGEPFVGRAGKLLDKIIEACQMKRSDI 184

Query: 151 HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTY 210
           +I+ I    PPGNRN +++E   CR  +  QIE++ P  ++  G+       ++D     
Sbjct: 185 YIANILRCRPPGNRNPTDLEASNCRGYLDAQIEIVDPDYIVCWGSVAAKNLLHSDL-PIG 243

Query: 211 QNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
           +  G +            + T HP  L++ P  KKN W  +
Sbjct: 244 KMRGDFYEY----GRAKVVCTYHPSYLLRNPSAKKNVWEDM 280


>gi|33597880|ref|NP_885523.1| bacteriophage-related DNA polymerase [Bordetella parapertussis
           12822]
 gi|33574309|emb|CAE38642.1| bacteriophage-related DNA polymerase [Bordetella parapertussis]
          Length = 298

 Score =  191 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 55/223 (24%), Positives = 94/223 (42%), Gaps = 3/223 (1%)

Query: 36  TYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCST 95
                R  +   +A Q             + A +       L +L+ L++    C LC  
Sbjct: 76  AASPARAPRPPVAAPQRAEPAAEADGQAARAAVAARAAGADLGQLQQLVQDCTACGLCQG 135

Query: 96  SLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQI-HISM 154
               +     +    M++G  P + ++  G PF G++G +LD MLQS+ + R +   I+ 
Sbjct: 136 RRHAVFGMGAQPARWMVVGEAPGEQEDRQGLPFVGRSGKLLDAMLQSVGMSRERDVFIAN 195

Query: 155 ISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLG 214
           +    PPGNRN    E+  C P + RQI L++P+ +L +G          +A       G
Sbjct: 196 VIKCRPPGNRNPKPEEIAACSPYLRRQIALLNPERILVLGRFAAQTLLGTEA-TIGNLRG 254

Query: 215 KWSNLCT-PHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
           +  +L T     IP + + HP  L++ P  K   W  L+   +
Sbjct: 255 RVHSLQTDEGRSIPVVVSYHPAYLLRSPAEKARAWQDLLLAAR 297


>gi|307824421|ref|ZP_07654646.1| phage SPO1 DNA polymerase-related protein [Methylobacter
           tundripaludum SV96]
 gi|307734405|gb|EFO05257.1| phage SPO1 DNA polymerase-related protein [Methylobacter
           tundripaludum SV96]
          Length = 228

 Score =  191 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 60/251 (23%), Positives = 105/251 (41%), Gaps = 26/251 (10%)

Query: 11  QILTIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSI 70
              T   +    G+                          + + + +   +P+    ++ 
Sbjct: 2   DNATRLQYLEAMGIDVWL---------------------PRAVADNQQTSTPVAIAENAR 40

Query: 71  AQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSG 130
            +   S   L++ +     C LC T   T+  +  +  D MIIG  P   ++  G PF G
Sbjct: 41  PESTDSWEALQAEVAPCTQCDLCKTRTQTVFGSGNKNADWMIIGEGPGQHEDQQGLPFVG 100

Query: 131 KTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKIL 190
             G +L +ML++I + R ++ I+ I    PP NR+   IE+E C+P +MRQI L+ PKI+
Sbjct: 101 NAGLLLTEMLRAIGLDREEVFITNIVKCRPPANRDPKPIEIETCKPYLMRQIALLKPKII 160

Query: 191 LFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHA 250
           + +G        + D +   +  GK   L       P +   HP  L++  L K+  W  
Sbjct: 161 VVLGRIAAQALLDTD-EPISKLRGKIHALN----DTPVVVVYHPAYLLRSMLDKRKAWAD 215

Query: 251 LITLKKALKNL 261
           L    + +KN+
Sbjct: 216 LKLALQTVKNI 226


>gi|220935320|ref|YP_002514219.1| phage SPO1 DNA polymerase-related protein [Thioalkalivibrio sp.
           HL-EbGR7]
 gi|219996630|gb|ACL73232.1| phage SPO1 DNA polymerase-related protein [Thioalkalivibrio sp.
           HL-EbGR7]
          Length = 241

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 54/227 (23%), Positives = 94/227 (41%), Gaps = 7/227 (3%)

Query: 34  EATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDC-HL 92
           +        +    S   P+          V +  +         EL + + +   C  L
Sbjct: 18  QRWVPRAVPDAPAASGAVPVAYEASQAPAPVVEVSAGDVSQLDWDELAARVAACSRCGEL 77

Query: 93  CSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ-IH 151
            +T   T+        D + IG  P   ++  G+PF G+ G +LD ML ++ + R + ++
Sbjct: 78  AATRTQTVFGVGDRQADWLFIGEAPGAEEDRQGEPFVGRAGQLLDSMLFALGLKRGRGVY 137

Query: 152 ISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQ 211
           I+ I    PPGNR+    E   CR  + RQI+LI P+I++ +G          D     +
Sbjct: 138 IANILKCRPPGNRDPKPEEARACRAYLDRQIDLIQPRIIVALGRIAAQNLLGTD-----E 192

Query: 212 NLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
            LG+       +  IP + T HP  L++ P  K+  W  L   ++ +
Sbjct: 193 PLGRLRGKPLNYRDIPLVITYHPAYLLRQPADKRKAWEDLCLARRVM 239


>gi|53719792|ref|YP_108778.1| putative phage-related DNA polymerase [Burkholderia pseudomallei
           K96243]
 gi|52210206|emb|CAH36185.1| putative phage-related DNA polymerase [Burkholderia pseudomallei
           K96243]
          Length = 284

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 49/211 (23%), Positives = 90/211 (42%), Gaps = 6/211 (2%)

Query: 51  QPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDL 110
           +P+             A + +       EL++ +     C LC    +T+     E  D 
Sbjct: 71  EPVHEPVLPDVAARPAATTPSVAELGWDELRARVADCERCRLCEKRTNTVFGVGDERADW 130

Query: 111 MIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNI 169
           M++G  P ++++  G+PF G+ G +LD ML+++ + R   ++I+ +    PPGNRN    
Sbjct: 131 MLVGEAPGENEDKQGEPFVGQAGKLLDNMLRALALKRGENVYIANVIKCRPPGNRNPEPD 190

Query: 170 EMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTL 229
           E+  C P + RQ+ L+ PK+++ +G          D        G+          +P +
Sbjct: 191 EVARCEPYLQRQVALVKPKLIVALGRFAAQTLLKTDGSIAS-MRGRVHQYE----GVPVI 245

Query: 230 ATVHPQELIQYPLIKKNTWHALITLKKALKN 260
            T HP  L++    K   W  L       ++
Sbjct: 246 VTYHPAYLLRSLQDKAKAWSDLCLANDTYRS 276


>gi|299067423|emb|CBJ38622.1| uracil-DNA glycosylase,phage-related protein [Ralstonia
           solanacearum CMR15]
          Length = 289

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 56/234 (23%), Positives = 94/234 (40%), Gaps = 8/234 (3%)

Query: 28  FDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSF 87
            + P             +  +             P+V +A  IA  A    +L+S +   
Sbjct: 59  IEAPPVAVAEVVSVAMPAAAAVATVADVPIEPIDPVVPRAQRIA--AFDWAQLESAVSGC 116

Query: 88  HDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR 147
             C LC     T+        D M+IG  P + ++  G+PF G+ G +LD ML++I + R
Sbjct: 117 TACKLCERRTQTVFGVGDRQADWMLIGEAPGEQEDRQGEPFVGQAGKLLDSMLRAIGLSR 176

Query: 148 TQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDA 206
              + I+ +    PPGNR+    E+ +C P + RQI LI P++++ +G            
Sbjct: 177 ETGVFIANVLKCRPPGNRDPEPDEVAMCDPYLKRQIALIKPRVIIVLGRFAAQSLLQ-TQ 235

Query: 207 QKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
               +  GK   +      +P + T HP  L++    K   W  L   +K    
Sbjct: 236 TPVGKLRGKVHEV----DGVPVVVTYHPAYLLRTLTDKARAWEDLCLARKVYTE 285


>gi|114570739|ref|YP_757419.1| phage SPO1 DNA polymerase-like protein [Maricaulis maris MCS10]
 gi|114341201|gb|ABI66481.1| phage SPO1 DNA polymerase-related protein [Maricaulis maris MCS10]
          Length = 286

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 66/270 (24%), Positives = 111/270 (41%), Gaps = 20/270 (7%)

Query: 8   SQEQILTIALFYADSGV--YWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHI------ 59
            ++ +  +  ++AD+G+        P   A   S    +    A                
Sbjct: 12  DEKALQALIAWWADAGIEMDEPIVTPRPAAAPVSPHTTEPRRQAPAEPVRAATPQAARAA 71

Query: 60  ----HSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGY 115
                      A S+A KA SL  L+  + +F  C L  T+ +T+ A       +M++G 
Sbjct: 72  GFGDSPATGPGARSVAAKADSLDALREAIEAFEGCALKRTARNTVFARGERAARVMLVGE 131

Query: 116 TPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICR 175
            P   ++  G+PF+G++G +LD+M  +I I R Q +I+ +  W PPGNR  +  E+  C 
Sbjct: 132 APGRDEDERGEPFAGQSGRLLDQMFAAIGIERDQAYIAHMLNWRPPGNRAPTQDEIAQCL 191

Query: 176 PIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPH-------SIIPT 228
           P I R I L  P IL+  G         +D     +  G+W +            + I  
Sbjct: 192 PFIERHIALKKPDILVLAGELGARALLRSDT-AITRLRGRWVDYVLRDAEGNPTSTSIKA 250

Query: 229 LATVHPQELIQYPLIKKNTWHALITLKKAL 258
           L    P+ L+  P+ K+  W  ++ L   L
Sbjct: 251 LPVFSPRYLLARPVEKRLAWQDMLALADQL 280


>gi|302382435|ref|YP_003818258.1| phage SPO1 DNA polymerase-related protein [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302193063|gb|ADL00635.1| phage SPO1 DNA polymerase-related protein [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 261

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 57/263 (21%), Positives = 105/263 (39%), Gaps = 8/263 (3%)

Query: 2   TSKRILSQEQILTIALFYADSGVYWVF-DEPNNEATYESQRKEKSIDSAIQPITNIRHIH 60
            + +      I ++  F+ D+GV   F D P +     +   +    +    +  +    
Sbjct: 1   MNAQPRETAAIESLLAFWRDAGVDACFEDAPQDRTIVVAPALKAVTRATASVMPVVDM-- 58

Query: 61  SPLVQQADSIAQKACSLHELKSLLRSFHDCHLCS-TSLSTICATQTEGQDLMIIGYTPSD 119
                 A  +A  A ++  L++   SF  C L    +   +         +++IG  P  
Sbjct: 59  GDATADARRLANGADTMEALEAAAASFRGCELVGMGARGCVFGRGDPHAPVLVIGEAPGA 118

Query: 120 SDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIM 179
            ++ +G+PF G+ G +LDKML +  +   ++ I+    W PPGNR  +  E   C P + 
Sbjct: 119 EEDATGQPFVGQPGKLLDKMLAAAGLA-DKVFITNTVFWRPPGNRTPTPQEQAACAPFVE 177

Query: 180 RQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCT--PHSIIPTLATVHPQEL 237
           R   L+ P+ +L +G                +  G W            P +AT+HP  L
Sbjct: 178 RAFFLMKPRAVLLLGAAAARSVL-RTEDGIMKVRGHWREWRLTEGDVTAPVIATLHPAFL 236

Query: 238 IQYPLIKKNTWHALITLKKALKN 260
           ++ P  K+  W  ++ L   L+ 
Sbjct: 237 LKQPQAKRQAWADMLELAARLEA 259


>gi|88810468|ref|ZP_01125725.1| Phage SPO1 DNA polymerase-related protein [Nitrococcus mobilis
           Nb-231]
 gi|88792098|gb|EAR23208.1| Phage SPO1 DNA polymerase-related protein [Nitrococcus mobilis
           Nb-231]
          Length = 265

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 57/258 (22%), Positives = 105/258 (40%), Gaps = 8/258 (3%)

Query: 7   LSQEQILTIALFYADSGVYWVFDE---PNNEATYESQRKEKSIDSAIQP--ITNIRHIHS 61
           +     L    +    G+            +A  E+     SI+  +QP  +       +
Sbjct: 1   MKTRDGLFRLQYLQRLGIDVWVRRQGGAAEQAPVENTTGRASIERLVQPGVVVEDTADTN 60

Query: 62  PLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSD 121
           P                 L+  ++    C L  T +  +         LM+IG  P   +
Sbjct: 61  PARLITAEAEIARLDWEALRERVQHCERCLLHQTRMQGVFGIGNPQAQLMLIGEAPGAEE 120

Query: 122 NISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQ 181
           +  G+PF G+ G +LD+ML++I + R +++I+ +    PP NR+ +  E+  C P + RQ
Sbjct: 121 DRRGEPFVGRAGKLLDEMLRAIGLSRERVYITNVLKSRPPNNRDPTPDEVAACEPYLRRQ 180

Query: 182 IELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
           +ELI+P ++L +G     +   +      +  G W +        P   T HP  L++ P
Sbjct: 181 LELIAPSLILALGRIAAQYLLKSTQSL-GRLRGAWHHY--GPRATPLRVTYHPAYLLRSP 237

Query: 242 LIKKNTWHALITLKKALK 259
             K   W  L  +++ L+
Sbjct: 238 ADKHKAWQDLKQVRQCLR 255


>gi|313679738|ref|YP_004057477.1| phage spo1 DNA polymerase-related protein [Oceanithermus profundus
           DSM 14977]
 gi|313152453|gb|ADR36304.1| phage SPO1 DNA polymerase-related protein [Oceanithermus profundus
           DSM 14977]
          Length = 205

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 56/192 (29%), Positives = 88/192 (45%), Gaps = 11/192 (5%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           SL EL +       C L       +         LMI+G  P   ++  G+PF G+ G +
Sbjct: 2   SLEELAAQAAHCTACRLHEGRTHVVFGEGDPDAKLMIVGEGPGADEDAQGRPFVGRAGQL 61

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRP-IIMRQIELISPKILLFIG 194
           LD++L++  I R+ ++I+ I    PPGNRN    E +IC    +++QIELI P+I++ +G
Sbjct: 62  LDRILEAAGIPRSSVYITNIVKCRPPGNRNPLPDEAKICSSLWLLKQIELIRPQIIVPLG 121

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLI-----KKNTWH 249
           +    FF         +  G+W         I      HP  L++ P       K  TW 
Sbjct: 122 SVATQFFLGEKL-PITKVRGQWFEWN----GIQVFPMFHPAYLLRNPSRAPGSPKALTWK 176

Query: 250 ALITLKKALKNL 261
            + T+K+ L  L
Sbjct: 177 DIQTVKQTLDRL 188


>gi|116621468|ref|YP_823624.1| phage SPO1 DNA polymerase-like protein [Candidatus Solibacter
           usitatus Ellin6076]
 gi|116224630|gb|ABJ83339.1| phage SPO1 DNA polymerase-related protein [Candidatus Solibacter
           usitatus Ellin6076]
          Length = 244

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 54/256 (21%), Positives = 95/256 (37%), Gaps = 26/256 (10%)

Query: 7   LSQEQILTIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQ 66
           +  + +     FY D  +  ++            R+     +A+ P         P ++ 
Sbjct: 1   MDADSLRQYLEFYQDLHIQTLY------------RRTAPPVAAVTPAPIALAAPEPKMEL 48

Query: 67  ADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGK 126
              +A    SL ++   +   H C L       +     E   L+ +G  P   ++  G 
Sbjct: 49  PP-LAPPNDSLLKIIQDIGDCHRCKLGDARNKIVFGVGDEKAQLVFVGEGPGADEDEQGI 107

Query: 127 PFSGKTGNMLDKMLQSIEI------MRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMR 180
           PF G+ G +L +M+++          R  ++I  +    PPGNR     EMEIC   + R
Sbjct: 108 PFVGRAGQLLTQMIENTSKKEGIPLKRGDVYICNVVKCRPPGNRTPEPEEMEICGEFLYR 167

Query: 181 QIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ- 239
           Q+  I PK +  +G         +  +   +  GKW         IP + T HP  L++ 
Sbjct: 168 QLSTIRPKAICALGGTAARAVTGHK-EGVTKMRGKWFKWQ----DIPVMVTYHPSYLLRP 222

Query: 240 -YPLIKKNTWHALITL 254
                K+  W  L  +
Sbjct: 223 FNENAKREAWEDLKKV 238


>gi|34498909|ref|NP_903124.1| DNA-directed DNA polymerase [Chromobacterium violaceum ATCC 12472]
 gi|34104758|gb|AAQ61115.1| probable DNA-directed DNA polymerase, bacteriophage-type
           [Chromobacterium violaceum ATCC 12472]
          Length = 280

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 53/240 (22%), Positives = 97/240 (40%), Gaps = 10/240 (4%)

Query: 20  ADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKAC--SL 77
           A+SG+     EP   +   + ++  S+       +               +A ++     
Sbjct: 41  AESGMPDPALEP--RSLIPAPQETASVAPPASNFSPPEQPQPAAEPLRAEVATESPLLDW 98

Query: 78  HELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLD 137
            +L+  +    DC LC T   T+          M+IG  P ++++  G PF G+ G +LD
Sbjct: 99  PQLQRKVSDCQDCRLCETRTQTVFGRGNPQARWMLIGEAPGENEDRQGLPFVGRAGQLLD 158

Query: 138 KMLQSIEIMRTQI-HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
            ML +  + R Q  +I+ +    PPGNRN +  E+  C   +++QI  I P +++ +G  
Sbjct: 159 NMLSAAGLDREQDVYIANVLKCRPPGNRNPAPDEIAACNGYLLQQIRHIQPTLIVALGRF 218

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
                         +  GK          +P + + HP  L++    K   W  L+  +K
Sbjct: 219 AAQTLL-ETESSIGRLRGKVHRYQ----GLPLVVSYHPAYLLRNQPDKAKAWQDLLLARK 273


>gi|296120473|ref|YP_003628251.1| phage SPO1 DNA polymerase-related protein [Planctomyces limnophilus
           DSM 3776]
 gi|296012813|gb|ADG66052.1| phage SPO1 DNA polymerase-related protein [Planctomyces limnophilus
           DSM 3776]
          Length = 305

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 50/220 (22%), Positives = 87/220 (39%), Gaps = 6/220 (2%)

Query: 36  TYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCH-LCS 94
             E  ++      A    T       P       +A++   L +LK  + +   C  L S
Sbjct: 82  ELEMAKRSARSQMAPPAPTASGIAPQPPKLLNLPLAERVHELEKLKKCVANCTRCPELAS 141

Query: 95  TSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISM 154
           T   T+         +M +G  P   ++ +G PF G+ G +LD ++ + ++ R +I+I  
Sbjct: 142 TRKQTVFGVGNPQAKIMFLGEAPGADEDATGVPFVGRAGQLLDGIIAACKLKREEIYICN 201

Query: 155 ISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLG 214
           I    PPGNR  S  E   CR  +  QI +++P+ ++  G+           +   +  G
Sbjct: 202 ILRCRPPGNRLPSPEEAGNCREWLDGQISIVNPEYIICWGSTAAKNLLG-TTEAIGKLRG 260

Query: 215 KWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITL 254
           K               T HP  L++ P  KK+ W  +   
Sbjct: 261 KLFEY----GRAKVCCTYHPSYLLRNPPAKKDVWQDMKWF 296


>gi|289523071|ref|ZP_06439925.1| uracil-DNA glycosylase [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
 gi|289503614|gb|EFD24778.1| uracil-DNA glycosylase [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
          Length = 211

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 44/192 (22%), Positives = 81/192 (42%), Gaps = 9/192 (4%)

Query: 75  CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
            +   L+  ++    C L      ++    +   +LM +G  P   +++ G PF GK G 
Sbjct: 19  ETWKILEEKVKECRKCPLSENRTQSVFGEGSRKTELMFVGEGPGADEDLQGLPFVGKAGQ 78

Query: 135 MLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           +L+++  +  I R++++I+ +    PP NR  +  E   C   +  QI L+ PKIL+ +G
Sbjct: 79  LLNQIFAAAGIDRSEVYITNVVKCRPPQNRVPTVEECSACNDYLFAQISLVQPKILITLG 138

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIK-----KNTWH 249
           N    +      +   Q  GKW +       I  +   HP  L++    K       TW 
Sbjct: 139 NTPTKWLLKTTHEGITQLRGKWFDWY----GIKLMPMFHPSYLLRNQSRKVGSPRHLTWQ 194

Query: 250 ALITLKKALKNL 261
            +  +K     +
Sbjct: 195 DIQEVKARWDEI 206


>gi|187928331|ref|YP_001898818.1| phage SPO1 DNA polymerase-like protein [Ralstonia pickettii 12J]
 gi|187725221|gb|ACD26386.1| phage SPO1 DNA polymerase-related protein [Ralstonia pickettii 12J]
          Length = 264

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 54/238 (22%), Positives = 94/238 (39%), Gaps = 8/238 (3%)

Query: 24  VYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSL 83
           V     EP                        +  +      +A  IA  A    +L++ 
Sbjct: 30  VEVAAAEPVAVEVEADSFVAAESVPVRGEPPVMHALSDTAAPRAQRIA--AFDWAQLEAA 87

Query: 84  LRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSI 143
           + +   C LC    +T+        + M+IG  P + ++  G+PF G+ G +LD ML+SI
Sbjct: 88  VSNCTSCKLCERRTNTVFGVGDREAEWMLIGEAPGEQEDKQGEPFVGQAGKLLDSMLRSI 147

Query: 144 EIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFF 202
            + R + + I+ +    PPGNR+    E  +C P + RQI L+ P+I++ +G        
Sbjct: 148 GLSREKGVFIANVLKCRPPGNRDPEPDEAAMCDPYLKRQIALVKPRIIVVLGRVAAQNLL 207

Query: 203 NNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
                   +  G   ++      +P + T HP  L++    K   W  L   +K    
Sbjct: 208 Q-TQTPVGKLRGTVHDVE----GVPVVVTYHPAYLLRTLTDKARAWEDLCLARKIYAE 260


>gi|206602194|gb|EDZ38676.1| Uracil-DNA glycosylase, family 4 [Leptospirillum sp. Group II
           '5-way CG']
          Length = 245

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 48/203 (23%), Positives = 84/203 (41%), Gaps = 2/203 (0%)

Query: 56  IRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGY 115
                      A  +      L  L+  + +   C L  T    +         LM +G 
Sbjct: 34  PSPGKDVEKVPAAPMPSFPEDLDGLERFVLACQACSLSETRNQVVFGEGRGTSGLMFVGE 93

Query: 116 TPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICR 175
            P   ++ +G+PF G+ G +L KM+Q++ + R +++I+      PPGNR  S  E + C 
Sbjct: 94  GPGADEDRTGRPFVGRAGELLTKMIQAMGLSREEVYIANTVKCRPPGNRVPSPEERKACF 153

Query: 176 PIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQ 235
           P +  QI L+ PK ++ +G           +    +  G    L   +  I  + T HP 
Sbjct: 154 PFLEAQIRLLKPKYMILLGQTAAQVVL-RQSAGITRIRGTCCELP-EYPGIKIMPTYHPA 211

Query: 236 ELIQYPLIKKNTWHALITLKKAL 258
            L++ P  K++ W  L T+   +
Sbjct: 212 YLLRNPSAKRDVWSDLQTVMGWM 234


>gi|33602783|ref|NP_890343.1| bacteriophage-related DNA polymerase [Bordetella bronchiseptica
           RB50]
 gi|33577225|emb|CAE35782.1| bacteriophage-related DNA polymerase [Bordetella bronchiseptica
           RB50]
          Length = 242

 Score =  189 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 55/223 (24%), Positives = 94/223 (42%), Gaps = 3/223 (1%)

Query: 36  TYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCST 95
                R  +   +A Q             + A +       L +L+ L++    C LC  
Sbjct: 20  AASPARAPRPPVAAPQRAEPAAEADGQAARAAVAARAAGADLGQLQQLVQDCTACGLCQG 79

Query: 96  SLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQI-HISM 154
               +     +    M++G  P + ++  G PF G++G +LD MLQS+ + R +   I+ 
Sbjct: 80  RRHAVFGMGAQPARWMVVGEAPGEQEDRQGLPFVGRSGKLLDAMLQSVGMSRERDVFIAN 139

Query: 155 ISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLG 214
           +    PPGNRN    E+  C P + RQI L++P+ +L +G          +A       G
Sbjct: 140 VIKCRPPGNRNPKPEEIAACSPYLRRQIALLNPERILVLGRFAAQTLLGTEA-TIGNLRG 198

Query: 215 KWSNLCT-PHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
           +  +L T     IP + + HP  L++ P  K   W  L+   +
Sbjct: 199 RVHSLQTDEGRSIPVVVSYHPAYLLRSPAEKARAWQDLLLAAR 241


>gi|325474785|gb|EGC77971.1| DNA polymerase domain-containing protein [Treponema denticola
           F0402]
          Length = 264

 Score =  189 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 64/266 (24%), Positives = 108/266 (40%), Gaps = 18/266 (6%)

Query: 7   LSQEQILTIALFYADSGVY---WVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPL 63
           +  E+  T+  F+  +  Y   +  DE   +    +  +    D+++        +  PL
Sbjct: 1   MKAEEKKTLYTFFRTASEYLSGFKTDEEYPDFADTALSETAIPDTSLPETEGTDGLTIPL 60

Query: 64  VQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQ-------TEGQDLMIIGYT 116
                       SL ++ + + S   C LC    +T+               ++M+IG  
Sbjct: 61  NDT--DSENGFESLEKVYAQIASCKACRLCERRHNTVAGEGPCEFSNFDNKIEVMVIGEG 118

Query: 117 PSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICR 175
           P   ++  G+PF GK G +LDKML +IE+ R    +I+ +    PP NR+    E   CR
Sbjct: 119 PGADEDAQGRPFVGKAGQLLDKMLAAIELYRTHNCYITNVVKCRPPNNRDPLPDETAACR 178

Query: 176 PIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQ 235
             +  QI LI PK +L +G            +   +  GK+         IP +AT HP 
Sbjct: 179 NYLNAQIALIKPKAILVVGRVALQNLLG-TQEGIGKMHGKFFEYQN----IPLMATYHPS 233

Query: 236 ELIQYPLIKKNTWHALITLKKALKNL 261
            L++   +K+  W  L   +  L  L
Sbjct: 234 ALLRDVNLKRPAWEDLKLFRSRLNEL 259


>gi|189183624|ref|YP_001937409.1| bacteriophage-type DNA polymerase [Orientia tsutsugamushi str.
           Ikeda]
 gi|189180395|dbj|BAG40175.1| bacteriophage-type DNA polymerase [Orientia tsutsugamushi str.
           Ikeda]
          Length = 268

 Score =  189 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 67/252 (26%), Positives = 125/252 (49%), Gaps = 9/252 (3%)

Query: 15  IALFYADSGVY--WVFD--EPNNEATYESQRKEKSIDSAIQPI-TNIRHIHSPLVQQADS 69
              +Y+  G+    ++D     N+    +  K K++ +       N ++ H  ++  +  
Sbjct: 11  ALKWYSYMGIDDNIIYDGTASLNQCNSINISKAKTLIAQNSSGFNNNQNTHLAVLSNSRQ 70

Query: 70  IAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFS 129
           +A    +L +LKS + SF  C L  T+L+T+         +M+IG  P  +++  G PF 
Sbjct: 71  LADSVHTLEDLKSSVTSFDGCLLKKTALNTVFGDGIPSAQIMLIGEAPGQNEDKHGIPFC 130

Query: 130 GKTGNMLDKMLQSIEIMRTQI-HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPK 188
           G++G +LD MLQSI + RT+  +I+    W PP NR  ++ E+ ICRP + + I +I+PK
Sbjct: 131 GESGKLLDNMLQSINLSRTKNVYITNTVFWRPPANRRPTSDELVICRPFVEKHIAIINPK 190

Query: 189 ILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSI--IPTLATVHPQELIQYPLIKKN 246
           +++ +G+         D  K  +   ++      +    IP  A  HP  +++ PL KK 
Sbjct: 191 LIILVGSTAATSMLG-DHVKISKIRQEYFLYKNCYLTFSIPITAIFHPAYMLRQPLQKKA 249

Query: 247 TWHALITLKKAL 258
            W  L+ +++ +
Sbjct: 250 CWFDLLKIQQFI 261


>gi|73541626|ref|YP_296146.1| Phage SPO1 DNA polymerase-related protein [Ralstonia eutropha
           JMP134]
 gi|72119039|gb|AAZ61302.1| Phage SPO1 DNA polymerase-related protein [Ralstonia eutropha
           JMP134]
          Length = 285

 Score =  189 bits (481), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 52/213 (24%), Positives = 93/213 (43%), Gaps = 7/213 (3%)

Query: 46  IDSAIQPITNIR-HIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQ 104
            ++  +P+      +         + A  A     L + + +   C LCST  +T+    
Sbjct: 69  AEAFAEPLPPAVVDLPVIAPVSDRAAAIAAMDWPTLDAAVAACEACGLCSTRTNTVFGVG 128

Query: 105 TEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGN 163
               + M+IG  P +++++ G+PF G+ G +LD ML S+ + R   + I+ +    PPGN
Sbjct: 129 DREAEWMLIGEAPGENEDLQGEPFVGQAGKLLDNMLASLGLRRGRNVFIANVLKCRPPGN 188

Query: 164 RNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPH 223
           RN    E++ C P + RQI L+ PK+++ +G                +  G   +     
Sbjct: 189 RNPEPAEVDQCEPFLKRQIALVRPKVIVVLGRFAAQSLL-RTTTPIGKLRGTVHSYE--- 244

Query: 224 SIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
             IP + T HP  L++    K   W  L   ++
Sbjct: 245 -GIPVVVTYHPAYLLRTLTDKARAWEDLCLARE 276


>gi|268315592|ref|YP_003289311.1| phage SPO1 DNA polymerase-like protein [Rhodothermus marinus DSM
           4252]
 gi|262333126|gb|ACY46923.1| phage SPO1 DNA polymerase-related protein [Rhodothermus marinus DSM
           4252]
          Length = 263

 Score =  189 bits (479), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 58/252 (23%), Positives = 101/252 (40%), Gaps = 9/252 (3%)

Query: 14  TIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQK 73
            +   YA  G    +  P   +T E     + +    QP             +A    + 
Sbjct: 11  ALLQEYALLGPLGFWKTPVAMSTPEHAPSNQDLFGQPQPPPESAPADPYARIEALIPPES 70

Query: 74  A----CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFS 129
                 +L E+   +       + +   + +        DLM+IG  P   ++  G+PF 
Sbjct: 71  PLRAMRTLDEVARYVAETVLIPIDARRTNPVFGVGNPEADLMVIGEAPGAEEDRQGEPFV 130

Query: 130 GKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKI 189
           G  G +L+KML++I   R +++I+ +    PP NR+    E+E   PI+ +QI L+ P+I
Sbjct: 131 GPAGQLLNKMLKAIGFEREEVYITNVLKSRPPHNRDPQPDEIEAHLPILYKQIALVKPRI 190

Query: 190 LLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWH 249
           +L +G    N     +        GK  +       +P + T HP  L++ P  K+  W 
Sbjct: 191 ILCVGRIAGNALLGRNGSLRA-LRGKVHDF----HGLPVVVTFHPAALLRNPQWKRLAWE 245

Query: 250 ALITLKKALKNL 261
            L  L+     L
Sbjct: 246 DLQLLRAHYDRL 257


>gi|197121903|ref|YP_002133854.1| phage SPO1 DNA polymerase-related protein [Anaeromyxobacter sp. K]
 gi|196171752|gb|ACG72725.1| phage SPO1 DNA polymerase-related protein [Anaeromyxobacter sp. K]
          Length = 295

 Score =  189 bits (479), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 56/282 (19%), Positives = 95/282 (33%), Gaps = 41/282 (14%)

Query: 10  EQILTIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADS 69
            ++     +   +GV  V   P      E          A                    
Sbjct: 15  AELARHLRWLEAAGVREV---PVPVLAVEPPAPAAHARQAGPAAERGAPAGRAPASPPPP 71

Query: 70  IAQK---------------------------------ACSLHELKSLLRSFHDCHLCSTS 96
             Q                                  + +L +++  L     C L    
Sbjct: 72  GQQAPPAAPREAPARTPAPVAPAPVAGAHRIGEKGCGSAALVQVRDALGDCRRCKLAGGR 131

Query: 97  LSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMIS 156
            + +        +L+ +G  P   ++  G+PF GK G +L KM+Q++   R Q++I+ + 
Sbjct: 132 TTLVFGVGNPQAELVFVGEGPGADEDREGEPFVGKAGQLLTKMIQAMGYQREQVYIANVV 191

Query: 157 PWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKW 216
              PPGNRN    E+E C P +  Q+  I P++++ +G          D     +  G+W
Sbjct: 192 KCRPPGNRNPEPDEIEACEPFLRAQLAAIRPRVVVALGKFAAQTLL-RDTTPITRLRGRW 250

Query: 217 SNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
                    I  + T HP  L++ P  KK  W  L  + K L
Sbjct: 251 REYE----GIRLMPTFHPAYLLRSPEEKKKAWEDLQLVMKEL 288


>gi|160872254|ref|ZP_02062386.1| phage SPO1 DNA polymerase domain protein [Rickettsiella grylli]
 gi|159121053|gb|EDP46391.1| phage SPO1 DNA polymerase domain protein [Rickettsiella grylli]
          Length = 240

 Score =  189 bits (479), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 54/206 (26%), Positives = 88/206 (42%), Gaps = 3/206 (1%)

Query: 54  TNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMII 113
             ++                  +  ELK  +     C L  T  + +        DL+++
Sbjct: 30  ARVKDEDMSEKPMTRQQKISTMNWQELKLAVNHCKACDLYKTRSNPVFGVGNPHADLLVV 89

Query: 114 GYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEI 173
           G  P   ++  G+PF G+ G +L  ML SI   R   +I+ I    PP NR+ S  E+  
Sbjct: 90  GEAPGAHEDKQGEPFVGRGGQLLTNMLSSIGFKREDYYIANILKSRPPNNRDPSLEEVSA 149

Query: 174 CRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVH 233
           C P ++RQI LI PK++L +G    ++  + ++    +  G           IP L T H
Sbjct: 150 CTPYLLRQINLIKPKLILAVGRIAAHYLLSTES-TMARLRGNLF--YFGERKIPLLVTYH 206

Query: 234 PQELIQYPLIKKNTWHALITLKKALK 259
           P  L++ P  K+  W  +  +KK L 
Sbjct: 207 PAYLLRSPREKRKAWQDMRCVKKQLD 232


>gi|94310339|ref|YP_583549.1| phage SPO1 DNA polymerase-related protein [Cupriavidus
           metallidurans CH34]
 gi|93354191|gb|ABF08280.1| DNA polymerase bacteriophage-type,uracil-DNA glycosylase
           superfamily [Cupriavidus metallidurans CH34]
          Length = 317

 Score =  189 bits (479), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 55/228 (24%), Positives = 92/228 (40%), Gaps = 6/228 (2%)

Query: 30  EPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHD 89
              NEA      +          +     I    VQ              L   +     
Sbjct: 86  HAVNEAEVAETIEAFDAPGPAHAVEVPVPIALAPVQDGREALIATMDWPVLADSVAGCTA 145

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-T 148
           C LCST  +T+     +  + M++G  P +++++ G+PF G+ G +LD ML ++ + R  
Sbjct: 146 CGLCSTRTNTVFGVGDQQAEWMLVGEAPGENEDLQGEPFVGQAGKLLDNMLGALGLARGR 205

Query: 149 QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQK 208
            ++I+ +    PPGNRN    E+  C P + RQI LI PK+++ +G         +    
Sbjct: 206 NVYIANVLKCRPPGNRNPEPGEVAQCEPYLKRQIALIKPKVIVVLGRFAAQSLLRSTTPI 265

Query: 209 TYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
                GK       +  IP + T HP  L++    K   W  L   ++
Sbjct: 266 -----GKLRGAVHSYEGIPVVVTYHPAYLLRTLTDKARAWEDLCLARE 308


>gi|300704264|ref|YP_003745867.1| uracil-DNA glycosylase,phage-like protein [Ralstonia solanacearum
           CFBP2957]
 gi|299071928|emb|CBJ43257.1| uracil-DNA glycosylase,phage-related protein [Ralstonia
           solanacearum CFBP2957]
          Length = 279

 Score =  189 bits (479), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 53/240 (22%), Positives = 96/240 (40%), Gaps = 10/240 (4%)

Query: 26  WVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKAC----SLHELK 81
            V DEP          + ++I S   P           +  A  + +          +L+
Sbjct: 41  AVADEPAPFIIEPPVIEPRAIVSEAPPPMAPAAAPMADISVAPELPRAQRIAAFDWAQLE 100

Query: 82  SLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQ 141
           + +     C LC     T+        + M+IG  P + ++  G+PF G+ G +LD ML+
Sbjct: 101 AAVSGCTACKLCERRTQTVFGVGDRQAEWMLIGEAPGEQEDRQGEPFVGQAGKLLDSMLR 160

Query: 142 SIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNF 200
           ++ + R   + I+ +    PPGNR+    E+ +C P + RQI L+ P++++ +G      
Sbjct: 161 AVGLSRETGVFIANVLKCRPPGNRDPEPDEVAMCDPYLKRQIALVKPRVIIVLGRFAAQS 220

Query: 201 FFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
                     +  GK   +      +P + T HP  L++    K   W  L   +K    
Sbjct: 221 LLQ-TQTPVGKLRGKVHEV----DGVPVVVTYHPAYLLRTLTDKARAWEDLCLARKVYTE 275


>gi|167816412|ref|ZP_02448092.1| putative phage-related DNA polymerase [Burkholderia pseudomallei
           91]
          Length = 262

 Score =  189 bits (479), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 49/211 (23%), Positives = 90/211 (42%), Gaps = 6/211 (2%)

Query: 51  QPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDL 110
           +P+             A + +       EL++ +     C LC    +T+     E  D 
Sbjct: 49  EPVHEPVLPDVAARPAATTPSVAELGWDELRARVADCERCRLCEKRTNTVFGVGDERADW 108

Query: 111 MIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNI 169
           M++G  P ++++  G+PF G+ G +LD ML+++ + R   ++I+ +    PPGNRN    
Sbjct: 109 MLVGEAPGENEDKQGEPFVGQAGKLLDNMLRALALKRGENVYIANVIKCRPPGNRNPEPD 168

Query: 170 EMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTL 229
           E+  C P + RQ+ L+ PK+++ +G          D        G+          +P +
Sbjct: 169 EVARCEPYLQRQVALVKPKLIVALGRFAAQTLLKTDGSIAS-MRGRVHQYE----GVPVI 223

Query: 230 ATVHPQELIQYPLIKKNTWHALITLKKALKN 260
            T HP  L++    K   W  L       ++
Sbjct: 224 VTYHPAYLLRSLQDKAKAWSDLCLANDTYRS 254


>gi|149926134|ref|ZP_01914396.1| Phage SPO1 DNA polymerase-related protein [Limnobacter sp. MED105]
 gi|149824952|gb|EDM84164.1| Phage SPO1 DNA polymerase-related protein [Limnobacter sp. MED105]
          Length = 233

 Score =  189 bits (479), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 55/190 (28%), Positives = 93/190 (48%), Gaps = 2/190 (1%)

Query: 68  DSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKP 127
           D +   + SL  L+ ++     C LC T   T+ A       LM++G  P   ++ +G+P
Sbjct: 41  DEMLPASLSLESLQEMVAVCKKCGLCETRKQTVFADGIPHAPLMVVGEGPGVDEDATGRP 100

Query: 128 FSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELIS 186
           F GK+G +LD+ML+++   R    +I+ +   HPPGNRN    E++ C P +++QI+   
Sbjct: 101 FVGKSGQLLDRMLKAVGASRTNNTYIANVVKCHPPGNRNPEQAEIDQCSPYLVQQIKASR 160

Query: 187 PKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKN 246
           P++LL +G        N       +  G    +      IP + T HP  L++    K+ 
Sbjct: 161 PQVLLLVGRFAIQTLLNTKKPV-GELRGTVHRVIVDGLDIPAVVTYHPAYLLRRSEEKQK 219

Query: 247 TWHALITLKK 256
            W  L+ LK+
Sbjct: 220 AWDDLLLLKQ 229


>gi|167903291|ref|ZP_02490496.1| phage SPO1 DNA polymerase domain protein [Burkholderia pseudomallei
           NCTC 13177]
          Length = 311

 Score =  189 bits (479), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 49/211 (23%), Positives = 90/211 (42%), Gaps = 6/211 (2%)

Query: 51  QPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDL 110
           +P+             A + +       EL++ +     C LC    +T+     E  D 
Sbjct: 98  EPVHEPVLPDVAARPAATTPSVAELGWDELRARVADCARCRLCEKRTNTVFGVGDERADW 157

Query: 111 MIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNI 169
           M++G  P ++++  G+PF G+ G +LD ML+++ + R   ++I+ +    PPGNRN    
Sbjct: 158 MLVGEAPGENEDKQGEPFVGQAGKLLDNMLRALALKRGENVYIANVIKCRPPGNRNPEPD 217

Query: 170 EMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTL 229
           E+  C P + RQ+ L+ PK+++ +G          D        G+          +P +
Sbjct: 218 EVARCEPYLQRQVALVKPKLIVALGRFAAQTLLKTDGSIAS-MRGRVHQYE----GVPVI 272

Query: 230 ATVHPQELIQYPLIKKNTWHALITLKKALKN 260
            T HP  L++    K   W  L       ++
Sbjct: 273 VTYHPAYLLRSLQDKAKAWSDLCLANDTYRS 303


>gi|220916695|ref|YP_002491999.1| phage SPO1 DNA polymerase-related protein [Anaeromyxobacter
           dehalogenans 2CP-1]
 gi|219954549|gb|ACL64933.1| phage SPO1 DNA polymerase-related protein [Anaeromyxobacter
           dehalogenans 2CP-1]
          Length = 205

 Score =  188 bits (478), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 53/202 (26%), Positives = 89/202 (44%), Gaps = 8/202 (3%)

Query: 60  HSPLVQQADSIAQK---ACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYT 116
               V  A  I +K   + +L +++  L     C L     + +        +L+ +G  
Sbjct: 2   APAPVAGAHRIGEKGCGSAALVQVRDALGDCRRCKLAGGRTTLVFGVGNPQAELVFVGEG 61

Query: 117 PSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRP 176
           P   ++  G+PF GK G +L KM+Q++   R Q++I+ +    PPGNRN    E+E C P
Sbjct: 62  PGADEDREGEPFVGKAGQLLTKMIQAMGYQREQVYIANVVKCRPPGNRNPEPDEIEACEP 121

Query: 177 IIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQE 236
            +  Q+  I P++++ +G          D     +  G+W         I  + T HP  
Sbjct: 122 FLRAQLAAIRPRVVVALGKFAAQTLL-RDTTPITRLRGRWREYE----GIRLMPTFHPAY 176

Query: 237 LIQYPLIKKNTWHALITLKKAL 258
           L++ P  KK  W  L  + K L
Sbjct: 177 LLRSPEEKKKAWEDLQLVMKEL 198


>gi|209518016|ref|ZP_03266847.1| phage SPO1 DNA polymerase-related protein [Burkholderia sp. H160]
 gi|209501520|gb|EEA01545.1| phage SPO1 DNA polymerase-related protein [Burkholderia sp. H160]
          Length = 292

 Score =  188 bits (478), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 56/245 (22%), Positives = 97/245 (39%), Gaps = 22/245 (8%)

Query: 29  DEPNNEATYESQRKEKSIDSAIQPITNIRH-----------IHSPLVQQADSIAQKAC-- 75
           DEP         + +   D +  P  ++               +P   +A   A      
Sbjct: 39  DEPVARPEASQPQPQSQPDRSAPPTLDVPPDDDFAWFDDPGAPAPEPVEARRDAPALPAI 98

Query: 76  ---SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKT 132
                  L   +     C LC    +T+        D M+IG  P ++++  G+PF G+ 
Sbjct: 99  HTLDWDALAERVAGCEACRLCEKRTNTVFGVGDREADWMLIGEAPGENEDRQGEPFVGQA 158

Query: 133 GNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILL 191
           G +LD ML+S+ + R T ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++
Sbjct: 159 GKLLDNMLRSLALARGTNVYIANVIKCRPPGNRNPQPDEVARCEPYLQRQVSLVKPKLIV 218

Query: 192 FIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
            +G          +A       G+          +P + T HP  L++    K   W  L
Sbjct: 219 ALGRFAAQSLLKTEA-SISSLRGRVHTYE----GVPVIVTYHPAYLLRSLPDKAKAWADL 273

Query: 252 ITLKK 256
              ++
Sbjct: 274 CLARE 278


>gi|42527991|ref|NP_973089.1| DNA polymerase domain-containing protein [Treponema denticola ATCC
           35405]
 gi|41819036|gb|AAS13008.1| DNA polymerase domain protein [Treponema denticola ATCC 35405]
          Length = 264

 Score =  188 bits (478), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 65/266 (24%), Positives = 107/266 (40%), Gaps = 18/266 (6%)

Query: 7   LSQEQILTIALFYADSGVY---WVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPL 63
           +  E+  T+  F+  +  Y   +  DE   +       +    D+A+        +  PL
Sbjct: 1   MKAEEKKTLYTFFRTASEYLSGFKTDEEYPDFADTVLSETAIPDTALPETDEAAGLTIPL 60

Query: 64  VQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQ-------TEGQDLMIIGYT 116
                       SL ++ + + S   C LC    +T+               ++M+IG  
Sbjct: 61  SDTDSESG--FESLEKVYAQIASCKACRLCERRHNTVAGEGPCEFSNFDNKIEVMVIGEG 118

Query: 117 PSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICR 175
           P   ++  G+PF GK G +LDKML +IE+ R    +I+ +    PP NR+    E   CR
Sbjct: 119 PGADEDAQGRPFVGKAGQLLDKMLAAIELYRTHNCYITNVVKCRPPNNRDPLPDETAACR 178

Query: 176 PIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQ 235
             +  QI LI PK +L +G            +   +  GK+         IP +AT HP 
Sbjct: 179 NYLNAQIALIRPKAILVVGRVALQNLL-ETQEGIGKMHGKFFEYQN----IPLMATYHPS 233

Query: 236 ELIQYPLIKKNTWHALITLKKALKNL 261
            L++   +K+  W  L   +  L  L
Sbjct: 234 ALLRDVNLKRPAWEDLKLFRSRLNEL 259


>gi|157804236|ref|YP_001492785.1| N-terminus of bacteriophage-type DNA polymerase [Rickettsia
           canadensis str. McKiel]
 gi|157785499|gb|ABV74000.1| N-terminus of bacteriophage-type DNA polymerase [Rickettsia
           canadensis str. McKiel]
          Length = 262

 Score =  188 bits (478), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 66/253 (26%), Positives = 121/253 (47%), Gaps = 9/253 (3%)

Query: 16  ALFYADSGV-YWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSP----LVQQADSI 70
             + +  GV Y+   +P      + Q   +      + I  I  + +      +  A S+
Sbjct: 5   LKWLSAIGVEYYCSTQPQKLNFDKPQENNQINPMPRKTIDKILEVDTDKMHTNISLARSL 64

Query: 71  AQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSG 130
           A K  ++ EL+  L +F+ C L   S +T+     +   +M+IG  P  ++++ G PF G
Sbjct: 65  ADKVNNIEELRESLLNFNGCKLKKFSTNTVFGDGNQKAQVMLIGEAPGSTEDLKGIPFCG 124

Query: 131 KTGNMLDKMLQSIEIMRTQI-HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKI 189
           ++GN+LD ML SI I R    +I+    W PP NR  +  E++ICRP + + I LI+PK+
Sbjct: 125 ESGNLLDNMLHSIGISRKNNAYITNTVFWRPPANRQPTLEEVDICRPFVEKHIALINPKL 184

Query: 190 LLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLAT--VHPQELIQYPLIKKNT 247
           ++ +G+               +   ++      +   P   T   HP  L+++P+ K+ +
Sbjct: 185 IILVGSTAATSLLG-KNSGITKIRQEYYFYTNKYLSSPIQTTTIFHPAYLLRHPMQKRTS 243

Query: 248 WHALITLKKALKN 260
           W+ L+ +K+ L N
Sbjct: 244 WYDLLKIKEYLVN 256


>gi|17546088|ref|NP_519490.1| DNA polymerase-related protein, bacteriophage-type [Ralstonia
           solanacearum GMI1000]
 gi|17428384|emb|CAD15071.1| putative uracil-dna glycosylase-related protein [Ralstonia
           solanacearum GMI1000]
          Length = 292

 Score =  188 bits (478), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 50/204 (24%), Positives = 85/204 (41%), Gaps = 6/204 (2%)

Query: 58  HIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTP 117
              S       +    A    +L++ +     C LC     T+        D M+IG  P
Sbjct: 90  PTDSTDPVAPRAQRIAAFDWAQLEAAVSGCTACKLCERRTQTVFGVGDRQADWMLIGEAP 149

Query: 118 SDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRP 176
            + ++  G+PF G+ G +LD ML++I + R   + I+ +    PPGNR+    E+ +C P
Sbjct: 150 GEQEDRQGEPFVGQAGKLLDSMLRAIGLSRETGVFIANVLKCRPPGNRDPEPDEVAMCDP 209

Query: 177 IIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQE 236
            + RQI LI P++++ +G                +  GK   +      +P + T HP  
Sbjct: 210 YLKRQIALIKPRVIVVLGRFAAQSLLQ-TQTPVGKLRGKVHEV----DGVPVVVTYHPAY 264

Query: 237 LIQYPLIKKNTWHALITLKKALKN 260
           L++    K   W  L   +K    
Sbjct: 265 LLRTLTDKARAWEDLCLARKVYTE 288


>gi|189499343|ref|YP_001958813.1| phage SPO1 DNA polymerase-related protein [Chlorobium
           phaeobacteroides BS1]
 gi|189494784|gb|ACE03332.1| phage SPO1 DNA polymerase-related protein [Chlorobium
           phaeobacteroides BS1]
          Length = 208

 Score =  188 bits (478), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 50/203 (24%), Positives = 86/203 (42%), Gaps = 5/203 (2%)

Query: 58  HIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTP 117
             +S    Q +S A    +L++L    ++   C L  T  + +         +++IG  P
Sbjct: 7   EENSSANAQKESAAGAFRNLNDLYEQSKNCRKCRLADTRTNFVFGEGNPEAKIVVIGEAP 66

Query: 118 SDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPI 177
              ++  G+PF G++G +LDK+L++I   R  + I  I    PP NRN    E+  C P 
Sbjct: 67  GAEEDAQGRPFVGRSGKLLDKILEAIGFSRDDVFICNIIKCRPPANRNPLADEITCCMPW 126

Query: 178 IMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQEL 237
           +  Q+ L+ P +LL +G    N   +N         G         +    + T HP  L
Sbjct: 127 LNAQLALLDPAVLLLLGKVAANTLLDNKQSM-----GNLRGKIIRWNGYDVIVTYHPAAL 181

Query: 238 IQYPLIKKNTWHALITLKKALKN 260
           ++ P  K+  W  +  L+     
Sbjct: 182 LRNPNWKRQCWDDVRMLRSHYDK 204


>gi|148284759|ref|YP_001248849.1| Uracil-DNA glycosylase [Orientia tsutsugamushi str. Boryong]
 gi|146740198|emb|CAM80476.1| Uracil-DNA glycosylase [Orientia tsutsugamushi str. Boryong]
          Length = 268

 Score =  188 bits (478), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 67/252 (26%), Positives = 124/252 (49%), Gaps = 9/252 (3%)

Query: 15  IALFYADSGVY--WVFD--EPNNEATYESQRKEKSIDSAIQPI-TNIRHIHSPLVQQADS 69
              +Y+  G+    ++D     ++    S  K K++         N ++ H  ++  +  
Sbjct: 11  ALKWYSYMGIDDNIIYDGTASFDQCNSISISKAKTLIDQNSAGFNNNQNTHLAVLSDSRQ 70

Query: 70  IAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFS 129
           +A    +L +LKS + SF  C L  T+L+T+         +M+IG  P  +++  G PF 
Sbjct: 71  LADSVHTLEDLKSSVTSFDGCLLKKTALNTVFGDGIPSAPIMLIGEAPGQNEDKHGIPFC 130

Query: 130 GKTGNMLDKMLQSIEIMRTQI-HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPK 188
           G++G +LD MLQSI + RT+  +I+    W PP NR  ++ E+ ICRP + + I +I+PK
Sbjct: 131 GESGKLLDNMLQSINLSRTKNVYITNTVFWRPPANRRPTSDELVICRPFVEKHIAIINPK 190

Query: 189 ILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSI--IPTLATVHPQELIQYPLIKKN 246
           +++ +G+         D  K  +   ++      +    IP  A  HP  +++ PL KK 
Sbjct: 191 LIILVGSTAATSMLG-DHVKISKIRQEYFLYKNCYLTFSIPITAIFHPAYMLRQPLQKKA 249

Query: 247 TWHALITLKKAL 258
            W  L+ +++ +
Sbjct: 250 CWFDLLKIQQFI 261


>gi|171057063|ref|YP_001789412.1| phage SPO1 DNA polymerase-like protein [Leptothrix cholodnii SP-6]
 gi|170774508|gb|ACB32647.1| phage SPO1 DNA polymerase-related protein [Leptothrix cholodnii
           SP-6]
          Length = 294

 Score =  188 bits (478), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 57/224 (25%), Positives = 104/224 (46%), Gaps = 11/224 (4%)

Query: 43  EKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICA 102
              +D A             L+Q A + A  A    EL++++ +   C LC +   T+  
Sbjct: 74  RPRVDPAPAAPAAPLARPGGLIQAAPAGAVSALDWPELQAVVEACRACGLCESRRQTVFG 133

Query: 103 TQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR------TQIHISMIS 156
                   M++G  P + +++ G+PF GK G +LD ML+++ + R       Q++I+ + 
Sbjct: 134 VGHHQAHWMLVGEAPGEQEDLQGEPFVGKAGQLLDNMLRAVGLTREQAEPARQVYIANVL 193

Query: 157 PWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKW 216
              PPGNRN    E++ C P + RQ+EL+ P+++L +G           ++   +  GK 
Sbjct: 194 KCRPPGNRNPDPQEVQRCEPFLQRQVELVRPRLILAMGRFAVQSLLK-TSEPIGRLRGKS 252

Query: 217 SNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
            +       +P + T HP  L++ PL K   W  L   ++ ++ 
Sbjct: 253 HHY----HGVPVVVTYHPAYLLRNPLDKARAWEDLCLARELIQA 292


>gi|167720198|ref|ZP_02403434.1| putative phage-related DNA polymerase [Burkholderia pseudomallei
           DM98]
          Length = 237

 Score =  188 bits (477), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 49/211 (23%), Positives = 90/211 (42%), Gaps = 6/211 (2%)

Query: 51  QPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDL 110
           +P+             A + +       EL++ +     C LC    +T+     E  D 
Sbjct: 24  EPVHEPALPDVAARPAATTPSVAELGWDELRARVADCERCRLCEKRTNTVFGVGDERADW 83

Query: 111 MIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNI 169
           M++G  P ++++  G+PF G+ G +LD ML+++ + R   ++I+ +    PPGNRN    
Sbjct: 84  MLVGEAPGENEDKQGEPFVGQAGKLLDNMLRALALKRGENVYIANVIKCRPPGNRNPEPD 143

Query: 170 EMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTL 229
           E+  C P + RQ+ L+ PK+++ +G          D        G+          +P +
Sbjct: 144 EVARCEPYLQRQVALVKPKLIVALGRFAAQTLLKTDGSIAS-MRGRVHQYE----GVPVI 198

Query: 230 ATVHPQELIQYPLIKKNTWHALITLKKALKN 260
            T HP  L++    K   W  L       ++
Sbjct: 199 VTYHPAYLLRSLQDKAKAWSDLCLANDTYRS 229


>gi|114319713|ref|YP_741396.1| phage SPO1 DNA polymerase-related protein [Alkalilimnicola
           ehrlichii MLHE-1]
 gi|114226107|gb|ABI55906.1| phage SPO1 DNA polymerase-related protein [Alkalilimnicola
           ehrlichii MLHE-1]
          Length = 264

 Score =  188 bits (477), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 57/254 (22%), Positives = 104/254 (40%), Gaps = 15/254 (5%)

Query: 19  YADSGVYWVFDEP---NNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKAC 75
               GV      P      A       +   D A +P      + +       + A +A 
Sbjct: 14  LRQMGVDLYVPRPGAGPQVADAVPAGPDPVRDGAPEPGPAPADVVTAPPAAEPAAASEAD 73

Query: 76  ---------SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGK 126
                    +   L+  +     C LC    +T+    +   DL+++G  P   ++  G+
Sbjct: 74  PTSGDVARLNWAALEDRVAGCRLCGLCEGRRNTVFGVGSRQADLVLVGEGPGAEEDKRGE 133

Query: 127 PFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELIS 186
           PF G+ G +LD+ML +I + R++++I  +    PP NR+    E+  CRP + RQ+ L+ 
Sbjct: 134 PFVGQAGRLLDRMLAAIGLDRSRVYICNVVKCRPPRNRDPRPEEVAACRPYLERQLTLLE 193

Query: 187 PKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKN 246
           P++++ +G  + +   N       +  G           +P LAT HP  L++ P  K  
Sbjct: 194 PRLIVALGRVSAHQLLNVTTPL-GRLRGGLHRYAPVD--VPLLATYHPAYLLRNPADKAR 250

Query: 247 TWHALITLKKALKN 260
            W  L  +++ L  
Sbjct: 251 AWEDLKRIRRILAE 264


>gi|300113321|ref|YP_003759896.1| phage SPO1 DNA polymerase-like protein [Nitrosococcus watsonii
           C-113]
 gi|299539258|gb|ADJ27575.1| phage SPO1 DNA polymerase-related protein [Nitrosococcus watsonii
           C-113]
          Length = 231

 Score =  188 bits (477), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 50/220 (22%), Positives = 93/220 (42%), Gaps = 7/220 (3%)

Query: 41  RKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTI 100
           ++ +   +   P+        P+   A  +++      EL   +     C L  +   T+
Sbjct: 18  QQRQPTSTGKTPLVETGEEPIPVAPSAGVMSE----WEELAVQVAGCKACSLHRSRTQTV 73

Query: 101 CATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHP 160
                +    +I+G  P   ++  G+PF G+ G +L+ ML+++ + R Q++I+ I    P
Sbjct: 74  FGVGDQAAKWLIVGEAPGAEEDRQGEPFVGRAGQLLNAMLEAVGLQRGQVYIANILKCRP 133

Query: 161 PGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLC 220
           P NR+    E+  C   + RQI L+ P+I+L +G         +      +  G      
Sbjct: 134 PNNRDPLPEEVAHCESYLRRQIALLRPRIILAVGRVAGQNLLKSSLPL-GRLRGSVHQY- 191

Query: 221 TPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
            P + IP + T HP  L++ P  K+  W  L    K  + 
Sbjct: 192 -PETAIPLVVTYHPAYLLRAPREKRRAWQDLRLALKVYRE 230


>gi|323701469|ref|ZP_08113142.1| phage SPO1 DNA polymerase-related protein [Desulfotomaculum
           nigrificans DSM 574]
 gi|323533478|gb|EGB23344.1| phage SPO1 DNA polymerase-related protein [Desulfotomaculum
           nigrificans DSM 574]
          Length = 184

 Score =  188 bits (476), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 48/186 (25%), Positives = 88/186 (47%), Gaps = 4/186 (2%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           SL +L   ++    C L +   + +         LM+IG  P   ++  G+PF G+ G +
Sbjct: 2   SLEQLALDIQGCTRCGLAAGRTNIVFGDGNPSGKLMLIGEGPGKDEDEQGRPFVGRAGQL 61

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           LD++L +I + R  ++I+ I    PP NR  +  E   C P + RQIELI P+I++ +G+
Sbjct: 62  LDRILAAINLTRQDVYIANIVKCRPPNNRVPTRAEAVACLPYLYRQIELIKPRIIVLLGS 121

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
                    +A +  +  G+W    +    I  + T HP  +++ P  ++  W     ++
Sbjct: 122 TALQNLIGPEA-RITKMRGQWLESKS---GIKIMPTFHPAAVLRDPNKRRPVWEDFQKIQ 177

Query: 256 KALKNL 261
           +    L
Sbjct: 178 EEYLRL 183


>gi|288940110|ref|YP_003442350.1| phage SPO1 DNA polymerase-like protein [Allochromatium vinosum DSM
           180]
 gi|288895482|gb|ADC61318.1| phage SPO1 DNA polymerase-related protein [Allochromatium vinosum
           DSM 180]
          Length = 331

 Score =  188 bits (476), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 59/238 (24%), Positives = 97/238 (40%), Gaps = 11/238 (4%)

Query: 24  VYWVFDEPNNEATY---ESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHEL 80
                 EP +       E+     S+      + +     +  V   + +         L
Sbjct: 102 ADAPSAEPESWPFPDWDETPEYSPSLMDEWDAMGHPPASEAEAVNPIERM-----DWDAL 156

Query: 81  KSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKML 140
            + +R    C L  T   T+        DLMIIG  P   ++  G+PF G+ G +L +ML
Sbjct: 157 DAAVRGCRACRLWETRTKTVFGVGDRRADLMIIGEAPGADEDRQGEPFVGRAGQLLTRML 216

Query: 141 QSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNF 200
            +I   R Q++I+ +    PPGNR+    E   C+  + RQ+ LI P+++L +G  +   
Sbjct: 217 AAIGFSREQVYIANVLKCRPPGNRDPKPDEALACQAYLHRQVALIEPRVILSVGRISAQQ 276

Query: 201 FFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
               D     +  G+W +    H  IP   T HP  L++ P  K   W  L  + + L
Sbjct: 277 LLKTDTPV-GRLRGQWFDYGPAH--IPLRVTYHPAYLLRSPEQKAKAWDDLTEVWRRL 331


>gi|67639488|ref|ZP_00438341.1| uracil-DNA glycosylase, family 4 [Burkholderia mallei GB8 horse 4]
 gi|238520036|gb|EEP83500.1| uracil-DNA glycosylase, family 4 [Burkholderia mallei GB8 horse 4]
          Length = 252

 Score =  188 bits (476), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 49/211 (23%), Positives = 90/211 (42%), Gaps = 6/211 (2%)

Query: 51  QPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDL 110
           +P+             A + +       EL++ +     C LC    +T+     E  D 
Sbjct: 39  EPVHEPALPDVAARPAATTPSVAELGWDELRARVADCARCRLCEKRTNTVFGVGDEHADW 98

Query: 111 MIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNI 169
           M++G  P ++++  G+PF G+ G +LD ML+++ + R   ++I+ +    PPGNRN    
Sbjct: 99  MLVGEAPGENEDKQGEPFVGQAGKLLDNMLRALALKRGENVYIANVIKCRPPGNRNPEPD 158

Query: 170 EMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTL 229
           E+  C P + RQ+ L+ PK+++ +G          D        G+          +P +
Sbjct: 159 EVARCEPYLQRQVALVKPKLIVALGRFAAQTLLKTDGSIAS-MRGRVHQYE----GVPVI 213

Query: 230 ATVHPQELIQYPLIKKNTWHALITLKKALKN 260
            T HP  L++    K   W  L       ++
Sbjct: 214 VTYHPAYLLRSLQDKAKAWSDLCLANDTYRS 244


>gi|33594425|ref|NP_882069.1| bacteriophage-related DNA polymerase [Bordetella pertussis Tohama
           I]
 gi|33564500|emb|CAE43815.1| bacteriophage-related DNA polymerase [Bordetella pertussis Tohama
           I]
 gi|332383836|gb|AEE68683.1| DNA polymerase [Bordetella pertussis CS]
          Length = 298

 Score =  188 bits (476), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 56/223 (25%), Positives = 95/223 (42%), Gaps = 3/223 (1%)

Query: 36  TYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCST 95
                R  +   +A Q             + A +       L +L+ L++    C LC  
Sbjct: 76  AASPTRAPRPPVAAPQRAEPAAEADGQAARAAVAARAAGADLGQLQQLVQDCTACGLCQG 135

Query: 96  SLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQI-HISM 154
               +     +    M++G  P + ++  G PF G++G +LD MLQS+ + R +   I+ 
Sbjct: 136 RRHAVFGMGAQPARWMVVGEAPGEQEDRQGLPFVGRSGKLLDAMLQSVGMSRERDVFIAN 195

Query: 155 ISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLG 214
           +    PPGNRN    E+  C P + RQI L++P+ +L +G        N +A       G
Sbjct: 196 VIKCRPPGNRNPKPEEIAACSPYLRRQIALLNPERILVLGRFAAQTLLNTEA-TIGNLRG 254

Query: 215 KWSNLCT-PHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
           +  +L T     IP + + HP  L++ P  K   W  L+   +
Sbjct: 255 RVHSLQTDEGRSIPVVVSYHPAYLLRSPAEKARAWQDLLLAAR 297


>gi|115352126|ref|YP_773965.1| phage SPO1 DNA polymerase--like protein [Burkholderia ambifaria
           AMMD]
 gi|115282114|gb|ABI87631.1| phage SPO1 DNA polymerase-related protein [Burkholderia ambifaria
           AMMD]
          Length = 367

 Score =  188 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 56/237 (23%), Positives = 92/237 (38%), Gaps = 6/237 (2%)

Query: 25  YWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLL 84
                EP   A  +        D A    T       P   +  +          L + +
Sbjct: 124 DRASAEPAPFAAADDMPPATEDDFAWFDATPPGDPLPPDEARPAATPVAMLDWDTLAARV 183

Query: 85  RSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIE 144
                C LC    +T+        D M+IG  P ++++  G+PF G+ G +LD MLQS+ 
Sbjct: 184 ADCTSCRLCEKRTNTVFGVGDREADWMLIGEAPGENEDKQGEPFVGQAGKLLDNMLQSLA 243

Query: 145 IMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFN 203
           + R   ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G         
Sbjct: 244 LKRGENVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVALVKPKLIVALGRFAAQTLLK 303

Query: 204 NDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
            DA       G+          +P + T HP  L++    K   W  L   +   + 
Sbjct: 304 TDASIAS-LRGRVHTYE----GVPVIVTYHPAYLLRSLQDKSKAWADLCLARDTFQQ 355


>gi|77165973|ref|YP_344498.1| Phage SPO1 DNA polymerase-related protein [Nitrosococcus oceani
           ATCC 19707]
 gi|254436357|ref|ZP_05049863.1| uracil-DNA glycosylase, family 4 [Nitrosococcus oceani AFC27]
 gi|76884287|gb|ABA58968.1| Phage SPO1 DNA polymerase-related protein [Nitrosococcus oceani
           ATCC 19707]
 gi|207088047|gb|EDZ65320.1| uracil-DNA glycosylase, family 4 [Nitrosococcus oceani AFC27]
          Length = 231

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 53/220 (24%), Positives = 94/220 (42%), Gaps = 7/220 (3%)

Query: 41  RKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTI 100
           ++ +   +  +P+        PL   A+     A    EL   + S   C L      T+
Sbjct: 18  QQRQPTSTGKKPLVETGEELIPLAPSAEV----ASEWEELAVQVASCTACLLHCGRTQTV 73

Query: 101 CATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHP 160
                +    +I+G  P   ++  G+PF G+ G +L+ ML+++ + R Q++I+ I    P
Sbjct: 74  FGVGDQAAKWLIVGEAPGVEEDRQGEPFVGRAGQLLNAMLEAVGLQRGQVYIANILKCRP 133

Query: 161 PGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLC 220
           P NR+    E+  C P + RQ+ L+ P+I+L +G         +      +  G      
Sbjct: 134 PNNRDPLPEEVAHCEPYLRRQVALLRPRIILAVGRVAGQNLLKSSLPL-GRLRGSVHQY- 191

Query: 221 TPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
            P + IP + T HP  L++ P  K+  W  L    K  + 
Sbjct: 192 -PETTIPLVVTYHPAYLLRAPREKRRAWQDLQLAHKVYRE 230


>gi|124515689|gb|EAY57198.1| Uracil-DNA glycosylase, family 4 [Leptospirillum rubarum]
          Length = 243

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 47/185 (25%), Positives = 84/185 (45%), Gaps = 2/185 (1%)

Query: 74  ACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTG 133
              +  L+  +R+   C L  T    +         LM +G  P   ++ +G+PF G+ G
Sbjct: 50  PEDIDGLERFVRTCQICSLSETRNQVVFGEGRGTSGLMFVGEGPGADEDRTGRPFVGRAG 109

Query: 134 NMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFI 193
            +L KM+Q++ + R +++I+      PPGNR  S  E   C P +  QI L+ PK ++ +
Sbjct: 110 ELLTKMIQAMGLSREEVYIANTVKCRPPGNRVPSPEERNACFPFLEAQIRLLKPKYMILL 169

Query: 194 GNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALIT 253
           G           ++   +  G+   +   +  I  + T HP  L++ P  KK+ W  L T
Sbjct: 170 GQTATQVILK-QSEGITRIRGRCFEMP-EYPGIKMMPTYHPAYLLRNPSAKKDVWSDLQT 227

Query: 254 LKKAL 258
           +   +
Sbjct: 228 VMGWM 232


>gi|167919542|ref|ZP_02506633.1| phage SPO1 DNA polymerase domain protein [Burkholderia pseudomallei
           BCC215]
          Length = 265

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 49/211 (23%), Positives = 90/211 (42%), Gaps = 6/211 (2%)

Query: 51  QPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDL 110
           +P+             A + +       EL++ +     C LC    +T+     E  D 
Sbjct: 52  EPVHEPVLPDVAARPAATTPSVAELGWDELRARVADCARCRLCEKRTNTVFGVGDEHADW 111

Query: 111 MIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNI 169
           M++G  P ++++  G+PF G+ G +LD ML+++ + R   ++I+ +    PPGNRN    
Sbjct: 112 MLVGEAPGENEDKQGEPFVGQAGKLLDNMLRALALKRGENVYIANVIKCRPPGNRNPEPD 171

Query: 170 EMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTL 229
           E+  C P + RQ+ L+ PK+++ +G          D        G+          +P +
Sbjct: 172 EVARCEPYLQRQVALVKPKLIVALGRFAAQTLLKTDGSIAS-MRGRVHQYE----GVPVI 226

Query: 230 ATVHPQELIQYPLIKKNTWHALITLKKALKN 260
            T HP  L++    K   W  L       ++
Sbjct: 227 VTYHPAYLLRSLQDKAKAWSDLCLANDTYRS 257


>gi|167739201|ref|ZP_02411975.1| putative phage-related DNA polymerase [Burkholderia pseudomallei
           14]
          Length = 259

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 49/211 (23%), Positives = 90/211 (42%), Gaps = 6/211 (2%)

Query: 51  QPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDL 110
           +P+             A + +       EL++ +     C LC    +T+     E  D 
Sbjct: 46  EPVHEPVLPDVAARPAATTPSVAELGWDELRARVADCERCRLCEKRTNTVFGVGDEHADW 105

Query: 111 MIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNI 169
           M++G  P ++++  G+PF G+ G +LD ML+++ + R   ++I+ +    PPGNRN    
Sbjct: 106 MLVGEAPGENEDKQGEPFVGQAGKLLDNMLRALALKRGENVYIANVIKCRPPGNRNPEPD 165

Query: 170 EMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTL 229
           E+  C P + RQ+ L+ PK+++ +G          D        G+          +P +
Sbjct: 166 EVARCEPYLQRQVALVKPKLIVALGRFAAQTLLKTDGSIAS-MRGRVHQYE----GVPVI 220

Query: 230 ATVHPQELIQYPLIKKNTWHALITLKKALKN 260
            T HP  L++    K   W  L       ++
Sbjct: 221 VTYHPAYLLRSLQDKAKAWSDLCLANDTYRS 251


>gi|292490788|ref|YP_003526227.1| phage SPO1 DNA polymerase-related protein [Nitrosococcus halophilus
           Nc4]
 gi|291579383|gb|ADE13840.1| phage SPO1 DNA polymerase-related protein [Nitrosococcus halophilus
           Nc4]
          Length = 231

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 53/223 (23%), Positives = 92/223 (41%), Gaps = 9/223 (4%)

Query: 39  SQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLS 98
            QR+  + D A         +   +  +       A    EL + +     C L  +   
Sbjct: 18  RQRQSANADRAPAVEVGGVPLGENMPTEV------APGWEELAARVAGCTACSLHCSRTQ 71

Query: 99  TICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPW 158
           T+          +I+G  P   ++  G+PF G+ G +L+ ML+++ + R Q++I+ I   
Sbjct: 72  TVFGVGDREAKWLIVGEAPGADEDRQGEPFVGRAGQLLNAMLEALGLQRGQVYIANILKC 131

Query: 159 HPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSN 218
            PP NR+    E+  C P +  Q+ L+ P+I+L +G           A    +  G    
Sbjct: 132 RPPKNRDPLPEEVASCEPYLRHQMALLQPRIILAVGRVAGQNLLKTSAPL-GRLRGIVHK 190

Query: 219 LCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
              P + IP + T HP  L++ P  K+  W  L    K  + L
Sbjct: 191 Y--PDTTIPLVVTYHPAYLLRSPREKRRAWQDLRLALKVYREL 231


>gi|167824793|ref|ZP_02456264.1| phage SPO1 DNA polymerase domain protein [Burkholderia pseudomallei
           9]
          Length = 256

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 49/211 (23%), Positives = 90/211 (42%), Gaps = 6/211 (2%)

Query: 51  QPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDL 110
           +P+             A + +       EL++ +     C LC    +T+     E  D 
Sbjct: 43  EPVHEPVLPDVAARPAATTPSVAELGWDELRARVADCARCRLCEKRTNTVFGVGDEHADW 102

Query: 111 MIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNI 169
           M++G  P ++++  G+PF G+ G +LD ML+++ + R   ++I+ +    PPGNRN    
Sbjct: 103 MLVGEAPGENEDKQGEPFVGQAGKLLDNMLRALALKRGENVYIANVIKCRPPGNRNPEPD 162

Query: 170 EMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTL 229
           E+  C P + RQ+ L+ PK+++ +G          D        G+          +P +
Sbjct: 163 EVARCEPYLQRQVALVKPKLIVALGRFAAQTLLKTDGSIAS-MRGRVHQYE----GVPVI 217

Query: 230 ATVHPQELIQYPLIKKNTWHALITLKKALKN 260
            T HP  L++    K   W  L       ++
Sbjct: 218 VTYHPAYLLRSLQDKAKAWSDLCLANDTYRS 248


>gi|298505240|gb|ADI83963.1| uracil-DNA glycosylase [Geobacter sulfurreducens KN400]
          Length = 243

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 42/188 (22%), Positives = 90/188 (47%), Gaps = 5/188 (2%)

Query: 71  AQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSG 130
                +L +++  +   H C L +   + +         LMIIG  P   +++ G+PF G
Sbjct: 50  GDARETLDDIRREMGGCHRCALGAGRTNLVFGVGNPAARLMIIGEAPGRDEDLRGEPFVG 109

Query: 131 KTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKIL 190
           + G +L K+++++   R  ++I  +    PP NR+ ++ E+E C   ++RQ++ ++P+ +
Sbjct: 110 EAGQLLTKIIEAMGFAREDVYICNVLKCRPPHNRDPASAEIEACSSFMLRQVKAVAPEAI 169

Query: 191 LFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHA 250
           L +G            +   +  G++ +       IP + T+HP  L++ P  K++ W  
Sbjct: 170 LALGTFAAQTILGTK-EPISRLRGRFHDY----HGIPLMPTLHPAFLLRNPERKRDVWDD 224

Query: 251 LITLKKAL 258
           +  +   L
Sbjct: 225 VRQVMGLL 232


>gi|56751576|ref|YP_172277.1| bacteriophage-type DNA polymerase [Synechococcus elongatus PCC
           6301]
 gi|81301352|ref|YP_401560.1| phage SPO1 DNA polymerase-related protein [Synechococcus elongatus
           PCC 7942]
 gi|56686535|dbj|BAD79757.1| DNA polymerase bacteriophage-type [Synechococcus elongatus PCC
           6301]
 gi|81170233|gb|ABB58573.1| phage SPO1 DNA polymerase-related protein [Synechococcus elongatus
           PCC 7942]
          Length = 235

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 52/224 (23%), Positives = 87/224 (38%), Gaps = 11/224 (4%)

Query: 44  KSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICAT 103
            + +        +     P        A    ++ EL     +   C L  T    +   
Sbjct: 13  AAAEPVADAPATVDRAAIPTSASIPIPAGTFSTVEELLEPCNACQRCGLGQTRTHAVVGR 72

Query: 104 QTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIM-RTQIHISMISPWHPPG 162
                 LM+IG  P +++++ G PF GK G +LD++L ++ +     ++I+ I    PPG
Sbjct: 73  GNPQAKLMVIGEGPGENEDLQGLPFVGKAGQLLDRILAAVSLDSNRDVYIANIVKCRPPG 132

Query: 163 NRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTP 222
           NR  +  EM  C P +  Q+ L+ PKI+L  G          D +   +  G W      
Sbjct: 133 NRKPTPEEMAACVPYLQEQVRLVQPKIILLAGATAVQGLLG-DKRGITKIRGLWMEWQ-- 189

Query: 223 HSIIPTLATVHPQELIQYPLI-----KKNTWHALITLKKALKNL 261
              I  +   HP  L++ P       K   W  +  +K+ L  L
Sbjct: 190 --GIACMPVFHPAYLLRNPSKEQGSPKWLMWQDIQEVKRRLDEL 231


>gi|167894904|ref|ZP_02482306.1| phage SPO1 DNA polymerase domain protein [Burkholderia pseudomallei
           7894]
          Length = 254

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 49/211 (23%), Positives = 90/211 (42%), Gaps = 6/211 (2%)

Query: 51  QPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDL 110
           +P+             A + +       EL++ +     C LC    +T+     E  D 
Sbjct: 41  EPVHEPVLPDVAARPAATTPSVAELGWDELRARVADCARCRLCEKRTNTVFGVGDEHADW 100

Query: 111 MIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNI 169
           M++G  P ++++  G+PF G+ G +LD ML+++ + R   ++I+ +    PPGNRN    
Sbjct: 101 MLVGEAPGENEDKQGEPFVGQAGKLLDNMLRALALKRGENVYIANVIKCRPPGNRNPEPD 160

Query: 170 EMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTL 229
           E+  C P + RQ+ L+ PK+++ +G          D        G+          +P +
Sbjct: 161 EVARCEPYLQRQVALVKPKLIVALGRFAAQTLLKTDGSIAS-MRGRVHQYE----GVPVI 215

Query: 230 ATVHPQELIQYPLIKKNTWHALITLKKALKN 260
            T HP  L++    K   W  L       ++
Sbjct: 216 VTYHPAYLLRSLQDKAKAWSDLCLANDTYRS 246


>gi|157826321|ref|YP_001494041.1| N-terminus of bacteriophage-type DNA polymerase [Rickettsia akari
           str. Hartford]
 gi|157800279|gb|ABV75533.1| N-terminus of bacteriophage-type DNA polymerase [Rickettsia akari
           str. Hartford]
          Length = 329

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 58/202 (28%), Positives = 103/202 (50%), Gaps = 4/202 (1%)

Query: 62  PLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSD 121
             +  A S+A KA ++ ELK  L +F+ C L   + +T+         +M+IG  P  ++
Sbjct: 123 DNITLARSLADKANNIAELKESLLNFNGCALKKFATNTVFGDGNLEAKIMLIGEAPGITE 182

Query: 122 NISGKPFSGKTGNMLDKMLQSIEIMRTQI-HISMISPWHPPGNRNLSNIEMEICRPIIMR 180
           ++ G PF G++GN+LD ML +I I R    +I+    W PP NR  +  E++IC+P + +
Sbjct: 183 DLKGIPFCGESGNLLDNMLHAIGISRKNNAYITNTVFWRPPANRQPTLEEVDICKPFVEK 242

Query: 181 QIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPT--LATVHPQELI 238
            I LISP +++ +G+               +   ++      +   P    A  HP  L+
Sbjct: 243 HIALISPTLIILVGSTAATSLLG-KNSGITKIRQEYYFYTNKYLSAPIQTTAIFHPAYLL 301

Query: 239 QYPLIKKNTWHALITLKKALKN 260
           + P+ K+ +W+ L+ +K+ L N
Sbjct: 302 RQPMQKRTSWYDLLKIKEYLVN 323


>gi|152990436|ref|YP_001356158.1| uracil-DNA glycosylase [Nitratiruptor sp. SB155-2]
 gi|151422297|dbj|BAF69801.1| uracil-DNA glycosylase [Nitratiruptor sp. SB155-2]
          Length = 195

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 51/186 (27%), Positives = 94/186 (50%), Gaps = 6/186 (3%)

Query: 74  ACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTG 133
              L  L++++   H C L  T  + +         LM IG  P  +++ +G+PF G+ G
Sbjct: 15  PNDLEALRAIVLECHLCDLSKTRKNVVFGEGNPHAKLMFIGEGPGATEDETGRPFVGRAG 74

Query: 134 NMLDKMLQSI-EIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLF 192
            +L KM++++ EI R++++I+ I    PP NR  +  E + C P + +QIE+I+P+IL+ 
Sbjct: 75  QLLTKMIENVLEIPRSEVYIANIVKCRPPNNRVPTPQEAQTCIPYLFKQIEIINPEILVA 134

Query: 193 IGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALI 252
           +G  +  +    D     +  G+  +          + T HP  L++ P  KK  +  L+
Sbjct: 135 LGATSYRWLTG-DNTPISKVRGQVISF----RGKKLIPTFHPSYLLRNPSKKKEAYEDLL 189

Query: 253 TLKKAL 258
            +K+ L
Sbjct: 190 KIKEML 195


>gi|217421553|ref|ZP_03453057.1| uracil-DNA glycosylase, family 4 [Burkholderia pseudomallei 576]
 gi|217395295|gb|EEC35313.1| uracil-DNA glycosylase, family 4 [Burkholderia pseudomallei 576]
          Length = 457

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 49/211 (23%), Positives = 90/211 (42%), Gaps = 6/211 (2%)

Query: 51  QPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDL 110
           +P+             A + +       EL++ +     C LC    +T+     E  D 
Sbjct: 244 EPVHEPVLPDVAARPAATTPSVAELGWDELRARVADCERCRLCEKRTNTVFGVGDEHADW 303

Query: 111 MIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNI 169
           M++G  P ++++  G+PF G+ G +LD ML+++ + R   ++I+ +    PPGNRN    
Sbjct: 304 MLVGEAPGENEDKQGEPFVGQAGKLLDNMLRALALKRGENVYIANVIKCRPPGNRNPEPD 363

Query: 170 EMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTL 229
           E+  C P + RQ+ L+ PK+++ +G          D        G+          +P +
Sbjct: 364 EVARCEPYLQRQVALVKPKLIVALGRFAAQTLLKTDGSIAS-MRGRVHQYE----GVPVI 418

Query: 230 ATVHPQELIQYPLIKKNTWHALITLKKALKN 260
            T HP  L++    K   W  L       ++
Sbjct: 419 VTYHPAYLLRSLQDKAKAWSDLCLANDTYRS 449


>gi|172060990|ref|YP_001808642.1| phage SPO1 DNA polymerase-related protein [Burkholderia ambifaria
           MC40-6]
 gi|171993507|gb|ACB64426.1| phage SPO1 DNA polymerase-related protein [Burkholderia ambifaria
           MC40-6]
          Length = 345

 Score =  186 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 56/232 (24%), Positives = 92/232 (39%), Gaps = 6/232 (2%)

Query: 30  EPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHD 89
           EP   A  +        D A    T       P   +  +          L + +     
Sbjct: 107 EPAPSAAADDMPPATEDDFAWFDATPPGEPLPPDEARPAATPVAMLDWDTLAARVADCTS 166

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-T 148
           C LC    +T+        D M+IG  P ++++  G+PF G+ G +LD MLQS+ + R  
Sbjct: 167 CRLCEKRTNTVFGVGDREADWMLIGEAPGENEDKQGEPFVGQAGKLLDNMLQSLALKRGE 226

Query: 149 QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQK 208
            ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G          DA  
Sbjct: 227 NVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVALVKPKLIVALGRFAAQTLLKTDASI 286

Query: 209 TYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
                G+          +P + T HP  L++    K   W  L   +   + 
Sbjct: 287 AS-LRGRVHTYE----GVPVIVTYHPAYLLRSLQDKSKAWADLCLARDTFQQ 333


>gi|167846322|ref|ZP_02471830.1| putative phage-related DNA polymerase [Burkholderia pseudomallei
           B7210]
          Length = 263

 Score =  186 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 49/211 (23%), Positives = 90/211 (42%), Gaps = 6/211 (2%)

Query: 51  QPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDL 110
           +P+             A + +       EL++ +     C LC    +T+     E  D 
Sbjct: 50  EPVHEPVLPDVAARPAATTPSVAELGWDELRARVADCERCRLCEKRTNTVFGVGDEHADW 109

Query: 111 MIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNI 169
           M++G  P ++++  G+PF G+ G +LD ML+++ + R   ++I+ +    PPGNRN    
Sbjct: 110 MLVGEAPGENEDKQGEPFVGQAGKLLDNMLRALALKRGENVYIANVIKCWPPGNRNPEPD 169

Query: 170 EMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTL 229
           E+  C P + RQ+ L+ PK+++ +G          D        G+          +P +
Sbjct: 170 EVARCEPYLQRQVALVKPKLIVALGRFAAQTLLKTDGSIAS-MRGRVHQYE----GVPVI 224

Query: 230 ATVHPQELIQYPLIKKNTWHALITLKKALKN 260
            T HP  L++    K   W  L       ++
Sbjct: 225 VTYHPAYLLRSLQDKAKAWSDLCLANDTYRS 255


>gi|300691643|ref|YP_003752638.1| uracil-DNA glycosylase,phage-related protein [Ralstonia
           solanacearum PSI07]
 gi|299078703|emb|CBJ51362.1| uracil-DNA glycosylase,phage-related protein [Ralstonia
           solanacearum PSI07]
          Length = 273

 Score =  186 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 55/233 (23%), Positives = 93/233 (39%), Gaps = 8/233 (3%)

Query: 29  DEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFH 88
           D P           E     A              + +A  IA  A    +L++ +    
Sbjct: 44  DAPAPLIEPPVAVAEVVPPVAPAAAPVAEIPADSALPRAQRIA--AFDWAQLEAAVSGCT 101

Query: 89  DCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRT 148
            C LC     T+        D M+IG  P + ++  G+PF G+ G +LD ML++I + R 
Sbjct: 102 ACKLCERRTQTVFGVGDRQADWMLIGEAPGEQEDRQGEPFVGQAGKLLDSMLRAIGLSRE 161

Query: 149 Q-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQ 207
           + + I+ +    PPGNR+    E+ +C P + RQI L+ P++++ +G             
Sbjct: 162 RGVFIANVLKCRPPGNRDPEPDEVAMCDPYLKRQIALVKPRVIIVLGRFAAQSLLQ-TQT 220

Query: 208 KTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
              +  GK   +      +P + T HP  L++    K   W  L   +K    
Sbjct: 221 PVGKLRGKVHEV----DGVPVVVTYHPAYLLRTLTDKARAWEDLCLARKVYAE 269


>gi|83748580|ref|ZP_00945600.1| Uracil DNA glycosylase superfamily protein [Ralstonia solanacearum
           UW551]
 gi|83724788|gb|EAP71946.1| Uracil DNA glycosylase superfamily protein [Ralstonia solanacearum
           UW551]
          Length = 277

 Score =  186 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 52/241 (21%), Positives = 95/241 (39%), Gaps = 11/241 (4%)

Query: 26  WVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSP-----LVQQADSIAQKACSLHEL 80
            V DEP          + + + S  +P                 +   +    A    +L
Sbjct: 38  AVADEPAPFIIEPPVIEPRVVVSEAEPPPMAPPAAPVADIPVAPELPRAQRIAAFDWAQL 97

Query: 81  KSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKML 140
           ++ +     C LC     T+        D M+IG  P + ++  G+PF G+ G +LD ML
Sbjct: 98  EAAVSGCTACKLCERRTQTVFGVGDRQADWMLIGEAPGEQEDRQGEPFVGQAGKLLDSML 157

Query: 141 QSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKN 199
           +++ + R   + I+ +    PPGNR+    E+ +C P + RQI L+ P++++ +G     
Sbjct: 158 RAVGLSRETGVFIANVLKCRPPGNRDPEPDEVAMCDPYLKRQIALVKPRVIIVLGRFAAQ 217

Query: 200 FFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALK 259
                      +  G+   +      +P + T HP  L++    K   W  L   +K   
Sbjct: 218 SLLQ-TQTPVGKLRGRVHEV----DGVPVVVTYHPAYLLRTLTDKARAWEDLCLARKVYA 272

Query: 260 N 260
            
Sbjct: 273 E 273


>gi|53723916|ref|YP_103220.1| phage SPO1 DNA polymerase domain-containing protein [Burkholderia
           mallei ATCC 23344]
 gi|52427339|gb|AAU47932.1| phage SPO1 DNA polymerase domain protein [Burkholderia mallei ATCC
           23344]
          Length = 220

 Score =  186 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 49/211 (23%), Positives = 90/211 (42%), Gaps = 6/211 (2%)

Query: 51  QPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDL 110
           +P+             A + +       EL++ +     C LC    +T+     E  D 
Sbjct: 7   EPVHEPALPDVAARPAATTPSVAELGWDELRARVADCARCRLCEKRTNTVFGVGDEHADW 66

Query: 111 MIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNI 169
           M++G  P ++++  G+PF G+ G +LD ML+++ + R   ++I+ +    PPGNRN    
Sbjct: 67  MLVGEAPGENEDKQGEPFVGQAGKLLDNMLRALALKRGENVYIANVIKCRPPGNRNPEPD 126

Query: 170 EMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTL 229
           E+  C P + RQ+ L+ PK+++ +G          D        G+          +P +
Sbjct: 127 EVARCEPYLQRQVALVKPKLIVALGRFAAQTLLKTDGSIAS-MRGRVHQYE----GVPVI 181

Query: 230 ATVHPQELIQYPLIKKNTWHALITLKKALKN 260
            T HP  L++    K   W  L       ++
Sbjct: 182 VTYHPAYLLRSLQDKAKAWSDLCLANDTYRS 212


>gi|325981465|ref|YP_004293867.1| phage SPO1 DNA polymerase-like protein [Nitrosomonas sp. AL212]
 gi|325530984|gb|ADZ25705.1| phage SPO1 DNA polymerase-related protein [Nitrosomonas sp. AL212]
          Length = 251

 Score =  186 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 53/210 (25%), Positives = 89/210 (42%), Gaps = 6/210 (2%)

Query: 53  ITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMI 112
               ++              ++  + +LK  +     C L  T   T+  T  +    + 
Sbjct: 33  PAPSKNEDITSSFTHKENLGQSKEIDQLKLAVSHCTACPLSKTRTHTVFGTGDKNASWLF 92

Query: 113 IGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQI-HISMISPWHPPGNRNLSNIEM 171
           +G  P   ++ +G+PF G+ G +LD+ML +I++ R  + +I+ I    PP NRN S  E 
Sbjct: 93  VGEGPGAREDETGEPFVGQAGKLLDQMLFAIQLNRRHMIYITNIVKCRPPNNRNPSTYEA 152

Query: 172 EICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLAT 231
             C P + +QI LI PKI++ +G          D        GK  +     S IP + T
Sbjct: 153 AQCEPFLTQQIALIKPKIIIALGKVAAQSLLKCD-NSISSLRGKIHDY----SGIPLIVT 207

Query: 232 VHPQELIQYPLIKKNTWHALITLKKALKNL 261
            HP  L++    K   W  L   +  + +L
Sbjct: 208 YHPAYLLRSLPEKAKAWRDLCFARSVMGSL 237


>gi|167911532|ref|ZP_02498623.1| phage SPO1 DNA polymerase domain protein [Burkholderia pseudomallei
           112]
          Length = 261

 Score =  186 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 49/211 (23%), Positives = 90/211 (42%), Gaps = 6/211 (2%)

Query: 51  QPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDL 110
           +P+             A + +       EL++ +     C LC    +T+     E  D 
Sbjct: 48  EPVHEPVLPDVAARPAATTPSVAELGWDELRARVADCARCRLCEKRTNTVFGVGDEHADW 107

Query: 111 MIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNI 169
           M++G  P ++++  G+PF G+ G +LD ML+++ + R   ++I+ +    PPGNRN    
Sbjct: 108 MLVGEAPGENEDKQGEPFVGQAGKLLDNMLRALALKRGENVYIANVIKCRPPGNRNPEPD 167

Query: 170 EMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTL 229
           E+  C P + RQ+ L+ PK+++ +G          D        G+          +P +
Sbjct: 168 EVARCEPYLQRQVALVKPKLIVALGRFAAQTLLKTDGSIAS-MRGRVHQYE----GVPVI 222

Query: 230 ATVHPQELIQYPLIKKNTWHALITLKKALKN 260
            T HP  L++    K   W  L       ++
Sbjct: 223 VTYHPAYLLRSLQDKAKAWSDLCLANDTYRS 253


>gi|254197195|ref|ZP_04903617.1| uracil-DNA glycosylase, family 4 [Burkholderia pseudomallei S13]
 gi|169653936|gb|EDS86629.1| uracil-DNA glycosylase, family 4 [Burkholderia pseudomallei S13]
          Length = 455

 Score =  186 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 49/211 (23%), Positives = 90/211 (42%), Gaps = 6/211 (2%)

Query: 51  QPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDL 110
           +P+             A + +       EL++ +     C LC    +T+     E  D 
Sbjct: 242 EPVHEPVLPDVAARPAATTPSVAELGWDELRARVADCERCRLCEKRTNTVFGVGDEHADW 301

Query: 111 MIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNI 169
           M++G  P ++++  G+PF G+ G +LD ML+++ + R   ++I+ +    PPGNRN    
Sbjct: 302 MLVGEAPGENEDKQGEPFVGQAGKLLDNMLRALALKRGENVYIANVIKCRPPGNRNPEPD 361

Query: 170 EMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTL 229
           E+  C P + RQ+ L+ PK+++ +G          D        G+          +P +
Sbjct: 362 EVARCEPYLQRQVALVKPKLIVALGRFAAQTLLKTDGSIAS-MRGRVHQYE----GVPVI 416

Query: 230 ATVHPQELIQYPLIKKNTWHALITLKKALKN 260
            T HP  L++    K   W  L       ++
Sbjct: 417 VTYHPAYLLRSLQDKAKAWSDLCLANDTYRS 447


>gi|39996228|ref|NP_952179.1| phage shock protein E [Geobacter sulfurreducens PCA]
 gi|39982993|gb|AAR34452.1| phage SPO1 DNA polymerase-related protein [Geobacter sulfurreducens
           PCA]
          Length = 235

 Score =  186 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 42/188 (22%), Positives = 90/188 (47%), Gaps = 5/188 (2%)

Query: 71  AQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSG 130
                +L +++  +   H C L +   + +         LMIIG  P   +++ G+PF G
Sbjct: 42  GDARETLDDIRREMGGCHRCALGAGRTNLVFGVGNPAARLMIIGEAPGRDEDLRGEPFVG 101

Query: 131 KTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKIL 190
           + G +L K+++++   R  ++I  +    PP NR+ ++ E+E C   ++RQ++ ++P+ +
Sbjct: 102 EAGQLLTKIIEAMGFAREDVYICNVLKCRPPHNRDPASAEIEACSSFMLRQVKAVAPEAI 161

Query: 191 LFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHA 250
           L +G            +   +  G++ +       IP + T+HP  L++ P  K++ W  
Sbjct: 162 LALGTFAAQTILGTK-EPISRLRGRFHDY----HGIPLMPTLHPAFLLRNPERKRDVWDD 216

Query: 251 LITLKKAL 258
           +  +   L
Sbjct: 217 VRQVMGLL 224


>gi|207723323|ref|YP_002253722.1| uracil-dna glycosylase-related protein [Ralstonia solanacearum
           MolK2]
 gi|206588521|emb|CAQ35484.1| uracil-dna glycosylase-related protein [Ralstonia solanacearum
           MolK2]
          Length = 280

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 56/243 (23%), Positives = 100/243 (41%), Gaps = 15/243 (6%)

Query: 26  WVFDEPNNEATYESQRKEKSIDSAIQPITNIRH-------IHSPLVQQADSIAQKACSLH 78
            V DEP          + + + S  +P               +P + +A  IA  A    
Sbjct: 41  AVADEPAPLVIEPPVIEPRVVVSEAEPPPMAPPAASVADIPVAPELPRAQRIA--AFDWA 98

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           +L++ +     C LC     T+        D M+IG  P + ++  G+PF G+ G +LD 
Sbjct: 99  QLEAAVSGCTACKLCERRTQTVFGVGDRQADWMLIGEAPGEQEDRQGEPFVGQAGKLLDS 158

Query: 139 MLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT 197
           ML+++ + R   + I+ +    PPGNR+    E+ +C P + RQI L+ P++++ +G   
Sbjct: 159 MLRAVGLSRETGVFIANVLKCRPPGNRDPEPDEVTMCDPYLKRQIALVKPRVIIVLGRFA 218

Query: 198 KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKA 257
                        +  G+   +      +P + T HP  L++    K   W  L   +K 
Sbjct: 219 AQSLLQ-TQTPVGKLRGRVHEV----DGVPVVVTYHPAYLLRTLTDKARAWEDLCLARKV 273

Query: 258 LKN 260
              
Sbjct: 274 YAE 276


>gi|332297808|ref|YP_004439730.1| phage SPO1 DNA polymerase-related protein [Treponema brennaborense
           DSM 12168]
 gi|332180911|gb|AEE16599.1| phage SPO1 DNA polymerase-related protein [Treponema brennaborense
           DSM 12168]
          Length = 258

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 59/207 (28%), Positives = 90/207 (43%), Gaps = 6/207 (2%)

Query: 56  IRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGY 115
                      AD++ + A +L  +   +     C LC T  +T+         +M+IG 
Sbjct: 43  PPQPSVRAAVAADTLPETAAALERIVQKIAGCTRCQLCKTRKNTVPGIGVPNPAVMVIGE 102

Query: 116 TPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEIC 174
            P   ++ SG PF G+ G +LDKML SI + R T  +I+ I    PPGNR+    E E C
Sbjct: 103 GPGADEDASGIPFVGRAGQLLDKMLASISLSRTTNCYIANIVKCRPPGNRDPLPEESEAC 162

Query: 175 RPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHP 234
              +  QI L+ P  +L +G                +  GK++        IP LAT HP
Sbjct: 163 AAFLEAQISLLKPAAILAVGRVAAQNLLK-TTVGIGKLRGKFTEYN----GIPFLATYHP 217

Query: 235 QELIQYPLIKKNTWHALITLKKALKNL 261
             L++   +K+  W  L   +  L+ L
Sbjct: 218 SALLRNEDLKRPAWEDLKLFRSGLQQL 244


>gi|319957234|ref|YP_004168497.1| phage spo1 DNA polymerase-related protein [Nitratifractor
           salsuginis DSM 16511]
 gi|319419638|gb|ADV46748.1| phage SPO1 DNA polymerase-related protein [Nitratifractor
           salsuginis DSM 16511]
          Length = 222

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 53/194 (27%), Positives = 92/194 (47%), Gaps = 6/194 (3%)

Query: 68  DSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKP 127
              AQ    L EL+ L+   H C L  +    +         LM +G  P  +++ +G+P
Sbjct: 33  PEPAQLPDDLEELRRLVEQCHLCDLAKSRHKVVFGEGDPHARLMFVGEGPGATEDQTGRP 92

Query: 128 FSGKTGNMLDKMLQSI-EIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELIS 186
           F G+ G +L +M++++  + R +++I+ I    PPGNR  +  E   CRP +++QIE+I 
Sbjct: 93  FVGRAGELLTRMIENVLHLRREEVYIANIVKCRPPGNRVPTPTEAFTCRPYLLKQIEIIR 152

Query: 187 PKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKN 246
           P+I++ +G      +  ND     +  G              + T HP  L++ P  KK 
Sbjct: 153 PRIIMTLGATAYR-YLTNDETPISRVRGHIIQSDH----YTLVPTFHPSYLLRNPSAKKQ 207

Query: 247 TWHALITLKKALKN 260
            W  L+ +K  L+ 
Sbjct: 208 AWEDLLKVKALLEK 221


>gi|198284582|ref|YP_002220903.1| phage SPO1 DNA polymerase-like protein [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218667172|ref|YP_002427251.1| uracil-DNA glycosylase family 4 protein [Acidithiobacillus
           ferrooxidans ATCC 23270]
 gi|198249103|gb|ACH84696.1| phage SPO1 DNA polymerase-related protein [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218519385|gb|ACK79971.1| uracil-DNA glycosylase family 4 protein [Acidithiobacillus
           ferrooxidans ATCC 23270]
          Length = 308

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 48/228 (21%), Positives = 84/228 (36%), Gaps = 6/228 (2%)

Query: 35  ATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCS 94
               S        S   P           V+   +         +L +++ +   C L  
Sbjct: 84  TALPSSGTAPIPVSGTPPPVPADQASVTAVEAHRTARIATLDWRDLSNMVSTCQACPLGQ 143

Query: 95  TSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQI-HIS 153
           T    +          + +G  P   ++  G+ F G+ G +LD MLQ++ + R +  +I+
Sbjct: 144 TRKHAVFGAGNPHGSWLFVGEAPGAEEDRRGEAFVGRAGQLLDNMLQAMGLSRDKDAYIA 203

Query: 154 MISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNL 213
            I    PP NR+    E+  C P + RQI L+ P++++ +G          +     Q  
Sbjct: 204 NILKCRPPNNRDPLGPEVHACTPYLQRQIALLQPRVIVALGRFAAQGLLQVNTPL-SQLR 262

Query: 214 GKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
           G           IP + T HP  L++ P+ K+  W  L         L
Sbjct: 263 GT----TQHFQGIPLIVTYHPAYLLRNPIDKRKVWEDLKRALGVFAEL 306


>gi|167563217|ref|ZP_02356133.1| putative phage-related DNA polymerase [Burkholderia oklahomensis
           EO147]
          Length = 253

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 52/207 (25%), Positives = 89/207 (42%), Gaps = 6/207 (2%)

Query: 55  NIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIG 114
                 +     A   +       EL++ +     C LC    +T+     E  D M+IG
Sbjct: 44  PALPDVAAKPAAASEPSVAELGWDELRARVADCRRCRLCEKRTNTVFGVGDERADWMLIG 103

Query: 115 YTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEI 173
             P ++++  G+PF G+ G +LD ML+++ + R   ++I+ +    PPGNRN    E+  
Sbjct: 104 EAPGENEDKQGEPFVGQAGKLLDNMLRALALKRGENVYIANVIKCRPPGNRNPEPDEVAR 163

Query: 174 CRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVH 233
           C P + RQ+ L+ PK+++ +G          DA       G+          +P + T H
Sbjct: 164 CEPYLQRQVALVKPKLIVALGRFAAQTLLKTDASIAS-MRGRVHQYE----GVPVIVTYH 218

Query: 234 PQELIQYPLIKKNTWHALITLKKALKN 260
           P  L++    K   W  L     A +N
Sbjct: 219 PAYLLRSLQDKAKAWSDLCLANDAYRN 245


>gi|126728290|ref|ZP_01744106.1| uracil-DNA glycosylase [Sagittula stellata E-37]
 gi|126711255|gb|EBA10305.1| uracil-DNA glycosylase [Sagittula stellata E-37]
          Length = 258

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 60/263 (22%), Positives = 111/263 (42%), Gaps = 10/263 (3%)

Query: 3   SKRILSQEQILTIALFYADSGV-YWVFDEPNNEATYESQRKEKSIDSAIQPITN--IRHI 59
            +  L          +  + GV   + + P +    E   K + +           +   
Sbjct: 1   MESALDWHAARAALDWQLEMGVSETLCEAPVDRFALEDAVKAERLAPRRGAAGAAPVAEP 60

Query: 60  HSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSD 119
               V +A + A  A  L  L + L ++  C L   + S + +       +M++G  P  
Sbjct: 61  EVDPVAEAQAAAAAAPDLPALAAALAAYDHCELKRGARSLVFSDGAAAARVMLVGEAPGR 120

Query: 120 SDNISGKPFSGKTGNMLDKMLQSIEIMRTQI-HISMISPWHPPGNRNLSNIEMEICRPII 178
            +++ GKPF G+ G +LD+ML ++ + R +  +I+ + PW PP NR+    E+ +  P +
Sbjct: 121 DEDLQGKPFVGRAGQLLDRMLAAVGLSRDESVYITNVLPWRPPQNRDPKPDEIAMMLPFL 180

Query: 179 MRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELI 238
            + I L+ P +L+ +GN +             +  G W          P L  VHP  L+
Sbjct: 181 KKHIALVDPDLLVIVGNISAQALLGRRG--ITRLRGTWQEAE----GRPALPMVHPAYLL 234

Query: 239 QYPLIKKNTWHALITLKKALKNL 261
           + P  K+  W+ ++ LK  L+ L
Sbjct: 235 RNPGFKREAWNDMLELKVKLRTL 257


>gi|114331290|ref|YP_747512.1| phage SPO1 DNA polymerase-related protein [Nitrosomonas eutropha
           C91]
 gi|114308304|gb|ABI59547.1| phage SPO1 DNA polymerase-related protein [Nitrosomonas eutropha
           C91]
          Length = 245

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 61/223 (27%), Positives = 100/223 (44%), Gaps = 6/223 (2%)

Query: 40  QRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLST 99
           Q   +S DS   P  +        +    S      +  +L+ ++ S   C LC T   T
Sbjct: 25  QPSVQSSDSKENPAAHTETAVESSIVDDRSALIARANWEQLRQMVSSCTACPLCQTRKQT 84

Query: 100 ICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ-IHISMISPW 158
           +     E  D + IG  P   +++ G+PF G+ G +LD MLQ+I++ R Q ++I+ I   
Sbjct: 85  VFGVGDEQADWLFIGEGPGAREDLLGEPFVGQAGKLLDSMLQAIDLGREQGVYIANIVKC 144

Query: 159 HPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSN 218
            PP NRN   +E + CRP ++RQI LI P++++ +G                   G+   
Sbjct: 145 RPPDNRNPLEMEAQQCRPYLLRQIALIQPRLIITLGKVAAQNLLA-TGDSIASLRGRLHE 203

Query: 219 LCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
                  IP +AT HP  L++    K   W  L   ++ ++ L
Sbjct: 204 FA----GIPLIATYHPAYLLRSLTDKAKAWEDLCFARRTMQAL 242


>gi|323706586|ref|ZP_08118137.1| phage SPO1 DNA polymerase-related protein [Thermoanaerobacterium
           xylanolyticum LX-11]
 gi|323534064|gb|EGB23864.1| phage SPO1 DNA polymerase-related protein [Thermoanaerobacterium
           xylanolyticum LX-11]
          Length = 187

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 48/183 (26%), Positives = 84/183 (45%), Gaps = 5/183 (2%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L EL     +   C L +   + +         +M +G  P   +++ G+PF GK G +L
Sbjct: 6   LKELIEQCMNCTKCPLHNVRNNVVFGEGNLRSKIMFVGEGPGRDEDLQGRPFVGKAGQLL 65

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
           +KML++I + R  ++I+ I    PP NR     E++ C P +  Q+ +I+PKI++ +G  
Sbjct: 66  NKMLEAINLKREDVYIANIVKCRPPNNRVPLQSEVDACLPYLRNQVAIIAPKIIVCLGAT 125

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
                 + D  K     G+W         +  +AT HP  L++ P  K   W    +++ 
Sbjct: 126 AAKAIIDKD-FKITAMRGQWFE----KKGVKIIATYHPAALLRDPEKKYPAWEDFKSIRD 180

Query: 257 ALK 259
            L 
Sbjct: 181 ELD 183


>gi|166999677|ref|ZP_02265512.1| uracil-DNA glycosylase, family 4 [Burkholderia mallei PRL-20]
 gi|243064327|gb|EES46513.1| uracil-DNA glycosylase, family 4 [Burkholderia mallei PRL-20]
          Length = 461

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 49/211 (23%), Positives = 90/211 (42%), Gaps = 6/211 (2%)

Query: 51  QPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDL 110
           +P+             A + +       EL++ +     C LC    +T+     E  D 
Sbjct: 248 EPVHEPALPDVAARPAATTPSVAELGWDELRARVADCARCRLCEKRTNTVFGVGDEHADW 307

Query: 111 MIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNI 169
           M++G  P ++++  G+PF G+ G +LD ML+++ + R   ++I+ +    PPGNRN    
Sbjct: 308 MLVGEAPGENEDKQGEPFVGQAGKLLDNMLRALALKRGENVYIANVIKCRPPGNRNPEPD 367

Query: 170 EMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTL 229
           E+  C P + RQ+ L+ PK+++ +G          D        G+          +P +
Sbjct: 368 EVARCEPYLQRQVALVKPKLIVALGRFAAQTLLKTDGSIAS-MRGRVHQYE----GVPVI 422

Query: 230 ATVHPQELIQYPLIKKNTWHALITLKKALKN 260
            T HP  L++    K   W  L       ++
Sbjct: 423 VTYHPAYLLRSLQDKAKAWSDLCLANDTYRS 453


>gi|254178558|ref|ZP_04885213.1| uracil-DNA glycosylase, family 4 [Burkholderia mallei ATCC 10399]
 gi|160699597|gb|EDP89567.1| uracil-DNA glycosylase, family 4 [Burkholderia mallei ATCC 10399]
          Length = 452

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 49/211 (23%), Positives = 90/211 (42%), Gaps = 6/211 (2%)

Query: 51  QPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDL 110
           +P+             A + +       EL++ +     C LC    +T+     E  D 
Sbjct: 239 EPVHEPALPDVAARPAATTPSVAELGWDELRARVADCARCRLCEKRTNTVFGVGDEHADW 298

Query: 111 MIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNI 169
           M++G  P ++++  G+PF G+ G +LD ML+++ + R   ++I+ +    PPGNRN    
Sbjct: 299 MLVGEAPGENEDKQGEPFVGQAGKLLDNMLRALALKRGENVYIANVIKCRPPGNRNPEPD 358

Query: 170 EMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTL 229
           E+  C P + RQ+ L+ PK+++ +G          D        G+          +P +
Sbjct: 359 EVARCEPYLQRQVALVKPKLIVALGRFAAQTLLKTDGSIAS-MRGRVHQYE----GVPVI 413

Query: 230 ATVHPQELIQYPLIKKNTWHALITLKKALKN 260
            T HP  L++    K   W  L       ++
Sbjct: 414 VTYHPAYLLRSLQDKAKAWSDLCLANDTYRS 444


>gi|254358080|ref|ZP_04974353.1| uracil-DNA glycosylase, family 4 [Burkholderia mallei 2002721280]
 gi|148027207|gb|EDK85228.1| uracil-DNA glycosylase, family 4 [Burkholderia mallei 2002721280]
          Length = 458

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 49/211 (23%), Positives = 90/211 (42%), Gaps = 6/211 (2%)

Query: 51  QPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDL 110
           +P+             A + +       EL++ +     C LC    +T+     E  D 
Sbjct: 245 EPVHEPALPDVAARPAATTPSVAELGWDELRARVADCARCRLCEKRTNTVFGVGDEHADW 304

Query: 111 MIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNI 169
           M++G  P ++++  G+PF G+ G +LD ML+++ + R   ++I+ +    PPGNRN    
Sbjct: 305 MLVGEAPGENEDKQGEPFVGQAGKLLDNMLRALALKRGENVYIANVIKCRPPGNRNPEPD 364

Query: 170 EMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTL 229
           E+  C P + RQ+ L+ PK+++ +G          D        G+          +P +
Sbjct: 365 EVARCEPYLQRQVALVKPKLIVALGRFAAQTLLKTDGSIAS-MRGRVHQYE----GVPVI 419

Query: 230 ATVHPQELIQYPLIKKNTWHALITLKKALKN 260
            T HP  L++    K   W  L       ++
Sbjct: 420 VTYHPAYLLRSLQDKAKAWSDLCLANDTYRS 450


>gi|121599419|ref|YP_993398.1| phage SPO1 DNA polymerase domain-containing protein [Burkholderia
           mallei SAVP1]
 gi|124385331|ref|YP_001029166.1| phage SPO1 DNA polymerase domain-containing protein [Burkholderia
           mallei NCTC 10229]
 gi|126451029|ref|YP_001080906.1| uracil-DNA glycosylase [Burkholderia mallei NCTC 10247]
 gi|121228229|gb|ABM50747.1| phage SPO1 DNA polymerase domain protein [Burkholderia mallei
           SAVP1]
 gi|124293351|gb|ABN02620.1| phage SPO1 DNA polymerase domain protein [Burkholderia mallei NCTC
           10229]
 gi|126243899|gb|ABO06992.1| uracil-DNA glycosylase, family 4 [Burkholderia mallei NCTC 10247]
          Length = 455

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 49/211 (23%), Positives = 90/211 (42%), Gaps = 6/211 (2%)

Query: 51  QPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDL 110
           +P+             A + +       EL++ +     C LC    +T+     E  D 
Sbjct: 242 EPVHEPALPDVAARPAATTPSVAELGWDELRARVADCARCRLCEKRTNTVFGVGDEHADW 301

Query: 111 MIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNI 169
           M++G  P ++++  G+PF G+ G +LD ML+++ + R   ++I+ +    PPGNRN    
Sbjct: 302 MLVGEAPGENEDKQGEPFVGQAGKLLDNMLRALALKRGENVYIANVIKCRPPGNRNPEPD 361

Query: 170 EMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTL 229
           E+  C P + RQ+ L+ PK+++ +G          D        G+          +P +
Sbjct: 362 EVARCEPYLQRQVALVKPKLIVALGRFAAQTLLKTDGSIAS-MRGRVHQYE----GVPVI 416

Query: 230 ATVHPQELIQYPLIKKNTWHALITLKKALKN 260
            T HP  L++    K   W  L       ++
Sbjct: 417 VTYHPAYLLRSLQDKAKAWSDLCLANDTYRS 447


>gi|134277251|ref|ZP_01763966.1| uracil-DNA glycosylase, family 4 [Burkholderia pseudomallei 305]
 gi|134250901|gb|EBA50980.1| uracil-DNA glycosylase, family 4 [Burkholderia pseudomallei 305]
          Length = 453

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 49/211 (23%), Positives = 90/211 (42%), Gaps = 6/211 (2%)

Query: 51  QPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDL 110
           +P+             A + +       EL++ +     C LC    +T+     E  D 
Sbjct: 240 EPVHEPALPDVAARPAATTPSVAELGWDELRARVADCARCRLCEKRTNTVFGVGDEHADW 299

Query: 111 MIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNI 169
           M++G  P ++++  G+PF G+ G +LD ML+++ + R   ++I+ +    PPGNRN    
Sbjct: 300 MLVGEAPGENEDKQGEPFVGQAGKLLDNMLRALALKRGENVYIANVIKCRPPGNRNPEPD 359

Query: 170 EMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTL 229
           E+  C P + RQ+ L+ PK+++ +G          D        G+          +P +
Sbjct: 360 EVARCEPYLQRQVALVKPKLIVALGRFAAQTLLKTDGSIAS-MRGRVHQYE----GVPVI 414

Query: 230 ATVHPQELIQYPLIKKNTWHALITLKKALKN 260
            T HP  L++    K   W  L       ++
Sbjct: 415 VTYHPAYLLRSLQDKAKAWSDLCLANDTYRS 445


>gi|171319311|ref|ZP_02908424.1| phage SPO1 DNA polymerase-related protein [Burkholderia ambifaria
           MEX-5]
 gi|171095493|gb|EDT40460.1| phage SPO1 DNA polymerase-related protein [Burkholderia ambifaria
           MEX-5]
          Length = 229

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 53/222 (23%), Positives = 88/222 (39%), Gaps = 6/222 (2%)

Query: 40  QRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLST 99
                  D A            P   +A +          L + +     C LC    +T
Sbjct: 1   MPPATEDDFAWFDAAPPGDPLPPDESRAAATPVAMLDWDTLAARVADCTSCRLCEKRTNT 60

Query: 100 ICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPW 158
           +        D M+IG  P ++++  G+PF G+ G +LD MLQS+ + R   ++I+ +   
Sbjct: 61  VFGVGDREADWMLIGEAPGENEDKQGEPFVGQAGKLLDNMLQSLALKRGENVYIANVIKC 120

Query: 159 HPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSN 218
            PPGNRN    E+  C P + RQ+ L+ PK+++ +G          DA       G+   
Sbjct: 121 RPPGNRNPEPDEVARCEPYLQRQVALVKPKLIVALGRFAAQTLLKTDASIAS-LRGRVHT 179

Query: 219 LCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
                  +P + T HP  L++    K   W  L   +   + 
Sbjct: 180 YE----GVPVIVTYHPAYLLRSLQDKSKAWADLCLARDTFQQ 217


>gi|262198188|ref|YP_003269397.1| phage SPO1 DNA polymerase-related protein [Haliangium ochraceum DSM
           14365]
 gi|262081535|gb|ACY17504.1| phage SPO1 DNA polymerase-related protein [Haliangium ochraceum DSM
           14365]
          Length = 380

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 48/229 (20%), Positives = 95/229 (41%), Gaps = 11/229 (4%)

Query: 33  NEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHL 92
           +     +        +A +P+        P  +          +L ++++ L     C L
Sbjct: 153 DRDRDRTAAARPPESAAHEPLAREPAAREPAPRPQR------RTLTDVRATLGDCQRCKL 206

Query: 93  CSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHI 152
            S   + +         LM +G  P   ++  G+PF G  G +LDKM+ ++   R  ++I
Sbjct: 207 ASGRENIVFGVGDPRAALMFVGEAPGFHEDRRGEPFVGNAGELLDKMIAAMGWTRDTVYI 266

Query: 153 SMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQN 212
           + +    PP NR+    E+  C+P +  QI+ ++P+IL+ +G    +             
Sbjct: 267 ANVLKCRPPNNRDPQPDEIAACQPFLAEQIDAVAPRILVTLGRPAAH-LLLQTTAPMSAL 325

Query: 213 LGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
            G++         +  + T HP  L++ P  K++TW+ L  +   L+ L
Sbjct: 326 RGRFQEY----RGVRVMPTFHPAFLLRRPERKRDTWNDLKLVIAELERL 370


>gi|134300898|ref|YP_001114394.1| phage SPO1 DNA polymerase-like protein [Desulfotomaculum reducens
           MI-1]
 gi|134053598|gb|ABO51569.1| phage SPO1 DNA polymerase-related protein [Desulfotomaculum
           reducens MI-1]
          Length = 187

 Score =  185 bits (470), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 51/186 (27%), Positives = 90/186 (48%), Gaps = 4/186 (2%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           SL +L   +++   C L       +         LM+IG  P   ++  G PF G+ G +
Sbjct: 2   SLEQLAKDMQNCTRCGLSEGRNKLVFGVGNPKAKLMLIGEGPGKDEDEQGVPFVGRAGQL 61

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           LD++L +I++ R  ++I+ I    PP NR  + +E + C P + RQIELI P+I++ +GN
Sbjct: 62  LDRILAAIDLTREDVYIANIVKCRPPNNRVPNRVEAKACLPYLYRQIELIQPQIIVLLGN 121

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
                    DA +  +  G+W    +    I  +AT HP  +++ P  ++  W     ++
Sbjct: 122 TALQNLIGPDA-RITKMRGQWLESQS---GIKIIATYHPAAVLRDPNRRRPVWEDFQMVQ 177

Query: 256 KALKNL 261
           +    L
Sbjct: 178 EEYHKL 183


>gi|126438636|ref|YP_001059495.1| uracil-DNA glycosylase [Burkholderia pseudomallei 668]
 gi|126218129|gb|ABN81635.1| uracil-DNA glycosylase, family 4 [Burkholderia pseudomallei 668]
          Length = 455

 Score =  185 bits (470), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 49/211 (23%), Positives = 90/211 (42%), Gaps = 6/211 (2%)

Query: 51  QPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDL 110
           +P+             A + +       EL++ +     C LC    +T+     E  D 
Sbjct: 242 EPVHEPALPDVAARPAATTPSVAELGWDELRARVADCARCRLCEKRTNTVFGVGDEHADW 301

Query: 111 MIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNI 169
           M++G  P ++++  G+PF G+ G +LD ML+++ + R   ++I+ +    PPGNRN    
Sbjct: 302 MLVGEAPGENEDKQGEPFVGQAGKLLDNMLRALALKRGENVYIANVIKCRPPGNRNPEPD 361

Query: 170 EMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTL 229
           E+  C P + RQ+ L+ PK+++ +G          D        G+          +P +
Sbjct: 362 EVARCEPYLQRQVALVKPKLIVALGRFAAQTLLKTDGSIAS-MRGRVHQYE----GVPVI 416

Query: 230 ATVHPQELIQYPLIKKNTWHALITLKKALKN 260
            T HP  L++    K   W  L       ++
Sbjct: 417 VTYHPAYLLRSLQDKAKAWSDLCLANDTYRS 447


>gi|126454213|ref|YP_001066778.1| uracil-DNA glycosylase [Burkholderia pseudomallei 1106a]
 gi|242316127|ref|ZP_04815143.1| uracil-DNA glycosylase, family 4 [Burkholderia pseudomallei 1106b]
 gi|126227855|gb|ABN91395.1| uracil-DNA glycosylase, family 4 [Burkholderia pseudomallei 1106a]
 gi|242139366|gb|EES25768.1| uracil-DNA glycosylase, family 4 [Burkholderia pseudomallei 1106b]
          Length = 455

 Score =  185 bits (470), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 49/211 (23%), Positives = 90/211 (42%), Gaps = 6/211 (2%)

Query: 51  QPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDL 110
           +P+             A + +       EL++ +     C LC    +T+     E  D 
Sbjct: 242 EPVHEPALPDVAARPAATTPSVAELGWDELRARVADCARCRLCEKRTNTVFGVGDEHADW 301

Query: 111 MIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNI 169
           M++G  P ++++  G+PF G+ G +LD ML+++ + R   ++I+ +    PPGNRN    
Sbjct: 302 MLVGEAPGENEDKQGEPFVGQAGKLLDNMLRALALKRGENVYIANVIKCRPPGNRNPEPD 361

Query: 170 EMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTL 229
           E+  C P + RQ+ L+ PK+++ +G          D        G+          +P +
Sbjct: 362 EVARCEPYLQRQVALVKPKLIVALGRFAAQTLLKTDGSIAS-MRGRVHQYE----GVPVI 416

Query: 230 ATVHPQELIQYPLIKKNTWHALITLKKALKN 260
            T HP  L++    K   W  L       ++
Sbjct: 417 VTYHPAYLLRSLQDKAKAWSDLCLANDTYRS 447


>gi|254189318|ref|ZP_04895829.1| uracil-DNA glycosylase, family 4 [Burkholderia pseudomallei Pasteur
           52237]
 gi|157936997|gb|EDO92667.1| uracil-DNA glycosylase, family 4 [Burkholderia pseudomallei Pasteur
           52237]
          Length = 476

 Score =  185 bits (470), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 49/211 (23%), Positives = 90/211 (42%), Gaps = 6/211 (2%)

Query: 51  QPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDL 110
           +P+             A + +       EL++ +     C LC    +T+     E  D 
Sbjct: 263 EPVHEPVLPDVAARPAATTPSVAELGWDELRARVADCARCRLCEKRTNTVFGVGDEHADW 322

Query: 111 MIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNI 169
           M++G  P ++++  G+PF G+ G +LD ML+++ + R   ++I+ +    PPGNRN    
Sbjct: 323 MLVGEAPGENEDKQGEPFVGQAGKLLDNMLRALALKRGENVYIANVIKCRPPGNRNPEPD 382

Query: 170 EMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTL 229
           E+  C P + RQ+ L+ PK+++ +G          D        G+          +P +
Sbjct: 383 EVARCEPYLQRQVALVKPKLIVALGRFAAQTLLKTDGSIAS-MRGRVHQYE----GVPVI 437

Query: 230 ATVHPQELIQYPLIKKNTWHALITLKKALKN 260
            T HP  L++    K   W  L       ++
Sbjct: 438 VTYHPAYLLRSLQDKAKAWSDLCLANDTYRS 468


>gi|254297183|ref|ZP_04964636.1| uracil-DNA glycosylase, family 4 [Burkholderia pseudomallei 406e]
 gi|157807234|gb|EDO84404.1| uracil-DNA glycosylase, family 4 [Burkholderia pseudomallei 406e]
          Length = 464

 Score =  185 bits (470), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 49/211 (23%), Positives = 90/211 (42%), Gaps = 6/211 (2%)

Query: 51  QPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDL 110
           +P+             A + +       EL++ +     C LC    +T+     E  D 
Sbjct: 251 EPVHEPVLPDVAARPAATTPSVAELGWDELRARVADCARCRLCEKRTNTVFGVGDEHADW 310

Query: 111 MIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNI 169
           M++G  P ++++  G+PF G+ G +LD ML+++ + R   ++I+ +    PPGNRN    
Sbjct: 311 MLVGEAPGENEDKQGEPFVGQAGKLLDNMLRALALKRGENVYIANVIKCRPPGNRNPEPD 370

Query: 170 EMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTL 229
           E+  C P + RQ+ L+ PK+++ +G          D        G+          +P +
Sbjct: 371 EVARCEPYLQRQVALVKPKLIVALGRFAAQTLLKTDGSIAS-MRGRVHQYE----GVPVI 425

Query: 230 ATVHPQELIQYPLIKKNTWHALITLKKALKN 260
            T HP  L++    K   W  L       ++
Sbjct: 426 VTYHPAYLLRSLQDKAKAWSDLCLANDTYRS 456


>gi|76811418|ref|YP_334000.1| phage SPO1 DNA polymerase domain-containing protein [Burkholderia
           pseudomallei 1710b]
 gi|254261802|ref|ZP_04952856.1| uracil-DNA glycosylase, family 4 [Burkholderia pseudomallei 1710a]
 gi|76580871|gb|ABA50346.1| phage SPO1 DNA polymerase domain protein [Burkholderia pseudomallei
           1710b]
 gi|254220491|gb|EET09875.1| uracil-DNA glycosylase, family 4 [Burkholderia pseudomallei 1710a]
          Length = 468

 Score =  185 bits (470), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 49/211 (23%), Positives = 90/211 (42%), Gaps = 6/211 (2%)

Query: 51  QPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDL 110
           +P+             A + +       EL++ +     C LC    +T+     E  D 
Sbjct: 255 EPVHEPVLPDVAARPAATTPSVAELGWDELRARVADCARCRLCEKRTNTVFGVGDEHADW 314

Query: 111 MIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNI 169
           M++G  P ++++  G+PF G+ G +LD ML+++ + R   ++I+ +    PPGNRN    
Sbjct: 315 MLVGEAPGENEDKQGEPFVGQAGKLLDNMLRALALKRGENVYIANVIKCRPPGNRNPEPD 374

Query: 170 EMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTL 229
           E+  C P + RQ+ L+ PK+++ +G          D        G+          +P +
Sbjct: 375 EVARCEPYLQRQVALVKPKLIVALGRFAAQTLLKTDGSIAS-MRGRVHQYE----GVPVI 429

Query: 230 ATVHPQELIQYPLIKKNTWHALITLKKALKN 260
            T HP  L++    K   W  L       ++
Sbjct: 430 VTYHPAYLLRSLQDKAKAWSDLCLANDTYRS 460


>gi|296134223|ref|YP_003641470.1| phage SPO1 DNA polymerase-related protein [Thermincola sp. JR]
 gi|296032801|gb|ADG83569.1| phage SPO1 DNA polymerase-related protein [Thermincola potens JR]
          Length = 197

 Score =  185 bits (470), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 49/193 (25%), Positives = 87/193 (45%), Gaps = 5/193 (2%)

Query: 69  SIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPF 128
           +  +    L +L  L R    C L +     +        DLM IG  P   ++  G PF
Sbjct: 8   AAIENCSDLEQLSLLARDCCRCGLRAGCRGVVFGKGNPDADLMFIGEGPGAEEDRQGLPF 67

Query: 129 SGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPK 188
            G  G +LDK++ +      +++I+ I    PPGNR  +  E + C+P + +QI LI PK
Sbjct: 68  VGAAGQLLDKIILAGGWQLNEVYIANIVKCRPPGNRTPAPQEADACKPWLEKQIALIKPK 127

Query: 189 ILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTW 248
           I++ +G+       +    +  ++ G+W       + I  + T HP  L++ P  K+  W
Sbjct: 128 IIVLLGSVAIQNIID-RGARITRDRGRWYE----KNGIRIMPTFHPAALLRDPAKKRPVW 182

Query: 249 HALITLKKALKNL 261
             +  ++    +L
Sbjct: 183 EDIKKVRALYDSL 195


>gi|237812834|ref|YP_002897285.1| uracil-DNA glycosylase, family 4 [Burkholderia pseudomallei
           MSHR346]
 gi|237502848|gb|ACQ95166.1| uracil-DNA glycosylase, family 4 [Burkholderia pseudomallei
           MSHR346]
          Length = 468

 Score =  185 bits (470), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 49/211 (23%), Positives = 90/211 (42%), Gaps = 6/211 (2%)

Query: 51  QPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDL 110
           +P+             A + +       EL++ +     C LC    +T+     E  D 
Sbjct: 255 EPVHEPVLPDVAARPAATTPSVAELGWDELRARVADCARCRLCEKRTNTVFGVGDEHADW 314

Query: 111 MIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNI 169
           M++G  P ++++  G+PF G+ G +LD ML+++ + R   ++I+ +    PPGNRN    
Sbjct: 315 MLVGEAPGENEDKQGEPFVGQAGKLLDNMLRALALKRGENVYIANVIKCRPPGNRNPEPD 374

Query: 170 EMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTL 229
           E+  C P + RQ+ L+ PK+++ +G          D        G+          +P +
Sbjct: 375 EVARCEPYLQRQVALVKPKLIVALGRFAAQTLLKTDGSIAS-MRGRVHQYE----GVPVI 429

Query: 230 ATVHPQELIQYPLIKKNTWHALITLKKALKN 260
            T HP  L++    K   W  L       ++
Sbjct: 430 VTYHPAYLLRSLQDKAKAWSDLCLANDTYRS 460


>gi|254247860|ref|ZP_04941181.1| Uracil-DNA glycosylase [Burkholderia cenocepacia PC184]
 gi|124872636|gb|EAY64352.1| Uracil-DNA glycosylase [Burkholderia cenocepacia PC184]
          Length = 343

 Score =  185 bits (470), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 56/257 (21%), Positives = 92/257 (35%), Gaps = 22/257 (8%)

Query: 20  ADSGVYW----VFDEPNNEATYESQRKEKSIDSAI------------QPITNIRHIHSPL 63
            D+GV        D P   A   +          +                         
Sbjct: 79  RDAGVSAHGLVEGDRPPVRAASPASTDTMPPKDDVPPAADDDFAWFDAAPPGESVPVPLA 138

Query: 64  VQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNI 123
             +             L + +     C LC    +T+        D M+IG  P ++++ 
Sbjct: 139 ESRPAGTPVAVLDWDALAARVADCTLCRLCEKRTNTVFGVGDREADWMLIGEAPGENEDK 198

Query: 124 SGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQI 182
            G+PF G+ G +LD MLQS+ + R   ++I+ +    PPGNRN    E+  C P + RQ+
Sbjct: 199 QGEPFVGQAGKLLDNMLQSLALKRGDNVYIANVIKCRPPGNRNPEPDEVASCEPYLQRQV 258

Query: 183 ELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPL 242
            L+ PK+++ +G          DA       G+          +P + T HP  L++   
Sbjct: 259 ALVKPKLIVALGRFAAQTLLKTDASIAS-LRGRVHAYE----GVPVIVTYHPAYLLRSLQ 313

Query: 243 IKKNTWHALITLKKALK 259
            K   W  L   +   K
Sbjct: 314 DKSKAWADLCLARDTFK 330


>gi|328950429|ref|YP_004367764.1| phage SPO1 DNA polymerase-related protein [Marinithermus
           hydrothermalis DSM 14884]
 gi|328450753|gb|AEB11654.1| phage SPO1 DNA polymerase-related protein [Marinithermus
           hydrothermalis DSM 14884]
          Length = 205

 Score =  185 bits (469), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 55/192 (28%), Positives = 86/192 (44%), Gaps = 11/192 (5%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L EL +  ++   C L     + +         LMI+G  P   ++  G+PF GK G +
Sbjct: 2   TLEELAAKAQACTACRLAEGRHTVVFGEGDPDAQLMIVGEGPGADEDAQGRPFVGKAGQL 61

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRP-IIMRQIELISPKILLFIG 194
           L+++L++  I R  ++I+ I    PPGNRN    E +IC    + +QIELI P+I+  +G
Sbjct: 62  LNRILEAAGIPRESVYIANIVKCRPPGNRNPLPDEAKICTGLWLSKQIELIRPQIIAPLG 121

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLI-----KKNTWH 249
           +    +F         +  G W         I      HP  L++ P       K  TW 
Sbjct: 122 SVAAQYFLGEK-ISITKVRGNWYEW----HGIKIFPMFHPAYLLRNPSRAPGSPKALTWR 176

Query: 250 ALITLKKALKNL 261
            +  LKK L  L
Sbjct: 177 DIQELKKTLDAL 188


>gi|226198966|ref|ZP_03794529.1| uracil-DNA glycosylase, family 4 [Burkholderia pseudomallei
           Pakistan 9]
 gi|225929066|gb|EEH25090.1| uracil-DNA glycosylase, family 4 [Burkholderia pseudomallei
           Pakistan 9]
          Length = 457

 Score =  185 bits (469), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 49/211 (23%), Positives = 90/211 (42%), Gaps = 6/211 (2%)

Query: 51  QPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDL 110
           +P+             A + +       EL++ +     C LC    +T+     E  D 
Sbjct: 244 EPVHEPVLPDVAARPAATTPSVAELGWDELRARVADCARCRLCEKRTNTVFGVGDEHADW 303

Query: 111 MIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNI 169
           M++G  P ++++  G+PF G+ G +LD ML+++ + R   ++I+ +    PPGNRN    
Sbjct: 304 MLVGEAPGENEDKQGEPFVGQAGKLLDNMLRALALKRGENVYIANVIKCRPPGNRNPEPD 363

Query: 170 EMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTL 229
           E+  C P + RQ+ L+ PK+++ +G          D        G+          +P +
Sbjct: 364 EVARCEPYLQRQVALVKPKLIVALGRFAAQTLLKTDGSIAS-MRGRVHQYE----GVPVI 418

Query: 230 ATVHPQELIQYPLIKKNTWHALITLKKALKN 260
            T HP  L++    K   W  L       ++
Sbjct: 419 VTYHPAYLLRSLQDKAKAWSDLCLANDTYRS 449


>gi|308271358|emb|CBX27966.1| hypothetical protein N47_G32900 [uncultured Desulfobacterium sp.]
          Length = 228

 Score =  185 bits (469), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 43/185 (23%), Positives = 85/185 (45%), Gaps = 5/185 (2%)

Query: 75  CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
            +L  ++S L     C L     + +  T      L  +G  P   +++ G+PF G+ G 
Sbjct: 48  DNLDSIRSELGECKRCKLSGGRTNIVFGTGNPNARLAFVGEGPGYDEDVKGEPFVGRAGQ 107

Query: 135 MLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           +L K++++I + R +++I  I    PP NRN    E++ C P + RQ++ I+P  +  +G
Sbjct: 108 LLTKIIEAINLTRDEVYICNIIKCRPPSNRNPEPDEIKACFPFLKRQLDAIAPDFICALG 167

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITL 254
                   + + +   +  G+  +       +  + T HP  L++ P  K++ W  +  L
Sbjct: 168 TFAAQTLLDTN-EPISKLRGRLFDY----RGMQVMPTYHPAYLLRSPEKKRDVWEDMKKL 222

Query: 255 KKALK 259
              +K
Sbjct: 223 IGMMK 227


>gi|207743281|ref|YP_002259673.1| uracil-dna glycosylase-related protein [Ralstonia solanacearum
           IPO1609]
 gi|206594678|emb|CAQ61605.1| uracil-dna glycosylase-related protein [Ralstonia solanacearum
           IPO1609]
          Length = 277

 Score =  185 bits (469), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 52/241 (21%), Positives = 95/241 (39%), Gaps = 11/241 (4%)

Query: 26  WVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSP-----LVQQADSIAQKACSLHEL 80
            V DEP          + + + S  +P                 +   +    A    +L
Sbjct: 38  AVADEPAPFIIEPPVIEPRVVVSEAEPPPMAPPAAPVADIPVAPELPRAQRIAAFDWAQL 97

Query: 81  KSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKML 140
           ++ +     C LC     T+        D M+IG  P + ++  G+PF G+ G +LD ML
Sbjct: 98  EAAVSGCTACKLCERRTQTVFGVGDRQADWMLIGEAPGEQEDRQGEPFVGQAGKLLDSML 157

Query: 141 QSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKN 199
           +++ + R   + I+ +    PPGNR+    E+ +C P + RQI L+ P++++ +G     
Sbjct: 158 RAVGLSRETGVFIANVLKCRPPGNRDPEPDEVAMCDPYLKRQIALVKPRVIIVLGRFPAQ 217

Query: 200 FFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALK 259
                      +  G+   +      +P + T HP  L++    K   W  L   +K   
Sbjct: 218 SLLQ-TQTPVGKLRGRVHEV----DGVPVVVTYHPAYLLRTLTDKARAWEDLCLARKVYA 272

Query: 260 N 260
            
Sbjct: 273 E 273


>gi|167570399|ref|ZP_02363273.1| putative phage-related DNA polymerase [Burkholderia oklahomensis
           C6786]
          Length = 311

 Score =  185 bits (469), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 52/207 (25%), Positives = 89/207 (42%), Gaps = 6/207 (2%)

Query: 55  NIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIG 114
                 +     A   +       EL++ +     C LC    +T+     E  D M+IG
Sbjct: 102 PALPDVAAKPAAASEPSVAELGWDELRARVADCRRCRLCEKRTNTVFGVGDERADWMLIG 161

Query: 115 YTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEI 173
             P ++++  G+PF G+ G +LD ML+++ + R   ++I+ +    PPGNRN    E+  
Sbjct: 162 EAPGENEDKQGEPFVGQAGKLLDNMLRALALKRGENVYIANVIKCRPPGNRNPEPDEVAR 221

Query: 174 CRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVH 233
           C P + RQ+ L+ PK+++ +G          DA       G+          +P + T H
Sbjct: 222 CEPYLQRQVALVKPKLIVALGRFAAQTLLKTDASIAS-MRGRVHQYE----GVPVIVTYH 276

Query: 234 PQELIQYPLIKKNTWHALITLKKALKN 260
           P  L++    K   W  L     A +N
Sbjct: 277 PAYLLRSLQDKAKAWSDLCLANDAYRN 303


>gi|124265496|ref|YP_001019500.1| putative DNA polymerase-like protein [Methylibium petroleiphilum
           PM1]
 gi|124258271|gb|ABM93265.1| putative DNA polymerase-related protein, bacteriophage-type
           [Methylibium petroleiphilum PM1]
          Length = 260

 Score =  185 bits (469), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 55/252 (21%), Positives = 104/252 (41%), Gaps = 17/252 (6%)

Query: 19  YADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQ-KACSL 77
            A+ G+  V+  P   A+     K ++  S +   +    +    V +       +A   
Sbjct: 11  LAEMGIR-VWQAPAAAASPVIDAKVEAAVSPVAAASPAPVVPRVAVARGARPEDVEAMDW 69

Query: 78  HELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLD 137
             L++ +     C LC    +T+          M++G  P + ++  G+PF GK G +LD
Sbjct: 70  PTLRAAVAGCTACGLCRGRTNTVFGVGHTQAHWMVVGEAPGEQEDRLGEPFVGKAGQLLD 129

Query: 138 KMLQSIEIMR----------TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISP 187
            MLQ++ + R           Q++I+ +    PP NRN    E+  C P + RQ+ L+ P
Sbjct: 130 HMLQALGLTRRAEGEGLQPAQQVYIANVLKCRPPMNRNPQPEEVAQCEPYLARQVALLQP 189

Query: 188 KILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNT 247
           +++L +G            +   +  G+          +P + T HP  L++ P  K   
Sbjct: 190 RLILAMGRFAVQSLLQ-TGEPIGRLRGRIHQYQ----GVPAIVTYHPAYLLRNPADKAKA 244

Query: 248 WHALITLKKALK 259
           W  L   ++ ++
Sbjct: 245 WDDLCLAREVMR 256


>gi|78044945|ref|YP_359051.1| uracil-DNA glycosylase [Carboxydothermus hydrogenoformans Z-2901]
 gi|77997060|gb|ABB15959.1| uracil-DNA glycosylase, family 4 [Carboxydothermus hydrogenoformans
           Z-2901]
          Length = 198

 Score =  184 bits (468), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 50/187 (26%), Positives = 83/187 (44%), Gaps = 5/187 (2%)

Query: 75  CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
             L  LK    +   C+L + +   +     E   LM++G  P   ++  G+PF G  G 
Sbjct: 2   EELKALKEEALACQRCNLRAHAQRVVFGEGNEKALLMLVGEGPGAEEDRQGRPFVGAAGE 61

Query: 135 MLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           +L+K+L++  I R +++I  +    PP NR  +  E+  CR  + RQIELI PKI++ +G
Sbjct: 62  LLNKILEAAGISREEVYIGNVVKCRPPNNRVPTREEVAACRTFLDRQIELIKPKIIVCLG 121

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITL 254
                     D  +  +  G W         I  + T HP  L++ P  K+  W     +
Sbjct: 122 ATAAQTLIGPD-VRITKIRGLWHE----KGEIKIMPTFHPAALLRDPTKKRPAWEDFQKV 176

Query: 255 KKALKNL 261
           +     L
Sbjct: 177 RDLYFAL 183


>gi|310814870|ref|YP_003962834.1| phage SPO1 DNA polymerase-related protein [Ketogulonicigenium
           vulgare Y25]
 gi|308753605|gb|ADO41534.1| phage SPO1 DNA polymerase-related protein [Ketogulonicigenium
           vulgare Y25]
          Length = 263

 Score =  184 bits (468), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 60/258 (23%), Positives = 111/258 (43%), Gaps = 19/258 (7%)

Query: 14  TIALFYADSGVYWVF-DEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQ 72
            +  +  + G      D+P +      +  + +  + I      +      + + D+ A+
Sbjct: 12  EMLAWLVEMGADEAIADQPVDRYALPGESPKIAAPAPIAAPEKPKAARLGPLPEVDAPAE 71

Query: 73  KA------CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGK 126
            A       +L +L S++  F  C L   + S + +       +MI+G  P   ++ +G+
Sbjct: 72  AAALAASAQNLEQLASVMEGFDLCALKQGARSFVFSDGDPAARVMIVGEAPGREEDRAGR 131

Query: 127 PFSGKTGNMLDKMLQSIEIMRTQIH------ISMISPWHPPGNRNLSNIEMEICRPIIMR 180
           PF G+ G +LD+M  +I + R+         I+ + PW PP NR  S+ E+ +  P + R
Sbjct: 132 PFVGRAGQLLDRMFGAIGLSRSAPMADQAVYIANVLPWRPPENRTPSDTEIAMMLPFLQR 191

Query: 181 QIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQY 240
            IEL  P+ L+ +GN               +  G W+ +    +  P L   HP  L++ 
Sbjct: 192 HIELADPEYLVLMGNTPCKALLGQAG--ILRLRGNWAEV----TGRPALPMTHPAYLLRE 245

Query: 241 PLIKKNTWHALITLKKAL 258
           P  K+  W  L++LK  L
Sbjct: 246 PGAKREAWADLLSLKARL 263


>gi|53803655|ref|YP_114693.1| phage SPO1 DNA polymerase-like protein [Methylococcus capsulatus
           str. Bath]
 gi|53757416|gb|AAU91707.1| phage SPO1 DNA polymerase-related protein [Methylococcus capsulatus
           str. Bath]
          Length = 243

 Score =  184 bits (467), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 52/216 (24%), Positives = 89/216 (41%), Gaps = 6/216 (2%)

Query: 45  SIDSAIQPITNIRHIHSPLVQQADSIAQK-ACSLHELKSLLRSFHDCHLCSTSLSTICAT 103
            + S   P         P              +   L + + +   C L  T   T+   
Sbjct: 25  KLRSQPVPAAEPAADAFPSPPGRRECEGPDEENWDRLAAEVAACTRCELHLTRTQTVFGV 84

Query: 104 QTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGN 163
                  M+IG  P + +++ G+PF G+ G +L++ML++I + R +++I+ I    PP N
Sbjct: 85  GNRRATWMVIGEAPGEQEDLQGEPFVGRAGQLLNEMLRAIGLKREEVYIANILKCRPPRN 144

Query: 164 RNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPH 223
           R+    E   C   + RQI LI P+I+L  G         +  +   +  G+        
Sbjct: 145 RDPKPEEAAACESYLKRQIALIRPRIILAAGRIAAQNLLKST-ETIGKLRGRVHRYEN-- 201

Query: 224 SIIPTLATVHPQELIQYPLIKKNTWHALITLKKALK 259
             IP + T HP  L++ PL K+  W  L+   + L 
Sbjct: 202 --IPLVITYHPAYLLRAPLEKRKAWQDLLLAVETLN 235


>gi|107028777|ref|YP_625872.1| phage SPO1 DNA polymerase-related protein [Burkholderia cenocepacia
           AU 1054]
 gi|116690064|ref|YP_835687.1| phage SPO1 DNA polymerase-related protein [Burkholderia cenocepacia
           HI2424]
 gi|105897941|gb|ABF80899.1| phage SPO1 DNA polymerase-related protein [Burkholderia cenocepacia
           AU 1054]
 gi|116648153|gb|ABK08794.1| phage SPO1 DNA polymerase-related protein [Burkholderia cenocepacia
           HI2424]
          Length = 346

 Score =  184 bits (467), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 52/240 (21%), Positives = 88/240 (36%), Gaps = 11/240 (4%)

Query: 26  WVFDEPNNEATYESQRKEKSIDSAI-----QPITNIRHIHSPLVQQADSIAQKACSLHEL 80
                P +  T   + +                            +             L
Sbjct: 99  ASITSPASTDTMPPKDEAPPAGDDDFAWFDAAPPGESVPVPAAESRPAGAPVAVLDWDAL 158

Query: 81  KSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKML 140
            + +     C LC    +T+        D M+IG  P ++++  G+PF G+ G +LD ML
Sbjct: 159 AARVADCTLCRLCEKRTNTVFGVGDREADWMLIGEAPGENEDKQGEPFVGQAGKLLDNML 218

Query: 141 QSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKN 199
           QS+ + R   ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G     
Sbjct: 219 QSLALKRGDNVYIANVIKCRPPGNRNPEPDEVASCEPYLQRQVALVKPKLIVALGRFAAQ 278

Query: 200 FFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALK 259
                DA       G+          +P + T HP  L++    K   W  L   +   K
Sbjct: 279 TLLKTDASIAS-LRGRVHAYE----GVPVIVTYHPAYLLRSLQDKSKAWADLCLARDTFK 333


>gi|83313537|ref|YP_423801.1| Uracil-DNA glycosylase [Magnetospirillum magneticum AMB-1]
 gi|82948378|dbj|BAE53242.1| Uracil-DNA glycosylase [Magnetospirillum magneticum AMB-1]
          Length = 254

 Score =  184 bits (467), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 59/222 (26%), Positives = 101/222 (45%), Gaps = 3/222 (1%)

Query: 42  KEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTIC 101
           ++    +            S L   A  +A     L  L+  +  F    L   + ST+ 
Sbjct: 32  RQPRPHAEPMAAPPGALSASALPGTAAHLAAGCADLQALRHAMEGFEGLQLKQAASSTVF 91

Query: 102 ATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPP 161
                   +M IG  P   ++  G PF G +G +LD+ML SI + R+  +I+ + PW PP
Sbjct: 92  GDGNPESAVMCIGEAPGQEEDRRGLPFVGPSGKLLDRMLGSIGLDRSTCYITNVVPWRPP 151

Query: 162 GNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCT 221
            NR  +  E+ +C P + R IEL+ P++L+ +G  +        A    +  G+W    +
Sbjct: 152 ANRKPTPDEVAVCMPFLTRHIELVDPQVLILLGGASAAAV-LAKADGINRLRGRWFEFNS 210

Query: 222 PH--SIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
           P     IP LAT HP  L++ P  K++ W  L+ +++ +  +
Sbjct: 211 PGLPRPIPALATFHPAYLLRTPEAKRDAWRDLLMIRRRMDAV 252


>gi|114567385|ref|YP_754539.1| Uracil-DNA glycosylase-like protein [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
 gi|114338320|gb|ABI69168.1| Uracil-DNA glycosylase-like protein [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
          Length = 233

 Score =  184 bits (467), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 55/214 (25%), Positives = 96/214 (44%), Gaps = 7/214 (3%)

Query: 50  IQPITNIRHIHSPLVQ--QADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEG 107
            +     + I SP +   + +        +  L+ L R+ ++C L S     + +     
Sbjct: 20  QEKQVAAKEIRSPFLPGIKVEEAFPGIKEVALLEELARNCNNCRLRSGCRQVVFSDGDVK 79

Query: 108 QDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLS 167
             +M IG  P   ++  G+PF GK G +LDK+L + EI R+Q++IS +    PPGNR  +
Sbjct: 80  SRIMFIGEGPGKDEDEQGRPFVGKAGQLLDKILVAAEIPRSQVYISNVVKCRPPGNRLPN 139

Query: 168 NIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIP 227
             E+  CR  +  QI ++ P I++ +G        +  A    +  GKW N       + 
Sbjct: 140 PDEVRECRNYLEAQIRIMQPAIIVCLGAMASQVVIDPKASV-SKIRGKWFN----RQGVK 194

Query: 228 TLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
            +AT HP  L++ P  K+  W     ++     +
Sbjct: 195 IMATYHPAALLRNPSYKRPAWQDFQMIRDEYNKV 228


>gi|149194079|ref|ZP_01871177.1| Uracil-DNA glycosylase [Caminibacter mediatlanticus TB-2]
 gi|149136032|gb|EDM24510.1| Uracil-DNA glycosylase [Caminibacter mediatlanticus TB-2]
          Length = 214

 Score =  184 bits (467), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 49/186 (26%), Positives = 93/186 (50%), Gaps = 6/186 (3%)

Query: 74  ACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTG 133
              L EL+++ ++   C L  T  + +         LM IG  P + ++ +G+PF G+ G
Sbjct: 34  PNELKELENICKNCTLCDLSKTRTNIVFGEGNPKAKLMFIGEGPGEMEDKTGRPFVGRAG 93

Query: 134 NMLDKMLQSI-EIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLF 192
            +L K+++++ E+ R  ++I+ I    PP NR  +  E E C+P +++QI++I+PKIL+ 
Sbjct: 94  KLLTKIIENVLELSREDVYIANIVKCRPPNNRVPTIEEAESCKPYLIKQIDIINPKILVC 153

Query: 193 IGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALI 252
           +G      +  N+     +  G+             + T HP  L++ P  KK  +   +
Sbjct: 154 LGKTAF-MYLMNNNIPISKIRGQIFEY----KGKKVIPTYHPSFLLRNPSAKKEAYKDFL 208

Query: 253 TLKKAL 258
            +K+ L
Sbjct: 209 LIKELL 214


>gi|193213467|ref|YP_001999420.1| phage SPO1 DNA polymerase-related protein [Chlorobaculum parvum
           NCIB 8327]
 gi|193086944|gb|ACF12220.1| phage SPO1 DNA polymerase-related protein [Chlorobaculum parvum
           NCIB 8327]
          Length = 207

 Score =  184 bits (467), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 54/201 (26%), Positives = 89/201 (44%), Gaps = 5/201 (2%)

Query: 61  SPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDS 120
            P+ +Q    A  A  L  L  +++    C L  T  S +         + +IG  P   
Sbjct: 8   DPVPEQPKQQAVPALDLGSLGKVVQECRKCRLAETRNSVVFGEGNPKARVFVIGEAPGAD 67

Query: 121 DNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMR 180
           ++  G+PF G++G +LDK+L +I   R+ ++I  I    PP NRN    E+E C+P +M+
Sbjct: 68  EDAQGRPFVGRSGQLLDKILLAIGFERSDVYIGNIIKCRPPQNRNPLGDEIECCKPWLMQ 127

Query: 181 QIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQY 240
           Q+E+I P I+L +G    N     +        GK        +      T HP  L++ 
Sbjct: 128 QLEIIKPNIILLLGRVAANTIL-ENTLSMSAMRGKL----IRWNGFDCFVTYHPAALLRN 182

Query: 241 PLIKKNTWHALITLKKALKNL 261
           P  K+  W  +  L+     +
Sbjct: 183 PNWKRLCWEDVQLLRAHYDKV 203


>gi|82703240|ref|YP_412806.1| phage SPO1 DNA polymerase-related protein [Nitrosospira multiformis
           ATCC 25196]
 gi|82411305|gb|ABB75414.1| phage SPO1 DNA polymerase-related protein [Nitrosospira multiformis
           ATCC 25196]
          Length = 271

 Score =  184 bits (467), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 61/244 (25%), Positives = 102/244 (41%), Gaps = 12/244 (4%)

Query: 25  YWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKAC------SLH 78
               D   +     +Q     + +  +    +  +  P     + +A+K           
Sbjct: 29  ECTEDGNPSRTPESAQVMVAPVVAPSEFEEQVEQVCVPSANATEDVAEKRRAMILRMEWD 88

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           +LK  +     C LCS+   T+        D + +G  P   ++  G+PF G+ G +LD 
Sbjct: 89  QLKESVEGCVACRLCSSRTRTVFGVGDPNADWLYVGEGPGAQEDALGEPFVGQAGKLLDN 148

Query: 139 MLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT 197
           ML +I + R   + I+ I    PPGNR  S+ E + C P + RQIELI P++++ +G   
Sbjct: 149 MLMAIGLKRGRDVFIANIVKCRPPGNREPSDDEAQCCEPYLARQIELIKPRLIVALGKTA 208

Query: 198 KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKA 257
                N DA       GK       H  IP + T HP  L++  + K   W  L   ++ 
Sbjct: 209 ARNLLNTDASIGS-LRGKLH----QHEGIPVIVTYHPAYLLRTLVAKAKAWEDLCFAQRT 263

Query: 258 LKNL 261
           ++ L
Sbjct: 264 MQAL 267


>gi|294085230|ref|YP_003551990.1| phage SPO1 DNA polymerase-like protein [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292664805|gb|ADE39906.1| phage SPO1 DNA polymerase-related protein [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 317

 Score =  184 bits (467), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 68/308 (22%), Positives = 121/308 (39%), Gaps = 51/308 (16%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVF-------------------------------- 28
           M+++   + +Q++T   + A+ GV   F                                
Sbjct: 1   MSNQSAATIQQLITQLAWQAEMGVDEAFLGAEALAMPKVKLDKYLPSSIAAAPEAIATTP 60

Query: 29  ----------DEPNNEATYESQRKEKSIDSAIQPITNIRHIHSP-LVQQADSIAQKACSL 77
                           AT       ++      P+        P     A      A  L
Sbjct: 61  DDSARHSASVMSAPKAATLSGAMPMQTPPMQTPPMQTPPMQTPPMQTPPAQISGPDAPDL 120

Query: 78  HEL------KSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGK 131
             +      K+ L +F  C L  T+ + + A    G  LMIIG  P   +++ G PF G 
Sbjct: 121 AAIGSLAALKAGLLAFEGCALKHTASNLVFADGNPGARLMIIGEAPGRDEDMVGLPFVGV 180

Query: 132 TGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILL 191
           +G +LDKML SI + R+ ++I+ + PW PPGNR  +  E  +  P + R ++L +P  +L
Sbjct: 181 SGQLLDKMLASIGLDRSHVYIANLLPWRPPGNRTPTTEETAMMLPWLRRHVQLANPDYIL 240

Query: 192 FIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHS-IIPTLATVHPQELIQYPLIKKNTWHA 250
            +G        +       +  G+W ++    +   PTLA++HP  L++ P  K+ ++  
Sbjct: 241 ILGGSAAKAVLDTK-DGILKLRGRWQDVDFGDAITRPTLASLHPAYLLRSPAQKRLSFAD 299

Query: 251 LITLKKAL 258
           ++ +   L
Sbjct: 300 MLAVNSRL 307


>gi|254179296|ref|ZP_04885895.1| uracil-DNA glycosylase, family 4 [Burkholderia pseudomallei 1655]
 gi|184209836|gb|EDU06879.1| uracil-DNA glycosylase, family 4 [Burkholderia pseudomallei 1655]
          Length = 463

 Score =  184 bits (467), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 49/211 (23%), Positives = 90/211 (42%), Gaps = 6/211 (2%)

Query: 51  QPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDL 110
           +P+             A + +       EL++ +     C LC    +T+     E  D 
Sbjct: 250 EPVHEPVLPDVAARPAATTPSVAELGWDELRARVADCARCRLCEKRTNTVFGVGDEHADW 309

Query: 111 MIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNI 169
           M++G  P ++++  G+PF G+ G +LD ML+++ + R   ++I+ +    PPGNRN    
Sbjct: 310 MLVGEAPGENEDKQGEPFVGQAGKLLDNMLRALALKRGENVYIANVIKCRPPGNRNPEPD 369

Query: 170 EMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTL 229
           E+  C P + RQ+ L+ PK+++ +G          D        G+          +P +
Sbjct: 370 EVARCEPYLQRQVALVKPKLIVALGRFAAQTLLKTDGSIAS-MRGRVHQYE----GVPVI 424

Query: 230 ATVHPQELIQYPLIKKNTWHALITLKKALKN 260
            T HP  L++    K   W  L       ++
Sbjct: 425 VTYHPAYLLRSLQDKAKAWSDLCLANDTYRS 455


>gi|170702440|ref|ZP_02893325.1| phage SPO1 DNA polymerase-related protein [Burkholderia ambifaria
           IOP40-10]
 gi|170132643|gb|EDT01086.1| phage SPO1 DNA polymerase-related protein [Burkholderia ambifaria
           IOP40-10]
          Length = 349

 Score =  184 bits (467), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 55/231 (23%), Positives = 91/231 (39%), Gaps = 6/231 (2%)

Query: 31  PNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDC 90
           P   AT +        D A            P   +  +          L + +     C
Sbjct: 112 PAPSATADDMPPATEDDFAWFDAAPPGDPLPPDEPRPAATPVAMLDWETLAARVADCTSC 171

Query: 91  HLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQ 149
            LC    +T+        D M+IG  P ++++  G+PF G+ G +LD MLQS+ + R   
Sbjct: 172 RLCEKRTNTVFGVGDREADWMLIGEAPGENEDKQGEPFVGQAGKLLDNMLQSLALKRGEN 231

Query: 150 IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKT 209
           ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G          DA   
Sbjct: 232 VYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVALVKPKLIVALGRFAAQTLLKTDASIA 291

Query: 210 YQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
               G+          +P + T HP  L++    K   W  L   +   + 
Sbjct: 292 S-LRGRVHTYE----GVPVIVTYHPAYLLRSLQDKSKAWADLCLARDTFQQ 337


>gi|313672976|ref|YP_004051087.1| phage spo1 DNA polymerase-related protein [Calditerrivibrio
           nitroreducens DSM 19672]
 gi|312939732|gb|ADR18924.1| phage SPO1 DNA polymerase-related protein [Calditerrivibrio
           nitroreducens DSM 19672]
          Length = 226

 Score =  184 bits (467), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 48/204 (23%), Positives = 92/204 (45%), Gaps = 5/204 (2%)

Query: 57  RHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYT 116
                P        + K   + ++   + S   C L  T L+ +        ++M IG  
Sbjct: 28  TDKSIPSPSLNLQNSSKFEQMQKIIEEVSSCFKCILGKTRLNVVPGEGNLDAEIMFIGEG 87

Query: 117 PSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRP 176
           P + ++  G+PF G+ G +L KM++++   R +++I+ I    PP NR   + E   C  
Sbjct: 88  PGEDEDRQGRPFVGRAGQLLTKMIEAMGYKREEVYIANIVKCRPPNNRAPFDEEAFACIG 147

Query: 177 IIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQE 236
            + +QIE+++PK+++ +G+    +  N D + +    G++         I  + T HP  
Sbjct: 148 YVKKQIEIVNPKVIVTLGSTATRYLLNTDKKIST-IRGEFQEYN----GIKVMPTFHPSY 202

Query: 237 LIQYPLIKKNTWHALITLKKALKN 260
           L++   +KK  W  L  +   LK 
Sbjct: 203 LLRNQSMKKPAWEDLKKVIAFLKK 226


>gi|134296052|ref|YP_001119787.1| phage SPO1 DNA polymerase--like protein [Burkholderia vietnamiensis
           G4]
 gi|134139209|gb|ABO54952.1| phage SPO1 DNA polymerase-related protein [Burkholderia
           vietnamiensis G4]
          Length = 342

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 57/227 (25%), Positives = 91/227 (40%), Gaps = 6/227 (2%)

Query: 35  ATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCS 94
           A+          D A    T       P   +AD           L + +     C LC 
Sbjct: 109 ASASDMPLAAEDDFAWFDATPPGDPLPPAEMRADVAPVATLDWDALAARVAGCTSCRLCE 168

Query: 95  TSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHIS 153
               T+        D M+IG  P ++++  G+PF G+ G +LD MLQS+ + R T ++I+
Sbjct: 169 KRTQTVFGVGDREADWMLIGEAPGENEDKQGEPFVGQAGKLLDNMLQSLTLARGTNVYIA 228

Query: 154 MISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNL 213
            +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G          DA       
Sbjct: 229 NVIKCRPPGNRNPEPDEVARCEPYLQRQVALVKPKLIVALGRFAAQTLLKTDASIAS-LR 287

Query: 214 GKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
           G+          +P + T HP  L++    K   W  L   +   + 
Sbjct: 288 GRVHAYE----GVPVIVTYHPAYLLRSLQDKSKAWADLCLARDTFRQ 330


>gi|332980856|ref|YP_004462297.1| phage SPO1 DNA polymerase-like protein [Mahella australiensis 50-1
           BON]
 gi|332698534|gb|AEE95475.1| phage SPO1 DNA polymerase-related protein [Mahella australiensis
           50-1 BON]
          Length = 189

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 50/182 (27%), Positives = 85/182 (46%), Gaps = 5/182 (2%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L  L   + +   C L  +   T+         LM +G  P   +++ G+PF G+ G +L
Sbjct: 6   LKPLMEEVANCTKCPLAQSRTHTVFGEGNLNARLMFVGEGPGKDEDLQGRPFVGRAGQLL 65

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
           D ML++I I R++++I+ +    PP NR  +  E + C P +  Q+ +I PKI++ +G  
Sbjct: 66  DNMLEAIGIKRSEVYIANVVKCRPPQNRVPTPSEAKACLPYLRNQVAIIKPKIIVCLGAT 125

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
                 + D  K  Q  G+W            +AT HP  +++ P  KK  W   I +K+
Sbjct: 126 AAKNLIDPD-FKITQQRGQWIE----RKGYYFIATFHPAAILRDPSKKKPAWEDFILIKE 180

Query: 257 AL 258
             
Sbjct: 181 KY 182


>gi|315186692|gb|EFU20451.1| phage SPO1 DNA polymerase-related protein [Spirochaeta thermophila
           DSM 6578]
          Length = 253

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 56/259 (21%), Positives = 107/259 (41%), Gaps = 18/259 (6%)

Query: 2   TSKRILSQEQILTIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHS 61
            S++ L  +++     F  +  V+  ++ P+         +  ++     P+       S
Sbjct: 1   MSEQDL-YKELWE-LSFLVEDLVHGGWERPH--------PEPPTVPGEAPPLVAGSGERS 50

Query: 62  PLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSD 121
                       A +L  L   +R+ + C L  T    +  T   G  +M++G  P   +
Sbjct: 51  EGKPTGGD--DPARTLGALHEQVRACNRCDLARTRRQAVPGTGRVGLPVMVVGEAPGADE 108

Query: 122 NISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMR 180
           ++ G+PF G+ G  LDK L +I + R   + I+ +    PPGNR+    E+  C P +  
Sbjct: 109 DVKGEPFVGRAGQYLDKWLAAIGLQRGRDVFITNVVKCRPPGNRDPRPDEISACLPFLEA 168

Query: 181 QIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQY 240
           QI L+ P+ +L +G    +       +   +  G+          IP + T HP  +++ 
Sbjct: 169 QIALVRPRAILTVGRFAASTLLG-TQEGISRLRGRVYRY----RDIPLVPTYHPSAVLRD 223

Query: 241 PLIKKNTWHALITLKKALK 259
           P +++  W  L  L   L+
Sbjct: 224 PSLRRPVWEDLKLLSSVLR 242


>gi|187924459|ref|YP_001896101.1| phage SPO1 DNA polymerase-related protein [Burkholderia
           phytofirmans PsJN]
 gi|187715653|gb|ACD16877.1| phage SPO1 DNA polymerase-related protein [Burkholderia
           phytofirmans PsJN]
          Length = 414

 Score =  183 bits (465), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 52/239 (21%), Positives = 91/239 (38%), Gaps = 16/239 (6%)

Query: 29  DEPNNEATYESQRKEKSIDSAIQPIT----------NIRHIHSPLVQQADSIAQKACSLH 78
           +EP    +   Q+                         +      ++     A       
Sbjct: 167 NEPQTPQSSRPQQPRSPEPPTFDAPPSDDFAWFDDLPTQAPADARLEAPAPPAIHTLDWD 226

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
            L   + +   C LC    +T+      G D M+IG  P ++++  G+PF G+ G +LD 
Sbjct: 227 ALSERVAACQLCRLCEKRTNTVFGVGDRGADWMLIGEAPGENEDRLGEPFVGQAGKLLDN 286

Query: 139 MLQSIEIMRTQI-HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT 197
           ML+S+ + R    +I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G   
Sbjct: 287 MLRSLTLARDTNVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVALVKPKLIVALGRFA 346

Query: 198 KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
                  +A       G+          +P + T HP  L++    K   W  L   + 
Sbjct: 347 AQSLLKTEA-SISSLRGRVHEYE----GVPVIVTYHPAYLLRSLPDKAKAWADLCLARD 400


>gi|258517054|ref|YP_003193276.1| phage SPO1 DNA polymerase-related protein [Desulfotomaculum
           acetoxidans DSM 771]
 gi|257780759|gb|ACV64653.1| phage SPO1 DNA polymerase-related protein [Desulfotomaculum
           acetoxidans DSM 771]
          Length = 191

 Score =  183 bits (465), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 49/191 (25%), Positives = 77/191 (40%), Gaps = 6/191 (3%)

Query: 72  QKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGK 131
           +K    ++LK        C L     + +      G  +M IG  P   ++  G+PF G+
Sbjct: 3   EKIKLWNDLKEKCLQCTGCALSEKRTNVVFGEGYIGAGIMFIGEGPGQQEDEQGRPFVGR 62

Query: 132 TGNMLDKMLQSIEIMRTQI-HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKIL 190
            G +LDKML +I + R     I  +    PPGNR     E   C P +  Q+ +I P+I+
Sbjct: 63  AGVLLDKMLDAIGLSRHTNAMICNVVKCRPPGNRVPDRQEAAACLPFLRAQVAIIKPRII 122

Query: 191 LFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHA 250
           + +G        +       Q  G+W            +AT HP  L++ P  K   W  
Sbjct: 123 VCLGATAVKHVLD-TVSGITQIRGQWYE----KKGYWMIATFHPAALLRDPAKKVLVWED 177

Query: 251 LITLKKALKNL 261
           L  ++     L
Sbjct: 178 LKAIRAKYDEL 188


>gi|299139044|ref|ZP_07032221.1| phage SPO1 DNA polymerase-related protein [Acidobacterium sp.
           MP5ACTX8]
 gi|298599198|gb|EFI55359.1| phage SPO1 DNA polymerase-related protein [Acidobacterium sp.
           MP5ACTX8]
          Length = 332

 Score =  183 bits (465), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 49/224 (21%), Positives = 94/224 (41%), Gaps = 6/224 (2%)

Query: 36  TYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHL-CS 94
           +  S        +   P        +PL  Q    A++  +L  +++ +     C L  +
Sbjct: 106 SEPSPLNLPPELAVPMPKPVSFDQLAPLPTQILPAAERPAALEAIRADIGDCTRCPLAYA 165

Query: 95  TSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISM 154
              + + A       LM +G  P   ++ SG PF GK G +L+ M++++ + R +++I+ 
Sbjct: 166 GRHTIVFADGDPNAKLMFVGEGPGADEDASGLPFVGKAGQLLNNMIKAMGLQREEVYIAN 225

Query: 155 ISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLG 214
           I    PPGNR    IE   C   ++RQI+++ P++++ +G     +             G
Sbjct: 226 IVKCRPPGNRTPEPIEANTCSQFLLRQIDIVRPQVIVALGGTAATYLLGVKQSL-SSLRG 284

Query: 215 KWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
           +W +          + T HP  L++ P  K   W  L  +   +
Sbjct: 285 RWHST----RGSKLVVTYHPAFLLRDPRQKGEAWKDLQMVMAEM 324


>gi|304315599|ref|YP_003850744.1| phage SPO1 DNA polymerase-related protein [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302777101|gb|ADL67660.1| phage SPO1 DNA polymerase-related protein [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 185

 Score =  183 bits (465), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 49/185 (26%), Positives = 86/185 (46%), Gaps = 5/185 (2%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L +L     +   C L +   + +         +M IG  P   ++I G+PF GK G +L
Sbjct: 6   LKQLMEECMNCTKCPLHNVRNNVVFGEGNLRSKIMFIGEGPGRDEDIQGRPFVGKAGQLL 65

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
           +KM+++I++ R  ++I+ I    PP NR     E++ C P +  Q+ +I+PKI++ +G  
Sbjct: 66  NKMIEAIDLKREDVYIANIVKCRPPNNRVPLQNEVDACLPYLRNQVAIIAPKIIVCLGAT 125

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
                 +    K     GKW         +  +AT HP  L++ P  K   W    ++K 
Sbjct: 126 AAKAIID-KNFKITVMRGKWIE----RKGVKIIATYHPAALLRDPEKKYPAWEDFKSIKN 180

Query: 257 ALKNL 261
            L+ +
Sbjct: 181 ELEKV 185


>gi|170733398|ref|YP_001765345.1| phage SPO1 DNA polymerase-related protein [Burkholderia cenocepacia
           MC0-3]
 gi|169816640|gb|ACA91223.1| phage SPO1 DNA polymerase-related protein [Burkholderia cenocepacia
           MC0-3]
          Length = 342

 Score =  183 bits (464), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 52/236 (22%), Positives = 86/236 (36%), Gaps = 12/236 (5%)

Query: 31  PNNEATYESQRKEKSIDSAI------QPITNIRHIHSPLVQQADSIAQKACSLHELKSLL 84
           P         + E                            +             L + +
Sbjct: 99  PPASTDTMPPKDEAPPAGDDDFAWFDAAPPGESVPVPAAESRPAGTPVAVLDWDALAARV 158

Query: 85  RSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIE 144
                C LC    +T+        D M+IG  P ++++  G+PF G+ G +LD MLQS+ 
Sbjct: 159 ADCTLCRLCEKRTNTVFGVGDREADWMLIGEAPGENEDKQGEPFVGQAGKLLDNMLQSLA 218

Query: 145 IMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFN 203
           + R   ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G         
Sbjct: 219 LKRGDNVYIANVIKCRPPGNRNPEPDEVASCEPYLQRQVALVKPKLIVALGRFAAQTLLK 278

Query: 204 NDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALK 259
            DA       G+          +P + T HP  L++    K   W  L   +   K
Sbjct: 279 TDASIAS-LRGRVHAYE----GVPVIVTYHPAYLLRSLQDKSKAWADLCLARDTFK 329


>gi|187477567|ref|YP_785591.1| uracil-DNA glycosylase [Bordetella avium 197N]
 gi|115422153|emb|CAJ48677.1| uracil-DNA glycosylase [Bordetella avium 197N]
          Length = 206

 Score =  183 bits (464), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 54/204 (26%), Positives = 86/204 (42%), Gaps = 5/204 (2%)

Query: 55  NIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIG 114
            +          A  +A     L  L+  + +   C LC      +     +    M++G
Sbjct: 4   ELAAPLGAGADTARRVADF--DLARLQQEVLACTACGLCQGRKHAVFGDGAQAARWMVVG 61

Query: 115 YTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQI-HISMISPWHPPGNRNLSNIEMEI 173
             P + ++  G PF G++G +LD ML S+ + R Q   I+ +    PPGNRN    E+  
Sbjct: 62  EAPGEQEDRRGLPFVGRSGQLLDAMLASVGMSREQDVFIANVIKCRPPGNRNPKPEEIAA 121

Query: 174 CRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTP-HSIIPTLATV 232
           C P +MRQI L+ P+ +L +G          DA       G+   L T     IP + + 
Sbjct: 122 CSPYLMRQIALLRPERILVLGRFAAQTLLGTDA-AISSLRGRQHVLKTEAGREIPVVVSY 180

Query: 233 HPQELIQYPLIKKNTWHALITLKK 256
           HP  L++ P  K   W  L   ++
Sbjct: 181 HPAYLLRSPAEKARAWQDLQLARQ 204


>gi|291614685|ref|YP_003524842.1| phage SPO1 DNA polymerase-related protein [Sideroxydans
           lithotrophicus ES-1]
 gi|291584797|gb|ADE12455.1| phage SPO1 DNA polymerase-related protein [Sideroxydans
           lithotrophicus ES-1]
          Length = 245

 Score =  183 bits (464), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 51/230 (22%), Positives = 92/230 (40%), Gaps = 8/230 (3%)

Query: 32  NNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLH--ELKSLLRSFHD 89
                           +  +       +    + +  +    A +L+  +LK ++R    
Sbjct: 19  VRRGVPAEADVASLPAAHAETSQPALPVAEQPMLRQQTEPPPASTLNWTDLKRVVRDCSA 78

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-T 148
           C L S    T+     E  + + +G  P   ++  G+PF G+ G +LD ML ++ + R  
Sbjct: 79  CKLRSGCTQTVFGVGDEKAEWLFVGEGPGADEDAQGEPFVGQAGKLLDNMLAALRLKRGD 138

Query: 149 QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQK 208
           +++I+ I    PP NR     E+  C P + +QIELI PK+++ +G          DA  
Sbjct: 139 KVYIANIVKCRPPNNRTPEPDEIATCMPYLQQQIELIKPKLIVALGKTAATSLLGRDATL 198

Query: 209 TYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
                G   +        P + T HP  L++ P  K   W  L   ++ +
Sbjct: 199 GS-LRGTVHDY----HGTPLIVTYHPAYLLRSPAEKAKAWQDLCFARQRM 243


>gi|194333183|ref|YP_002015043.1| phage SPO1 DNA polymerase-like protein [Prosthecochloris aestuarii
           DSM 271]
 gi|194311001|gb|ACF45396.1| phage SPO1 DNA polymerase-related protein [Prosthecochloris
           aestuarii DSM 271]
          Length = 209

 Score =  183 bits (464), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 54/186 (29%), Positives = 83/186 (44%), Gaps = 5/186 (2%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           SL EL +  ++   C L  T  + +         +++IG  P   ++  G+PF G++G +
Sbjct: 23  SLDELGAQSKNCTQCQLAETRQNVVFGEGNPQAKIVVIGEGPGAEEDAQGRPFVGRSGKL 82

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           LDK+LQSI   R  ++I  I    PP NRN    E+E C P +  Q+ELI P I+L +G 
Sbjct: 83  LDKILQSIGFDRNDVYICNIVKCRPPANRNPLAEEIEQCLPWLNAQLELIQPGIILLLGK 142

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
              N    N         G              + T HP  L++ P  K   W  +  L+
Sbjct: 143 VAANTILQNKCSM-----GSMRGSIIRWGTYDVVVTYHPAALLRNPNWKYQCWEDVKMLR 197

Query: 256 KALKNL 261
           K   ++
Sbjct: 198 KHFDSM 203


>gi|188585122|ref|YP_001916667.1| phage SPO1 DNA polymerase-related protein [Natranaerobius
           thermophilus JW/NM-WN-LF]
 gi|179349809|gb|ACB84079.1| phage SPO1 DNA polymerase-related protein [Natranaerobius
           thermophilus JW/NM-WN-LF]
          Length = 195

 Score =  183 bits (464), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 58/186 (31%), Positives = 82/186 (44%), Gaps = 5/186 (2%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
            L  LK       +CHL  T    +     E  D+M+IG  P   ++   +PF G  G +
Sbjct: 9   DLESLKKEALICKNCHLRETCNGVVFGEGDEQADIMLIGEGPGAKEDELQRPFVGPAGEL 68

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           L KML +I   R  ++I+ I    PP NR  +  EM+ C PI+ +QI LI  KI++ +G 
Sbjct: 69  LTKMLAAINFSRDDVYITNIVKCRPPNNRTPNQEEMDTCLPILRQQIRLIQSKIIVILGG 128

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
                  +    K  +  G W         I  L T HP  L++ P  KK +W  L  LK
Sbjct: 129 AALKGLID-KNMKITKARGSWLE----RKGIHILPTYHPAYLLRNPAKKKESWEDLQNLK 183

Query: 256 KALKNL 261
                L
Sbjct: 184 AKYMEL 189


>gi|21673047|ref|NP_661112.1| DNA polymerase [Chlorobium tepidum TLS]
 gi|21646115|gb|AAM71454.1| DNA polymerase, bacteriophage-type [Chlorobium tepidum TLS]
          Length = 208

 Score =  183 bits (464), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 52/201 (25%), Positives = 86/201 (42%), Gaps = 5/201 (2%)

Query: 61  SPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDS 120
            P  ++A         L EL  +      C L  T  + +         L +IG  P   
Sbjct: 9   DPAPEEAAQPNSPLEGLGELCRITVECRKCRLAQTRKNVVFGEGNPQAGLFVIGEAPGAD 68

Query: 121 DNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMR 180
           ++  G+PF G++G +LDK+L +I   R  ++I  I    PP NRN    E++ C+P +M+
Sbjct: 69  EDAQGRPFVGRSGQLLDKILLAIGFERQDVYIGNIIKCRPPENRNPLADEIDCCKPWLMQ 128

Query: 181 QIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQY 240
           Q+ +I PK+LL +G    N     + Q      G+             + T HP  L++ 
Sbjct: 129 QLGIIKPKVLLLLGKVAANTIL-ENTQSMGLMRGRI----IKWKGFDCVVTYHPAALLRN 183

Query: 241 PLIKKNTWHALITLKKALKNL 261
           P  K+  W  +  L+     +
Sbjct: 184 PNWKRLCWEDVQMLRAHYDKV 204


>gi|116747914|ref|YP_844601.1| phage SPO1 DNA polymerase-like protein [Syntrophobacter
           fumaroxidans MPOB]
 gi|116696978|gb|ABK16166.1| phage SPO1 DNA polymerase-related protein [Syntrophobacter
           fumaroxidans MPOB]
          Length = 264

 Score =  183 bits (464), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 48/214 (22%), Positives = 85/214 (39%), Gaps = 5/214 (2%)

Query: 46  IDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQT 105
           I+      ++         +  +     A  L  +   L     C L S     +    +
Sbjct: 30  IEDWAAAWSDPAVGLPEPEKAIEQEPDPAGGLTVIAGELEGCRRCRLHSERTRIVFGEGS 89

Query: 106 EGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRN 165
               L+ +G  P   ++  G+PF G+ G +LD+M++++   R  ++I  +    PP NR 
Sbjct: 90  AHAPLVFVGEGPGLEEDRQGRPFVGRAGRLLDQMIKALGFHREAVYICNVVKCRPPKNRT 149

Query: 166 LSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSI 225
             + E+  C P ++RQIE I P+++  +G                +  G           
Sbjct: 150 PESEEIARCGPFLIRQIEAIRPRVICALGACAAQTLVG-TGSSISRLRGSVHYW----RG 204

Query: 226 IPTLATVHPQELIQYPLIKKNTWHALITLKKALK 259
           IP + T HP  L++ P  K   W  LI ++  LK
Sbjct: 205 IPLICTFHPAYLLRTPAQKAAAWEDLILVRDLLK 238


>gi|331000978|ref|ZP_08324615.1| uracil-DNA glycosylase, family 4 [Parasutterella excrementihominis
           YIT 11859]
 gi|329569937|gb|EGG51694.1| uracil-DNA glycosylase, family 4 [Parasutterella excrementihominis
           YIT 11859]
          Length = 324

 Score =  183 bits (464), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 59/227 (25%), Positives = 95/227 (41%), Gaps = 2/227 (0%)

Query: 33  NEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHL 92
           N     S R E +   A +  +  R +      +A            LK L++    C +
Sbjct: 98  NAPPPRSARPEPAAKPAYRSASEARGVRPEAYTEARIHQIATADWQTLKQLVQDCRACEI 157

Query: 93  CSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQI-H 151
            S+ L  +         LM+IG  P   ++  G+PF G +G +LDK+L++ ++ R +   
Sbjct: 158 SSSRLHPVFGQGYPPCRLMLIGEAPGAEEDRLGQPFVGPSGKLLDKILEAAKLDREKDLC 217

Query: 152 ISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQ 211
           I       PP N      E   CRP + RQIELI P++++ +G    ++FF  D +    
Sbjct: 218 IFNTLKCRPPLNATPEKAETMACRPFLERQIELIDPEVIVAMGKPAASWFF-PDLKTLNP 276

Query: 212 NLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
             GK  NL         + T HP  L++ P  K+  W     +   L
Sbjct: 277 YRGKVHNLTVQGKPRKVIVTYHPSYLLRSPQEKRKAWLDWCLILDTL 323


>gi|217970656|ref|YP_002355890.1| phage SPO1 DNA polymerase-related protein [Thauera sp. MZ1T]
 gi|217507983|gb|ACK54994.1| phage SPO1 DNA polymerase-related protein [Thauera sp. MZ1T]
          Length = 304

 Score =  183 bits (464), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 47/222 (21%), Positives = 81/222 (36%), Gaps = 6/222 (2%)

Query: 40  QRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLST 99
             +      A                 A            L++ +R    C LC      
Sbjct: 86  PHRAARPQPAAASTPAAVRSAPAAPDPARGARISTLEWDALEAEIRDCKACGLCERRKQA 145

Query: 100 ICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPW 158
           +          M++G  P   ++  G+PF G+ G +LD ML +I + R   ++I+     
Sbjct: 146 VPGVGDRQARWMLVGEAPGAEEDQRGEPFVGQAGRLLDNMLAAIGLKRGEDVYIANAVKC 205

Query: 159 HPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSN 218
            PP NR     E+  C+P + RQI L+ P++L+ +G        + +        GK   
Sbjct: 206 RPPHNRTPERGEIAACQPYLDRQIALVQPQLLVALGRPAAQALLDRE-IAISAARGKRFE 264

Query: 219 LCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
                +  P + T HP  L++ P  K   W  L   ++ +  
Sbjct: 265 ----RAGTPVVVTYHPAYLLRNPQDKAKAWEDLCFARRLIAE 302


>gi|163856012|ref|YP_001630310.1| bacteriophage-related DNA polymerase [Bordetella petrii DSM 12804]
 gi|163259740|emb|CAP42041.1| bacteriophage-related DNA polymerase [Bordetella petrii]
          Length = 298

 Score =  183 bits (464), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 56/226 (24%), Positives = 88/226 (38%), Gaps = 4/226 (1%)

Query: 30  EPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHD 89
            P  E              A +P   +          A  + + A     L+  +     
Sbjct: 70  APVREQKPAPAGAPTPPRPAARPNVPVPAAREQAQPAAQPV-EPARDFDALREQVIQCAA 128

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C LC+     +          M++G  P + ++  G PF G++G +LD ML S+ + R +
Sbjct: 129 CGLCNGRRHAVFGMGGRPARWMVVGEAPGEQEDRQGLPFVGRSGQLLDAMLASVGLSREK 188

Query: 150 I-HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQK 208
              I+ +    PPGNRN    E+  C P +MRQIEL+ P+ +L +G          DA  
Sbjct: 189 DVFIANVIKCRPPGNRNPKPEEIAACSPYLMRQIELLKPERILVLGRFAAQTLLGTDATI 248

Query: 209 TYQNLGKWSNLCTP-HSIIPTLATVHPQELIQYPLIKKNTWHALIT 253
                G+   L       IP + + HP  L++ P  K   W  L  
Sbjct: 249 GS-LRGRRHELAAEDGRKIPVVVSYHPAYLLRSPAEKARAWQDLRL 293


>gi|257457232|ref|ZP_05622407.1| DNA polymerase domain protein [Treponema vincentii ATCC 35580]
 gi|257445383|gb|EEV20451.1| DNA polymerase domain protein [Treponema vincentii ATCC 35580]
          Length = 299

 Score =  183 bits (463), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 52/209 (24%), Positives = 90/209 (43%), Gaps = 13/209 (6%)

Query: 61  SPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTE-------GQDLMII 113
           +     ADS      S+ E+ + +     C L  T    +     E         ++M+I
Sbjct: 92  ADEDSPADSSGASFRSMQEIYAAVAQCSACVLGQTRTHPVAGEGPEELSRLTNSVEVMVI 151

Query: 114 GYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRT-QIHISMISPWHPPGNRNLSNIEME 172
           G  P   ++  G+PF G+ G +LDKML++I++ R    +I+ +    PP NR+ +  E  
Sbjct: 152 GEGPGADEDRQGRPFVGRAGQLLDKMLEAIQLSRKTNCYITNVVKCRPPQNRDPAPEERN 211

Query: 173 ICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATV 232
            C   +  QI LI PK++L +G           +    +  G++ +       IP + T 
Sbjct: 212 CCAAFLDAQIRLIRPKMILVMGRIAAQHLLQ-TSDGIGKLRGRFFDYQ----GIPLMPTY 266

Query: 233 HPQELIQYPLIKKNTWHALITLKKALKNL 261
           HP  L++   +K+  W  L   +  L  L
Sbjct: 267 HPSALLRDESLKRPAWEDLKRFRARLHEL 295


>gi|307719508|ref|YP_003875040.1| hypothetical protein STHERM_c18320 [Spirochaeta thermophila DSM
           6192]
 gi|306533233|gb|ADN02767.1| hypothetical protein STHERM_c18320 [Spirochaeta thermophila DSM
           6192]
          Length = 253

 Score =  183 bits (463), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 53/259 (20%), Positives = 102/259 (39%), Gaps = 18/259 (6%)

Query: 2   TSKRILSQEQILTIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHS 61
            S++ L  +++     F  +  V+  ++ P                        +     
Sbjct: 1   MSEQDL-YKELWE-LSFLVEDLVHGGWERP----------HPAPPTVPAGAPPLVAGSGE 48

Query: 62  PLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSD 121
              ++       A +L  L   +R+ + C L  T    +      G  +M++G  P   +
Sbjct: 49  RSERKPTGGDDPARTLGALHEQVRACNRCDLARTRRHAVPGIGRVGLPVMVVGEAPGADE 108

Query: 122 NISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMR 180
           ++ G+PF G+ G  LDK L +I + R   + I+ +    PPGNR+    E+  C P +  
Sbjct: 109 DVKGEPFVGRAGQYLDKWLAAIGLQRGRDVFITNVVKCRPPGNRDPRPDEISACLPFLEA 168

Query: 181 QIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQY 240
           QI L+ P+ +L +G    +       +   +  G+          IP + T HP  +++ 
Sbjct: 169 QIALVRPRAILTVGRFAASTLLG-TQEGISRLRGRVYRY----RDIPLVPTYHPSAVLRD 223

Query: 241 PLIKKNTWHALITLKKALK 259
           P +++  W  L  L   L+
Sbjct: 224 PSLRRPVWEDLKLLSSVLR 242


>gi|320449933|ref|YP_004202029.1| uracil-DNA glycosylase, family 4 [Thermus scotoductus SA-01]
 gi|320150102|gb|ADW21480.1| uracil-DNA glycosylase, family 4 [Thermus scotoductus SA-01]
          Length = 205

 Score =  183 bits (463), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 52/192 (27%), Positives = 90/192 (46%), Gaps = 11/192 (5%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L  L++  ++   C L       +         LMI+G  P + ++ +G+PF GK G +
Sbjct: 2   TLELLQAQAKACTACRLAEGRTQVVFGEGNPDAQLMIVGEGPGEEEDKTGRPFVGKAGQL 61

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEIC-RPIIMRQIELISPKILLFIG 194
           L+++L++  I R  ++I+ I    PPGNR     E ++C    +++QIELI+P+I++ +G
Sbjct: 62  LNRILEAAGIPRESVYITNIVKCRPPGNRAPLPDEAKVCTDKWLLKQIELIAPQIIVPLG 121

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLI-----KKNTWH 249
                FF         +  G+W         I      HP  L++ P       K  TW 
Sbjct: 122 AVAAEFFLGEK-VSITKVRGQWFEW----HGIRVFPMFHPAYLLRNPSRTPGSPKHLTWL 176

Query: 250 ALITLKKALKNL 261
            +  +K+AL  L
Sbjct: 177 DIQEVKRALDAL 188


>gi|167837067|ref|ZP_02463950.1| putative phage-related DNA polymerase [Burkholderia thailandensis
           MSMB43]
          Length = 208

 Score =  183 bits (463), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 48/185 (25%), Positives = 84/185 (45%), Gaps = 6/185 (3%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
              L++ +     C LC    +T+     E  D M++G  P ++++  G+PF G+ G +L
Sbjct: 21  WDALRARVADCERCRLCEKRTNTVFGVGDESADWMLVGEAPGENEDKQGEPFVGQAGKLL 80

Query: 137 DKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           D ML+++ + R   ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G 
Sbjct: 81  DNMLRALALKRGENVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVALVKPKLIVALGR 140

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
                    DA       G+          +P + T HP  L++    K   W  L    
Sbjct: 141 FAAQTLLKTDASIAS-MRGRVHRYE----GVPVIVTYHPAYLLRSLQDKAKAWSDLCLAN 195

Query: 256 KALKN 260
              +N
Sbjct: 196 DTYRN 200


>gi|311104684|ref|YP_003977537.1| uracil DNA glycosylase superfamily protein [Achromobacter
           xylosoxidans A8]
 gi|310759373|gb|ADP14822.1| uracil DNA glycosylase superfamily protein [Achromobacter
           xylosoxidans A8]
          Length = 333

 Score =  182 bits (462), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 54/213 (25%), Positives = 92/213 (43%), Gaps = 3/213 (1%)

Query: 48  SAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEG 107
              +P+       +P      + A +  +L E+   + +   C LC    + +     + 
Sbjct: 121 PPPRPVPKAAEEAAPPPPVPVAEAIRNATLEEMHEQVVACAACGLCKGRRNAVFGHGGQP 180

Query: 108 QDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQI-HISMISPWHPPGNRNL 166
              +++G  P + ++  G+PF G++G +LD ML S+ + R +   I+ +    PPGNRN 
Sbjct: 181 TRWLVVGEAPGEQEDRQGQPFVGRSGQLLDAMLSSVSMSRERDVFITNVIKCRPPGNRNP 240

Query: 167 SNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCT-PHSI 225
              E+  C P +MRQI L+ P+ +L +G          DA       G+   L T     
Sbjct: 241 KPEEIAACSPYLMRQIALLKPERILVLGRFAAQTLLGTDATIGS-LRGRIHQLKTDEGVE 299

Query: 226 IPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
           IP + + HP  L++ P  K   W  L      L
Sbjct: 300 IPVVVSYHPAYLLRSPSEKARAWQDLRLTVARL 332


>gi|332968166|gb|EGK07248.1| uracil-DNA glycosylase [Desmospora sp. 8437]
          Length = 241

 Score =  182 bits (462), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 46/186 (24%), Positives = 79/186 (42%), Gaps = 5/186 (2%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
            L  +         C L       +         LM +G  P   ++  G+PF G+ G +
Sbjct: 56  DLESVHQRYARCSRCPLHRGRTRIVLGEGNPASPLMFVGEGPGADEDRQGRPFVGRAGQL 115

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           L +ML++ EI R +I I+ I    PPGNR   + EM  C  I+  Q   I PK+++ +G+
Sbjct: 116 LSRMLEAAEIPRAEIFITNIVKCRPPGNRTPQDEEMATCITILREQFVAIRPKLIVTLGS 175

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
                  +  A +  +  G+W         +  + T HP  L++ P  K+  W     ++
Sbjct: 176 APTRALIDP-AARITRVRGQWVE----RKGVRMMPTFHPAYLLRNPEAKREAWIDFQAIR 230

Query: 256 KALKNL 261
            A + +
Sbjct: 231 DAYREV 236


>gi|315121906|ref|YP_004062395.1| putative uracil-DNA glycosylase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495308|gb|ADR51907.1| putative uracil-DNA glycosylase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 260

 Score =  182 bits (462), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 179/260 (68%), Positives = 205/260 (78%), Gaps = 2/260 (0%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIH 60
           MT KR LSQE+IL  ALFYADSGVYWVFD  N +       ++  + S  QPI  I   +
Sbjct: 1   MTYKRTLSQEKILNTALFYADSGVYWVFDHSNGKTHKSWGEEKPPLSS--QPIKEIDQTN 58

Query: 61  SPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDS 120
           +PLV++A SIAQ A SLHELKSL+ SFHDC L +TS STICATQ  G+DLMIIGYTPSDS
Sbjct: 59  NPLVEKAYSIAQNARSLHELKSLISSFHDCALQNTSSSTICATQEGGKDLMIIGYTPSDS 118

Query: 121 DNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMR 180
           DNI+G PFSGKTG++LDKMLQSI +MR Q H SMISPWHPPGNR LS IEMEICRP+IM+
Sbjct: 119 DNINGNPFSGKTGDILDKMLQSIGVMRIQTHTSMISPWHPPGNRQLSKIEMEICRPLIMK 178

Query: 181 QIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQY 240
           QIEL+SP+IL F+GNKT NFFFNND +  YQNLGKW  +   +  IPTL+TVHPQEL+QY
Sbjct: 179 QIELVSPRILFFLGNKTINFFFNNDDKANYQNLGKWHKIQVQNRTIPTLSTVHPQELMQY 238

Query: 241 PLIKKNTWHALITLKKALKN 260
           PLIKK  WH LITLKKALKN
Sbjct: 239 PLIKKTAWHTLITLKKALKN 258


>gi|303257069|ref|ZP_07343083.1| arginine biosynthesis bifunctional protein ArgJ [Burkholderiales
           bacterium 1_1_47]
 gi|302860560|gb|EFL83637.1| arginine biosynthesis bifunctional protein ArgJ [Burkholderiales
           bacterium 1_1_47]
          Length = 321

 Score =  182 bits (462), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 59/227 (25%), Positives = 95/227 (41%), Gaps = 2/227 (0%)

Query: 33  NEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHL 92
           N     S R E +   A +  +  R +      +A            LK L++    C +
Sbjct: 95  NAPPPRSARPEPAAKPAYRSASEARGVRPEAYTEARIHQIATADWQTLKQLVQDCRACEI 154

Query: 93  CSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQI-H 151
            S+ L  +         LM+IG  P   ++  G+PF G +G +LDK+L++ ++ R +   
Sbjct: 155 SSSRLHPVFGQGYPPCRLMLIGEAPGAEEDRLGQPFVGPSGKLLDKILEAAKLDREKDLC 214

Query: 152 ISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQ 211
           I       PP N      E   CRP + RQIELI P++++ +G    ++FF  D +    
Sbjct: 215 IFNTLKCRPPLNATPEKAETMACRPFLERQIELIDPEVIVAMGKPAASWFF-PDLKTLNP 273

Query: 212 NLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
             GK  NL         + T HP  L++ P  K+  W     +   L
Sbjct: 274 YRGKVHNLTVQGKPRKVIVTYHPSYLLRSPQEKRKAWLDWCLILDTL 320


>gi|296135025|ref|YP_003642267.1| phage SPO1 DNA polymerase-related protein [Thiomonas intermedia
           K12]
 gi|295795147|gb|ADG29937.1| phage SPO1 DNA polymerase-related protein [Thiomonas intermedia
           K12]
          Length = 288

 Score =  182 bits (462), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 61/237 (25%), Positives = 97/237 (40%), Gaps = 18/237 (7%)

Query: 28  FDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKAC-------SLHEL 80
             +P  EA  E      +     QP    R I  P    +  IA  A            L
Sbjct: 35  QAQPVPEAAPEVIATPATAKPVAQPPKPNRPIPPPRPTSSIPIADAARVEAIVRMDWDGL 94

Query: 81  KSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKML 140
           ++  ++   C L S+    +  + +     MIIG  P   ++  G+PF G  G +LD ML
Sbjct: 95  QAGAQACRACKLGSSRHQAVFGSGSTQARWMIIGEAPGAEEDRQGQPFVGAAGQLLDAML 154

Query: 141 QSIEIMRTQI------HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           Q+I + R+        +I+ +    PPGNRN    E+  C P + RQ+ L+ P+++L +G
Sbjct: 155 QAIGLDRSADDPERAVYIANVLKCRPPGNRNPEPEEVGQCAPWLERQVALLQPQLILALG 214

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
               +    + A    Q  G+          IP + + HP  L++ P  K   W  L
Sbjct: 215 RFAAHSLLGSQA-PISQLRGQVHEFA----GIPVIVSYHPAYLLRNPADKARVWRDL 266


>gi|197104821|ref|YP_002130198.1| uracil-DNA glycosylase [Phenylobacterium zucineum HLK1]
 gi|196478241|gb|ACG77769.1| uracil-DNA glycosylase [Phenylobacterium zucineum HLK1]
          Length = 274

 Score =  182 bits (462), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 69/270 (25%), Positives = 110/270 (40%), Gaps = 13/270 (4%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYW-VFDEPNNEATYESQRKEKSIDSAIQPITNIRHI 59
           M            ++  F+A++GV   + DEP +          K     + P      +
Sbjct: 1   MPPAAPSDALIAESLLAFWAEAGVDGMLLDEPFDRIEAGKILPPKPAPPLVAPAVRPGPV 60

Query: 60  HSPLVQQADSIAQKAC------SLHELKSLLRSFHDCHLC--STSLSTICATQTEGQDLM 111
            SP    + +IAQ          +  L + + +F  C L     +   +C        LM
Sbjct: 61  ASPQPDVSAAIAQAQALAAQAQDMDALAAAIAAFEGCPLRFEGAASKAVCWRGEPSAPLM 120

Query: 112 IIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEM 171
           +IG  P   ++  G PF G+ G +LD+ML +  +   +  I+    W PPGNR  S  E 
Sbjct: 121 VIGEGPGAEEDSQGLPFVGRAGKLLDRMLGAAGLT-GRALITNTVFWRPPGNRTPSPHEQ 179

Query: 172 EICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHS--IIPTL 229
            IC P + R I L  P++LL +G  +       D        G+W    +      +P +
Sbjct: 180 LICAPFLERAIALTQPRMLLLVGGASAKSLLKKDEGILS-LRGRWFEWRSSDGALELPAM 238

Query: 230 ATVHPQELIQYPLIKKNTWHALITLKKALK 259
            T+HP  L++ P  KK  W  L+TL + L 
Sbjct: 239 PTLHPAFLLRQPGAKKRAWSDLLTLAERLD 268


>gi|113868094|ref|YP_726583.1| bacteriophage-type DNA polymerase [Ralstonia eutropha H16]
 gi|113526870|emb|CAJ93215.1| Putative DNA polymerase bacteriophage-type,uracil-DNA glycosylase
           superfamily [Ralstonia eutropha H16]
          Length = 289

 Score =  182 bits (462), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 46/198 (23%), Positives = 82/198 (41%), Gaps = 6/198 (3%)

Query: 60  HSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSD 119
                Q     A  +     L + +     C LC    +T+        + M++G  P +
Sbjct: 88  EPGSAQADREAAIASMEWPALDAAVAGCTACGLCQHRTNTVFGVGDRQAEWMLVGEAPGE 147

Query: 120 SDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPII 178
           ++++ G+PF G+ G +LD ML ++ + R   + I+ +    PPGNRN    E+  C P +
Sbjct: 148 NEDLQGEPFVGQAGKLLDNMLGALGLARGRNVFIANVLKCRPPGNRNPEPEEVAQCEPFL 207

Query: 179 MRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELI 238
            RQI L+ P +++ +G                +  G   +       IP + T HP  L+
Sbjct: 208 RRQIALVKPSVIVVLGRFAAQSLL-RSTTPIGKLRGTVHSYE----GIPVVVTYHPAYLL 262

Query: 239 QYPLIKKNTWHALITLKK 256
           +    K   W  L   ++
Sbjct: 263 RTLTDKARAWEDLCLARE 280


>gi|288574896|ref|ZP_06393253.1| phage SPO1 DNA polymerase-related protein [Dethiosulfovibrio
           peptidovorans DSM 11002]
 gi|288570637|gb|EFC92194.1| phage SPO1 DNA polymerase-related protein [Dethiosulfovibrio
           peptidovorans DSM 11002]
          Length = 206

 Score =  182 bits (461), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 49/190 (25%), Positives = 88/190 (46%), Gaps = 10/190 (5%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L  L   + S   C LC      +         LM +G  P + ++ SG PF G+ G +L
Sbjct: 15  LARLSHEVSSCRRCDLCKERTQPVLGEGPPDAALMFVGEGPGEDEDRSGIPFVGRAGRLL 74

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
           DK+L++ +I R  ++I+ +    PP NR     E  +C+  +  QI +I+P+I++ +GN 
Sbjct: 75  DKILEAAKIDRKGVYITNVVKCRPPKNRTPMVEETMVCQRFLEAQIAVINPRIIVCLGNT 134

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKK-----NTWHAL 251
              +F    ++   +  G+W +       I  +   HP  L++    KK      TW  +
Sbjct: 135 PMKWFLG-TSEGITKLRGQWFSW----KGIDVMPMFHPSYLLRNESRKKNSPKALTWRDI 189

Query: 252 ITLKKALKNL 261
           + +++ L  L
Sbjct: 190 LEVRRRLDEL 199


>gi|332531590|ref|ZP_08407487.1| putative DNA polymerase-like protein [Hylemonella gracilis ATCC
           19624]
 gi|332038953|gb|EGI75382.1| putative DNA polymerase-like protein [Hylemonella gracilis ATCC
           19624]
          Length = 283

 Score =  182 bits (461), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 51/270 (18%), Positives = 101/270 (37%), Gaps = 32/270 (11%)

Query: 19  YADSGVYWVFDEPNNEATYESQRKEKSIDSAIQ---------------------PITNIR 57
             + GV      P +  +           +  +                     P+    
Sbjct: 11  LEEMGVRVW--APRDAVSAPETAPAPPFQNLPEGSREGQAAPRPAAPRVPPTQVPVPVAM 68

Query: 58  HIHSPLVQQADSIAQ--KACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGY 115
                 V  +  +     A    +L++ +     C LC +  +T+          +I+G 
Sbjct: 69  VSDRAAVAPSRDLPADIAAMGWDDLEAAVAGCQACGLCKSRKNTVFGVGQRQARWLIVGE 128

Query: 116 TPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR------TQIHISMISPWHPPGNRNLSNI 169
            P +++++ G+PF G+ G +LD ML+++   R        ++I+ +    PPGNRN +  
Sbjct: 129 APGENEDLQGEPFVGQAGKLLDNMLKTLGRSRTSDDEAQSVYIANVLKCRPPGNRNPAPE 188

Query: 170 EMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKT-YQNLGKWSNLCTPHSIIPT 228
           E+  C P + RQ+ L+ P+I+L +G         +         LG+       +  +P 
Sbjct: 189 EVLQCEPYLRRQVALLQPRIILALGRFAVQSLLQHSVPDVATLPLGRLRGQVYRYEGVPV 248

Query: 229 LATVHPQELIQYPLIKKNTWHALITLKKAL 258
           + + HP  L++ P  K   W  L   +  +
Sbjct: 249 VVSYHPAYLLRTPQDKAKAWDDLCLAQSLM 278


>gi|170696493|ref|ZP_02887618.1| phage SPO1 DNA polymerase-related protein [Burkholderia graminis
           C4D1M]
 gi|170138596|gb|EDT06799.1| phage SPO1 DNA polymerase-related protein [Burkholderia graminis
           C4D1M]
          Length = 390

 Score =  182 bits (461), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 55/246 (22%), Positives = 90/246 (36%), Gaps = 19/246 (7%)

Query: 26  WVFDEPNNEATYESQRKEKSIDSAIQP----------ITNIRHIHSPLVQQADSIAQKAC 75
              DEP   A  +  R  +       P            +               A    
Sbjct: 142 AASDEP---AVAQPPRPSEPSSFDAPPDDGFAWFDDLPLHPPGEGDADAAMPALPAIDTL 198

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
               L   + +   C LC     T+        D M+IG  P ++++  G+PF G+ G +
Sbjct: 199 DWDALSERVSTCERCRLCEKRTKTVFGVGDRNADWMLIGEAPGENEDRVGEPFVGQAGKL 258

Query: 136 LDKMLQSIEIMRTQI-HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           LD ML+S+ + R    +I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G
Sbjct: 259 LDNMLRSLTLARDSNVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVALVKPKLIVALG 318

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITL 254
                     DA       G+          +P + T HP  L++    K   W  L   
Sbjct: 319 RFAAQSLLKTDA-SISSLRGRVHEYE----GVPVIVTYHPAYLLRSLPDKAKAWADLCLA 373

Query: 255 KKALKN 260
           +   + 
Sbjct: 374 RDTWRE 379


>gi|167590014|ref|ZP_02382402.1| phage SPO1 DNA polymerase-related protein [Burkholderia ubonensis
           Bu]
          Length = 307

 Score =  182 bits (461), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 54/253 (21%), Positives = 97/253 (38%), Gaps = 22/253 (8%)

Query: 21  DSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSP----------------LV 64
           D+G   +     + A      ++ +    + P  + R +                     
Sbjct: 29  DAGTPPLEAHAPSAAGERIASRQAARTDDVAPPADARPVEDDDFAWFDAAPPADPAPVAE 88

Query: 65  QQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNIS 124
            +A            L + +     C LC    +T+        D M++G  P ++++  
Sbjct: 89  LRAAETPVAELDWDALAARVADCTRCRLCEKRTNTVFGVGDREADWMLVGEAPGENEDKQ 148

Query: 125 GKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIE 183
           G+PF G+ G +LD MLQS+ + R   ++I+ +    PPGNRN    E+  C P + RQ+ 
Sbjct: 149 GEPFVGQAGKLLDNMLQSLSLERGANVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVA 208

Query: 184 LISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLI 243
           L+ PK+++ +G          DA       G+          +P + T HP  L++    
Sbjct: 209 LVKPKLIVALGRFAAQTLLKTDASIAS-LRGRVHAYE----GVPVIVTYHPAYLLRSLQD 263

Query: 244 KKNTWHALITLKK 256
           K   W  L   + 
Sbjct: 264 KSKAWADLCLARD 276


>gi|218295021|ref|ZP_03495857.1| phage SPO1 DNA polymerase-related protein [Thermus aquaticus
           Y51MC23]
 gi|218244224|gb|EED10749.1| phage SPO1 DNA polymerase-related protein [Thermus aquaticus
           Y51MC23]
          Length = 204

 Score =  182 bits (461), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 54/192 (28%), Positives = 92/192 (47%), Gaps = 11/192 (5%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L  L++  ++   C L       +        +LMI+G  P + ++ +G PF GK G +
Sbjct: 2   TLEVLEAQAKACTACRLAEGRTQVVFGEGNPDANLMIVGEGPGEEEDKTGHPFVGKAGQL 61

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEIC-RPIIMRQIELISPKILLFIG 194
           L+++L++  I R +I+I+ I    PPGNR     E +IC    +++QIELI+P+I++ +G
Sbjct: 62  LNRILEAAGIRREEIYITNIVKCRPPGNRAPLPDEAKICTDRWLLKQIELIAPQIIVPLG 121

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLI-----KKNTWH 249
                FF         +  G+W         I      HP  L++ P       K  TW 
Sbjct: 122 AVAAEFFLGEK-VSITKVRGQWYEW----HGIKVFPMFHPAYLLRNPSRAPGSPKHLTWL 176

Query: 250 ALITLKKALKNL 261
            +  +K+AL+ L
Sbjct: 177 DIQEVKRALQAL 188


>gi|117926680|ref|YP_867297.1| phage SPO1 DNA polymerase-related protein [Magnetococcus sp. MC-1]
 gi|117610436|gb|ABK45891.1| phage SPO1 DNA polymerase-related protein [Magnetococcus sp. MC-1]
          Length = 300

 Score =  182 bits (461), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 57/226 (25%), Positives = 100/226 (44%), Gaps = 6/226 (2%)

Query: 35  ATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCS 94
           A   ++R       A     +   I +P  Q  +  A KA +L  +    ++   C LC 
Sbjct: 73  AAAPAKRPRLPQPVAPAHKPDETPIVTPP-QPLNLPAGKAAALEHIAQHCQACQRCDLCR 131

Query: 95  TSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISM 154
           T    +         ++ +G  P   ++  G+PF G  G +LD+M+ +I + R  ++I+ 
Sbjct: 132 TRTQAVPGIGHPDAPVVFVGEAPGAEEDRIGQPFVGPAGQLLDRMMATIGLQREHVYIAN 191

Query: 155 ISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLG 214
           +    PPGNRN    E+ +C+  + +Q+E+ISPK++  +G         +          
Sbjct: 192 VVKCRPPGNRNPQTHEVALCQGYLHQQLEVISPKVIFALGRFAIQSLLGSTDSVAAIRR- 250

Query: 215 KWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
                      IP LA+ HP   ++ P  KK+ W  LI L++ L+N
Sbjct: 251 ----HEHSWRGIPVLASYHPAFYLRTPTRKKDGWLDLIRLQQLLEN 292


>gi|224372523|ref|YP_002606895.1| uracil-DNA glycosylase [Nautilia profundicola AmH]
 gi|223588852|gb|ACM92588.1| uracil-DNA glycosylase [Nautilia profundicola AmH]
          Length = 210

 Score =  181 bits (460), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 50/186 (26%), Positives = 85/186 (45%), Gaps = 6/186 (3%)

Query: 74  ACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTG 133
              L EL+ +  +   C L  T    +        DLM IG  P   ++ +G+PF G+ G
Sbjct: 30  PKELDELEKICLNCTLCDLSKTRTHVVFGEGNPNADLMFIGEGPGAEEDKTGRPFVGRAG 89

Query: 134 NML-DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLF 192
            +L   +L  +E+ R  ++I+ I    PP NR  +  E E C+P +++QI++I+PKIL+ 
Sbjct: 90  KLLTKIILNVLELTREDVYIANIVKCRPPNNRVPTIEEAETCKPYLLKQIDIINPKILVC 149

Query: 193 IGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALI 252
           +G      +  N      +  G+             + T HP  L++ P  KK  +   +
Sbjct: 150 LGKTAF-MYLMNTDMPISKVRGQIFEFKEK----KVIPTFHPSFLLRNPSAKKEAYKDFL 204

Query: 253 TLKKAL 258
            +K  L
Sbjct: 205 LIKSML 210


>gi|226227093|ref|YP_002761199.1| putative DNA glycosylase [Gemmatimonas aurantiaca T-27]
 gi|226090284|dbj|BAH38729.1| putative DNA glycosylase [Gemmatimonas aurantiaca T-27]
          Length = 293

 Score =  181 bits (460), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 50/235 (21%), Positives = 96/235 (40%), Gaps = 10/235 (4%)

Query: 30  EPNNEATYESQRKEKSIDSAIQ-----PITNIRHIHSPLVQQADSIAQKACSLHELKSLL 84
            P       + R  +S+           I       +P          +  +L +L   +
Sbjct: 47  APVKRTAPAAGRVAESVAQLPAWLEALGIPAGLEAGAPQPTSVAPDIAQLPTLEQLAQHV 106

Query: 85  RSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIE 144
                C L +++ + +        D + +G  P  +++  G+PF G  G +L K+L +I+
Sbjct: 107 AGCQRCALHASAKNPVPGEGNPEADFLCVGEAPGANEDAQGRPFVGDAGQLLTKILGAIQ 166

Query: 145 IMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNN 204
           + R  ++I  +    PPGNR+    E++ C+P ++RQIEL+ PK++L +G          
Sbjct: 167 LSRESVYICNVLKHRPPGNRDPLPDEVQACQPYLLRQIELVRPKVILALGRFAAQTLLQ- 225

Query: 205 DAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALK 259
                    G+          +P + T HP  L++    K+ TW  +   ++ L 
Sbjct: 226 TTTSIGVLRGRIH----RFHGVPLIVTYHPAALLRNESWKRPTWEDVKLARRVLD 276


>gi|46198674|ref|YP_004341.1| uracil-DNA glycosylase [Thermus thermophilus HB27]
 gi|21464612|emb|CAD29336.1| uracil-DNA glycosylase [Thermus thermophilus HB27]
 gi|46196297|gb|AAS80714.1| uracil-DNA glycosylase [Thermus thermophilus HB27]
          Length = 205

 Score =  181 bits (460), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 53/192 (27%), Positives = 90/192 (46%), Gaps = 11/192 (5%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L  L++  ++   C L       +         LMI+G  P + ++ +G+PF GK G +
Sbjct: 2   TLELLQAQAQNCTACRLAEGRTRVVFGEGNPDAKLMIVGEGPGEEEDKTGRPFVGKAGQL 61

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEIC-RPIIMRQIELISPKILLFIG 194
           L+++L++  I R +++I+ I    PP NR     E +IC    +++QIELI+P+I++ +G
Sbjct: 62  LNRILEAAGIPREEVYITNIVKCRPPQNRAPLPDEAKICTDKWLLKQIELIAPQIIVPLG 121

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLI-----KKNTWH 249
                FF         +  GKW         I      HP  L++ P       K  TW 
Sbjct: 122 AVAAEFFLGEK-VSITKVRGKWYEW----HGIKVFPMFHPAYLLRNPSRAPGSPKHLTWL 176

Query: 250 ALITLKKALKNL 261
            +  +K+AL  L
Sbjct: 177 DIQEVKRALDAL 188


>gi|147679076|ref|YP_001213291.1| uracil-DNA glycosylase [Pelotomaculum thermopropionicum SI]
 gi|146275173|dbj|BAF60922.1| uracil-DNA glycosylase [Pelotomaculum thermopropionicum SI]
          Length = 202

 Score =  181 bits (459), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 53/188 (28%), Positives = 87/188 (46%), Gaps = 5/188 (2%)

Query: 75  CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
            SL ELK++  +   C L S     +         LM+IG  P   ++  G+PF GK G 
Sbjct: 16  NSLEELKAMAVACTRCGLRSGCSGVVFGEGNPEARLMLIGEGPGADEDRMGRPFVGKAGQ 75

Query: 135 MLDKMLQSIEIMRTQI-HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFI 193
           +LDK+L++  + R    +I+ +    PPGNR     E   C P + RQIEL+SP I++ +
Sbjct: 76  LLDKILEAAGLERFTHTYIANVVKCRPPGNRVPRPDEAARCLPWLYRQIELVSPGIIVLL 135

Query: 194 GNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALIT 253
           G+       +  A +  +  G+W       S I  + T HP  L++    K+  W     
Sbjct: 136 GSTALQNLIDP-AARITEMRGRWL---VSKSGIKIMPTYHPAALLRDVSKKRPVWEDFQK 191

Query: 254 LKKALKNL 261
           ++   + +
Sbjct: 192 VRDEYRKI 199


>gi|255262434|ref|ZP_05341776.1| uracil-DNA glycosylase [Thalassiobium sp. R2A62]
 gi|255104769|gb|EET47443.1| uracil-DNA glycosylase [Thalassiobium sp. R2A62]
          Length = 270

 Score =  181 bits (459), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 59/265 (22%), Positives = 103/265 (38%), Gaps = 25/265 (9%)

Query: 14  TIALFYADSGVYWV-FDEPNNEATYESQRKEKSIDSA-----------IQPITNIRHIHS 61
            +  +  + GV     D P N     +   +                      +   + +
Sbjct: 12  AMLGWQVELGVDEATLDAPVNRYEIPAAAPKVETQPVELPKAKATPPPAAAAPDPVALAN 71

Query: 62  PLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSD 121
             V  A   AQ A S+  L   + +F  C L   + ST+         +MIIG  P+  +
Sbjct: 72  EAVNAARLAAQNATSIETLTETVNAFEHCELKRGARSTLLGVGAASAPVMIIGEPPNRDE 131

Query: 122 NISGKPFSGKTGNMLDKMLQSIEIMRTQI------HISMISPWHPPGNRNLSNIEMEICR 175
           +  G+ F G  G +LD+ML +I   R          ++ + PW PP     +  E+ +  
Sbjct: 132 DREGRAFVGAAGQLLDRMLAAIGRDRNATDPETGVFVASVMPWRPPNRD-PNATELAMTM 190

Query: 176 PIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQ 235
           P + R +EL+ PKI++ +GN +       +     +  G+W          P L   +P+
Sbjct: 191 PFLERLVELVDPKIVILMGNVSCQAALGRNG--ITRLRGQWLT----GFNRPVLPMFNPE 244

Query: 236 ELIQYPLIKKNTWHALITLKKALKN 260
            L++ P  K+  WH L+ +K  L  
Sbjct: 245 FLLRTPAAKREAWHDLLMVKAKLNE 269


>gi|291296318|ref|YP_003507716.1| phage SPO1 DNA polymerase-related protein [Meiothermus ruber DSM
           1279]
 gi|290471277|gb|ADD28696.1| phage SPO1 DNA polymerase-related protein [Meiothermus ruber DSM
           1279]
          Length = 205

 Score =  181 bits (459), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 51/192 (26%), Positives = 88/192 (45%), Gaps = 11/192 (5%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L  L +  ++   C L       +         LMI+G  P + +++ G+PF G++G +
Sbjct: 2   NLELLAAQAKACTACGLARQRTHVVFGEGNPDAKLMIVGEGPGEDEDLQGRPFVGRSGQL 61

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRP-IIMRQIELISPKILLFIG 194
           LDK+L++  I R  ++I+ I    PPGNR    +E + C    +++QI+L+ P+I++ +G
Sbjct: 62  LDKILEAAGIPRASVYIANIVKCRPPGNRAPEPLEAKTCTSLWLVKQIQLVKPQIIIPLG 121

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLI-----KKNTWH 249
                FF         +  GK+         I      HP  L++ P       K  TW 
Sbjct: 122 ATALEFFAGEKL-SITKARGKFFEWQ----GIRIFPMFHPAYLLRNPSREAGSPKHLTWQ 176

Query: 250 ALITLKKALKNL 261
            +  +KK L  L
Sbjct: 177 DIQLVKKTLDEL 188


>gi|186476121|ref|YP_001857591.1| phage SPO1 DNA polymerase-like protein [Burkholderia phymatum
           STM815]
 gi|184192580|gb|ACC70545.1| phage SPO1 DNA polymerase-related protein [Burkholderia phymatum
           STM815]
          Length = 341

 Score =  181 bits (459), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 48/205 (23%), Positives = 86/205 (41%), Gaps = 6/205 (2%)

Query: 53  ITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMI 112
                        +             L++ + +   C LC    +T+        D M+
Sbjct: 129 PAGPPSDLEANTSEPVQPGIDTLDWAALEARVSACERCRLCERRTNTVFGVGDREADWML 188

Query: 113 IGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEM 171
           IG  P ++++  G+PF G+ G +LD ML+S+ + R T ++I+ +    PPGNRN    E+
Sbjct: 189 IGEAPGENEDKQGEPFVGQAGKLLDNMLRSLGLARGTNVYIANVIKCRPPGNRNPERDEV 248

Query: 172 EICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLAT 231
             C P + RQ+ L+ PK+++ +G          +A       G+          +P + T
Sbjct: 249 ARCEPYLQRQVALVKPKLIIALGRFAAQSLLKTEA-SISSLRGRVYEYE----GVPVVVT 303

Query: 232 VHPQELIQYPLIKKNTWHALITLKK 256
            HP  L++    K  +W  L   + 
Sbjct: 304 YHPAYLLRSLGDKAKSWQDLCLARD 328


>gi|152992742|ref|YP_001358463.1| uracil-DNA glycosylase [Sulfurovum sp. NBC37-1]
 gi|151424603|dbj|BAF72106.1| uracil-DNA glycosylase [Sulfurovum sp. NBC37-1]
          Length = 222

 Score =  181 bits (458), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 52/188 (27%), Positives = 94/188 (50%), Gaps = 6/188 (3%)

Query: 74  ACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTG 133
             +L  L+    + H C L  +    +        D++IIG  P  +++ +GKPF G++G
Sbjct: 39  PDTLDSLQKQAINCHLCDLSKSRQKVVFGEGNPHADILIIGEGPGATEDSTGKPFVGRSG 98

Query: 134 NMLDKMLQSI-EIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLF 192
            +L KML+++  + R  ++I+ I    PP NR  +  E   C+P +++QIELI PK++L 
Sbjct: 99  ELLSKMLENVLGLKRADVYITNIVKCRPPNNRAPTPTEAHTCQPYLLKQIELIKPKLILT 158

Query: 193 IGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALI 252
           +G    ++   +D     +  G        H     + T HP  L++ P  KK  +  L+
Sbjct: 159 LGATAYHYLTGDDT-GITKVRGSIH----KHGNATLIPTYHPSYLLRNPSAKKEVFEDLL 213

Query: 253 TLKKALKN 260
            +K+ +K+
Sbjct: 214 KVKELMKS 221


>gi|295676848|ref|YP_003605372.1| phage SPO1 DNA polymerase-related protein [Burkholderia sp.
           CCGE1002]
 gi|295436691|gb|ADG15861.1| phage SPO1 DNA polymerase-related protein [Burkholderia sp.
           CCGE1002]
          Length = 332

 Score =  181 bits (458), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 56/242 (23%), Positives = 90/242 (37%), Gaps = 18/242 (7%)

Query: 28  FDEPNNEATYESQRKEKSIDSAIQ------------PITNIRHIHSPLVQQADSIAQKAC 75
           FDE          + + S   A              P  +               A    
Sbjct: 82  FDETAARRETSQPQPDFSAPPAFDAPLDDDFAWFDDPTASTPAPAEARRAAPALPAVHTL 141

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
               L   +     C LC    +T+        D M+IG  P ++++  G+PF G+ G +
Sbjct: 142 DWDALAERVAGCEACRLCEKRTNTVFGVGDREADWMLIGEAPGENEDRQGEPFVGQAGKL 201

Query: 136 LDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           LD ML S+ + R T ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G
Sbjct: 202 LDNMLHSLALARGTNVYIANVIKCRPPGNRNPQPDEVARCEPYLQRQVSLVKPKLIVALG 261

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITL 254
                     DA       G+          +P + T HP  L++    K   W  L   
Sbjct: 262 RFAAQSLLKTDA-SISSLRGRVHTYE----GVPVIVTYHPAYLLRSLPDKAKAWTDLCLA 316

Query: 255 KK 256
           + 
Sbjct: 317 RA 318


>gi|294339041|emb|CAZ87390.1| putative Uracil-DNA glycosylase [Thiomonas sp. 3As]
          Length = 286

 Score =  181 bits (458), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 58/229 (25%), Positives = 97/229 (42%), Gaps = 12/229 (5%)

Query: 35  ATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKAC-SLHELKSLLRSFHDCHLC 93
           AT  + +         +PI   R   S  +  A  I   A     EL++  ++   C L 
Sbjct: 47  ATPAAAKPVAQPPKPNRPIPPPRPASSIPITDAARIEAIARMDWDELQAGAQACRACKLG 106

Query: 94  STSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQI--- 150
           S+    +  + +     MIIG  P   ++  G+PF G  G +LD MLQ+I + R+     
Sbjct: 107 SSRHQAVFGSGSTQARWMIIGEAPGAEEDRQGQPFVGAAGQLLDAMLQAIGLDRSADDPE 166

Query: 151 ---HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQ 207
              +I+ +    PPGNRN    E+  C P + RQ+ L+ P+++L +G    +    + A 
Sbjct: 167 RAVYIANVLKCRPPGNRNPEPEEVAQCAPWLERQVALLQPQLILALGRFAAHSLLGSQA- 225

Query: 208 KTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
              Q  G+          +P + + HP  L++ P  K   W  L   + 
Sbjct: 226 PISQLRGQVHEFA----GVPVIVSYHPAYLLRNPADKARVWRDLCFARD 270


>gi|323526514|ref|YP_004228667.1| phage SPO1 DNA polymerase-like protein [Burkholderia sp. CCGE1001]
 gi|323383516|gb|ADX55607.1| phage SPO1 DNA polymerase-related protein [Burkholderia sp.
           CCGE1001]
          Length = 344

 Score =  181 bits (458), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 56/238 (23%), Positives = 95/238 (39%), Gaps = 16/238 (6%)

Query: 34  EATYESQRKEKSIDSAIQPITNI-------RHIHSPLVQQADSIAQKA---CSLHELKSL 83
            A + ++    S  S+     +          +H P    A   A  A        L   
Sbjct: 94  RAPHVAEPPATSEPSSFGAPPDDGFAWFDDLPLHPPGEAHAAVPALPAIHTLDWDALSER 153

Query: 84  LRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSI 143
           + +   C LC      +        D M+IG  P ++++  G+PF G+ G +LD ML+S+
Sbjct: 154 VANCERCRLCEKRTQAVFGVGDRNADWMLIGEAPGENEDRVGEPFVGQAGKLLDNMLRSL 213

Query: 144 EIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFF 202
            + R   ++I+ +    PPGNRN    E+  C P + RQ+EL+ PK+++ +G        
Sbjct: 214 TLARGANVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVELVKPKLIVALGRFAAQSLL 273

Query: 203 NNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
             DA       G+          +P + T HP  L++    K   W  L   +   + 
Sbjct: 274 KTDA-SISSLRGRVHQYE----GVPVIVTYHPAYLLRSLPDKAKAWADLCLARDTWRE 326


>gi|325972111|ref|YP_004248302.1| phage SPO1 DNA polymerase-related protein [Spirochaeta sp. Buddy]
 gi|324027349|gb|ADY14108.1| phage SPO1 DNA polymerase-related protein [Spirochaeta sp. Buddy]
          Length = 249

 Score =  180 bits (457), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 51/185 (27%), Positives = 87/185 (47%), Gaps = 6/185 (3%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           ++ +L++L+     C LC T    +    +    LM+IG  P   ++ SGKPF GK G  
Sbjct: 63  NVRQLEALVALCTKCRLCETRKQVVFGEGSIPARLMVIGEGPGFEEDASGKPFVGKAGKY 122

Query: 136 LDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           LD  L +I + R+  ++I+ I    PP NR+    E++ C P + RQI+L+ P+I+L +G
Sbjct: 123 LDSWLGAIHMDRSNAVYIANIVKCRPPENRDPEVDEVQACLPYLKRQIQLVKPQIILLVG 182

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITL 254
           +                  GK       +  +P + T HP  +++   +K+  W  L  +
Sbjct: 183 SVAARSLLGVSDGV-----GKLRGRFLRYEDVPVVVTYHPAAVLRNMELKRPVWDDLKKI 237

Query: 255 KKALK 259
              L 
Sbjct: 238 AAYLD 242


>gi|239616610|ref|YP_002939932.1| phage SPO1 DNA polymerase-related protein [Kosmotoga olearia TBF
           19.5.1]
 gi|239505441|gb|ACR78928.1| phage SPO1 DNA polymerase-related protein [Kosmotoga olearia TBF
           19.5.1]
          Length = 207

 Score =  180 bits (457), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 43/185 (23%), Positives = 86/185 (46%), Gaps = 8/185 (4%)

Query: 82  SLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQ 141
             +   + C L  T  + +    +    ++ +G  P   ++ +G+PF G+ G +L K+L+
Sbjct: 16  RKIEECNLCPLHLTRTNVVPGEGSLDSPVVFVGEGPGADEDATGRPFVGRAGKLLTKILE 75

Query: 142 SIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFF 201
           S+ + R  ++I+ I    PP NR  +  EM+ C P ++ Q+ +I PK+++ +G      F
Sbjct: 76  SVGLSREDVYITNIVKCRPPNNRTPTLQEMKACEPYLLSQLAVIKPKLIVCLGATALAAF 135

Query: 202 FNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLI-----KKNTWHALITLKK 256
             ++  +  +  GK  +    H  I      HP  L++ P       K+ TW  +  ++K
Sbjct: 136 LESEKVQITKYRGKLFDW---HGGIKVFGMFHPSYLLRNPSTAPGSPKRLTWEDIQKVRK 192

Query: 257 ALKNL 261
               +
Sbjct: 193 MYDQV 197


>gi|119898004|ref|YP_933217.1| DNA-directed DNA polymerase [Azoarcus sp. BH72]
 gi|119670417|emb|CAL94330.1| DNA-directed DNA polymerase [Azoarcus sp. BH72]
          Length = 283

 Score =  180 bits (457), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 48/185 (25%), Positives = 83/185 (44%), Gaps = 6/185 (3%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
             EL++ +R+   C LC      +         +M +G  P   ++  G+PF G+ G +L
Sbjct: 101 WDELEADIRACTACALCQRRKQAVPGVGDREARVMFVGEGPGAEEDQRGEPFVGQAGKLL 160

Query: 137 DKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           D ML +I + R + ++I+      PP NR     E+  C P + RQI L+ P++L+ +G 
Sbjct: 161 DNMLAAIGLRRGEGVYIANSVKCRPPLNRTPEAGEIATCLPYLERQIALVQPRLLVALGR 220

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
                  + +     +  G+        + IP L T HP  L++ P  K   W  L  ++
Sbjct: 221 PAAQSLLDTE-IAITKARGRAFE----RAGIPVLVTYHPAYLLRNPQDKAKAWEDLCLVR 275

Query: 256 KALKN 260
           + L  
Sbjct: 276 RTLAQ 280


>gi|297566593|ref|YP_003685565.1| phage SPO1 DNA polymerase-like protein [Meiothermus silvanus DSM
           9946]
 gi|296851042|gb|ADH64057.1| phage SPO1 DNA polymerase-related protein [Meiothermus silvanus DSM
           9946]
          Length = 205

 Score =  180 bits (457), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 51/192 (26%), Positives = 86/192 (44%), Gaps = 11/192 (5%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L  L +  +    C L  T    +         + I+G  P + ++ +G+PF GK G +
Sbjct: 2   NLELLAAQAQVCTACRLAKTRTKVVFGEGNPDAKVFIVGEGPGEEEDKTGRPFVGKAGQL 61

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRP-IIMRQIELISPKILLFIG 194
           LD++L++  I R  I+IS I    PP NR     E++ C    + +Q+ELI P+I++ +G
Sbjct: 62  LDRILEAAGIPRESIYISNIVKCRPPQNRVPLPDEVKACTSLWLNKQLELIRPQIIVPLG 121

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLI-----KKNTWH 249
                FF         +  G+W +       I      HP  L++ P       K  TW 
Sbjct: 122 ATAAEFFLGEK-VSITKIRGQWMDW----HGILLFPMFHPAYLLRNPSRAAGSPKHLTWL 176

Query: 250 ALITLKKALKNL 261
            +  LK+ + +L
Sbjct: 177 DIQALKQKMDSL 188


>gi|196228387|ref|ZP_03127254.1| phage SPO1 DNA polymerase-related protein [Chthoniobacter flavus
           Ellin428]
 gi|196227790|gb|EDY22293.1| phage SPO1 DNA polymerase-related protein [Chthoniobacter flavus
           Ellin428]
          Length = 302

 Score =  180 bits (457), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 47/231 (20%), Positives = 97/231 (41%), Gaps = 14/231 (6%)

Query: 40  QRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCH-LCSTSLS 98
           +   + + +A +        H    + A     KA  L  ++  + +   C  L  +   
Sbjct: 65  KPASEPVKAAARVSETAPVSHYDGPRMAPLEGSKAERLAAMRGPVLACTKCPHLVKSRTQ 124

Query: 99  TICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPW 158
            +        +LM +G  P + ++  G+PF GK G +L K+++++   R  ++I+ +   
Sbjct: 125 VVFGVGNPEAELMFVGEAPGEDEDRQGEPFVGKAGQLLTKIIETMGFARGDVYIANVLKC 184

Query: 159 H------PPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQN 212
                   PGNR     EM+ C P +  QI++I P++L+ +G         +      + 
Sbjct: 185 RPDMPPGMPGNRKPKVEEMQTCLPYLREQIDIIRPRLLVALGATAMEGLTGST-DSMSRL 243

Query: 213 LGKWSNLCTPHSIIPTLATVHPQELIQYPLI--KKNTWHALITLKKALKNL 261
            G+W +        P +AT HP  L++   +  K+  W  ++ + + L  +
Sbjct: 244 RGRWHDF----HGTPLMATYHPAYLLRNQSLSEKRKVWEDMLMVLERLGKM 290


>gi|55980687|ref|YP_143984.1| uracil-DNA glycosylase [Thermus thermophilus HB8]
 gi|38493048|pdb|1UI0|A Chain A, Crystal Structure Of Uracil-Dna Glycosylase From Thermus
           Thermophilus Hb8
 gi|32698481|dbj|BAC79245.1| uracil-DNA glycosylase [Thermus thermophilus]
 gi|55772100|dbj|BAD70541.1| uracil-DNA glycosylase [Thermus thermophilus HB8]
          Length = 205

 Score =  180 bits (456), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 53/192 (27%), Positives = 90/192 (46%), Gaps = 11/192 (5%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L  L++  ++   C L       +         LMI+G  P + ++ +G+PF GK G +
Sbjct: 2   TLELLQAQAQNCTACRLMEGRTRVVFGEGNPDAKLMIVGEGPGEEEDKTGRPFVGKAGQL 61

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEIC-RPIIMRQIELISPKILLFIG 194
           L+++L++  I R +++I+ I    PP NR     E +IC    +++QIELI+P+I++ +G
Sbjct: 62  LNRILEAAGIPREEVYITNIVKCRPPQNRAPLPDEAKICTDKWLLKQIELIAPQIIVPLG 121

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLI-----KKNTWH 249
                FF         +  GKW         I      HP  L++ P       K  TW 
Sbjct: 122 AVAAEFFLGEK-VSITKVRGKWYEW----HGIKVFPMFHPAYLLRNPSRAPGSPKHLTWL 176

Query: 250 ALITLKKALKNL 261
            +  +K+AL  L
Sbjct: 177 DIQEVKRALDAL 188


>gi|189426388|ref|YP_001953565.1| phage SPO1 DNA polymerase-related protein [Geobacter lovleyi SZ]
 gi|189422647|gb|ACD97045.1| phage SPO1 DNA polymerase-related protein [Geobacter lovleyi SZ]
          Length = 249

 Score =  180 bits (456), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 48/254 (18%), Positives = 102/254 (40%), Gaps = 27/254 (10%)

Query: 9   QEQILTIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQAD 68
              +        +SGV  +  E   +    ++ +E       QP+  +            
Sbjct: 10  YASVREYLQELEESGVDGLPFEELQQTV--NRGREPEQQRQEQPLPAVLQG--------- 58

Query: 69  SIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPF 128
                   L  L+  +     C L  +  + +     E   L+ +G  P   ++  G+PF
Sbjct: 59  --------LEGLRRKIGDCQRCDLAQSRTNLVFGAGPEKARLVFVGEAPGADEDRQGQPF 110

Query: 129 SGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPK 188
            G+ G +L ++++++ + RTQ++I  +    PP NRN    E+  C P + +Q+++I P+
Sbjct: 111 VGEAGQVLTRLIEAMGLKRTQVYICNVLKCRPPANRNPHKDEIATCSPFLQQQLQIIKPE 170

Query: 189 ILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKK--- 245
           +++ +G            +   +  G++ +       IP + T HP  L+     K+   
Sbjct: 171 VIVALGTFAAQTLL-ETKEPISRMRGQFHSW----HGIPVMPTFHPSFLLHNKENKQHYW 225

Query: 246 NTWHALITLKKALK 259
           + W  +  + + LK
Sbjct: 226 DVWSDMEQVLRKLK 239


>gi|240141067|ref|YP_002965547.1| putative phage DNA polymerase [Methylobacterium extorquens AM1]
 gi|240011044|gb|ACS42270.1| putative phage DNA polymerase [Methylobacterium extorquens AM1]
          Length = 337

 Score =  180 bits (456), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 80/329 (24%), Positives = 129/329 (39%), Gaps = 71/329 (21%)

Query: 1   MTSKRILSQE--QILTIALFYADSGVYWVFDE-PNNEATYE------------------- 38
           MT+    +     +++   F+  +GV  V DE P++                        
Sbjct: 4   MTANHADTDARGDLISYLDFHVAAGVDAVLDEQPHDRFAEAESVRAEAALQAEPATRREP 63

Query: 39  -------------------------SQRKEKSIDSAIQPI----TNIRHIHSPLVQQADS 69
                                    S+  ++   SA +P       +    +P  +   +
Sbjct: 64  LESRREPLEPRREPLPPRREALEPRSESPQRDAPSAEEPPLAFRRELPSRDAPAREPPRT 123

Query: 70  IAQKA------------------CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLM 111
               A                   +L EL+ LLR F  C L  T+ + + A       +M
Sbjct: 124 YGNAAGAKPGEAADDARARAAQMKTLEELEELLRGFEGCGLRFTAKNLVFADGNPQARVM 183

Query: 112 IIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEM 171
            +G  P   ++  GKPF G++G +LD+M+ +I + RT  +IS + PW PPGNRN +  E+
Sbjct: 184 FVGEAPGADEDRIGKPFMGRSGQLLDRMMAAIGLDRTSAYISNVVPWRPPGNRNPTPQEI 243

Query: 172 EICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTP-HSIIPTLA 230
            ICRP + RQIEL +P IL+ +G                +  G++          I  LA
Sbjct: 244 SICRPFVERQIELANPDILVCLGAPATQTLTGTK-DGILKARGRFYPYRLGDGREIRALA 302

Query: 231 TVHPQELIQYPLIKKNTWHALITLKKALK 259
           T+HP  L++ P+ K+  W     LK AL 
Sbjct: 303 TLHPAYLLRQPVQKRLAWRDFRMLKSALD 331


>gi|223935707|ref|ZP_03627623.1| phage SPO1 DNA polymerase-related protein [bacterium Ellin514]
 gi|223895715|gb|EEF62160.1| phage SPO1 DNA polymerase-related protein [bacterium Ellin514]
          Length = 307

 Score =  180 bits (456), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 56/240 (23%), Positives = 99/240 (41%), Gaps = 16/240 (6%)

Query: 30  EPNNEATYESQRKEKSIDSAIQPIT--NIRHIHSPLVQQADSIAQKACSLHELKSLLRSF 87
            P       +         A++P     I    +P+     S   K  +  +L+S   S 
Sbjct: 58  APAVRQAVVAPVPAPVEIPAVKPAALFPISPAETPITVAPLSPEAKVAAFADLRSRAMSC 117

Query: 88  HDC-HLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIM 146
             C HL ++  + +    +    LM +G  P   ++  G+PF GK G +L K++Q++ + 
Sbjct: 118 VKCAHLAASRKNVVFGVGSIDAQLMFVGEAPGADEDEQGEPFVGKAGQLLTKIIQTMGLQ 177

Query: 147 RTQIHISMISPWHPP------GNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNF 200
           R  ++I+ I    P       GNR  ++ EM  C P +  QI+LI PK+L+ +G      
Sbjct: 178 RGDVYIANILKCRPDTPGQSAGNRKPTSEEMATCIPYLHEQIDLIRPKVLVALGATAVEG 237

Query: 201 FFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP--LIKKNTWHALITLKKAL 258
                     +  G W+        IP + T HP  L++      K+  W  ++ + + L
Sbjct: 238 LLG-KTVGITKLRGTWNTY----RGIPLMPTYHPAYLLRNQAMSEKRRVWEDMLAVMEKL 292


>gi|169830501|ref|YP_001716483.1| phage SPO1 DNA polymerase-like protein [Candidatus Desulforudis
           audaxviator MP104C]
 gi|169637345|gb|ACA58851.1| phage SPO1 DNA polymerase-related protein [Candidatus Desulforudis
           audaxviator MP104C]
          Length = 207

 Score =  180 bits (456), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 42/190 (22%), Positives = 86/190 (45%), Gaps = 5/190 (2%)

Query: 72  QKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGK 131
               +L +L+ ++    +C L +   + +         LM+IG  P   ++  G+PF G 
Sbjct: 15  DGPQALEDLREMMSDCRECGLHAGRTNLVFGEGHPRARLMLIGEGPGAEEDRLGRPFVGA 74

Query: 132 TGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILL 191
            G +LD++L +  + RT+++I+ +    PPGNR  +  E + C   + +Q  LI P +++
Sbjct: 75  AGRLLDRILDAAGLARTEVYIANVVKCRPPGNRVPNREEAQACLRWLRKQFSLIGPPLVV 134

Query: 192 FIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
            +G+       +          G+W         +  + T HP  L++ P  K++ W   
Sbjct: 135 ILGSTALKNLIDP-GASITAWRGQWIV----RGRVRFMPTYHPAALLRDPGKKRDVWRDF 189

Query: 252 ITLKKALKNL 261
             ++ A + +
Sbjct: 190 QLIRDAYREI 199


>gi|87306738|ref|ZP_01088885.1| DNA polymerase, bacteriophage-type [Blastopirellula marina DSM
           3645]
 gi|87290917|gb|EAQ82804.1| DNA polymerase, bacteriophage-type [Blastopirellula marina DSM
           3645]
          Length = 282

 Score =  180 bits (456), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 38/198 (19%), Positives = 75/198 (37%), Gaps = 6/198 (3%)

Query: 60  HSPLVQQADSIAQKACSLHELKSLLRSFHDCH-LCSTSLSTICATQTEGQDLMIIGYTPS 118
            +           +   L  L + +     C  L  T   T+         +   G  P 
Sbjct: 80  RAAPPVLNTDHGGRQQQLDVLAAEVAKCVLCEELACTRTQTVFGVGNPNARICFFGEAPG 139

Query: 119 DSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPII 178
             ++  G+PF G+ G +L +++++    R  ++I       PPGNRN +  E   C P  
Sbjct: 140 ADEDKQGEPFVGRAGKLLTQIIEACTFQREDVYILNTLKCRPPGNRNPTPEENANCMPYF 199

Query: 179 MRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELI 238
            +Q+ +I P  ++ +G          +     +  G++ +          +AT HP  L+
Sbjct: 200 EQQLAIIQPDYIVCLGKFAAQNLLKTET-AIGKLRGQFHDY----GGAKVIATYHPAYLL 254

Query: 239 QYPLIKKNTWHALITLKK 256
           + P  K+  W  +  + +
Sbjct: 255 RNPAAKREVWEDMKMMLR 272


>gi|237748493|ref|ZP_04578973.1| DNA polymerase bacteriophage-type [Oxalobacter formigenes OXCC13]
 gi|229379855|gb|EEO29946.1| DNA polymerase bacteriophage-type [Oxalobacter formigenes OXCC13]
          Length = 304

 Score =  180 bits (456), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 48/233 (20%), Positives = 86/233 (36%), Gaps = 9/233 (3%)

Query: 37  YESQRKEKSIDSAIQPITNIRHIHSP---LVQQADSIAQKACSLHELKSLLRSFHDCHLC 93
           +      ++      PI +   +       V    +I     +   L   +     CHLC
Sbjct: 66  FPETLPVEAFADDFPPIPSEMDVSPETGVPVSSPATIPAGGDTWDGLLHEINHCERCHLC 125

Query: 94  STSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHI 152
            +    +     +    + +G  P   ++  G+PF G++G++LD M+ ++ + R   ++I
Sbjct: 126 KSRNKVVPGVGDQHAGWLFVGEGPGFHEDQQGEPFVGRSGHLLDAMMAAMHMKRGENVYI 185

Query: 153 SMISPWH----PPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNN-DAQ 207
           + +           +R  +  E   C P + RQI+LI PKI++ +G        N     
Sbjct: 186 ANVVKCRATNEFAKDRQPTEEEAAFCMPYLERQIDLIKPKIMVALGKTAACALLNTGREV 245

Query: 208 KTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
                  K          IP + T HP  L++ P  KK  W  L T       
Sbjct: 246 TLGSLRNKTHVFRVAGRRIPLIVTYHPSYLLRTPGGKKQAWQDLCTAMDIYDE 298


>gi|330817462|ref|YP_004361167.1| Phage SPO1 DNA polymerase-related protein [Burkholderia gladioli
           BSR3]
 gi|327369855|gb|AEA61211.1| Phage SPO1 DNA polymerase-related protein [Burkholderia gladioli
           BSR3]
          Length = 354

 Score =  179 bits (455), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 46/196 (23%), Positives = 83/196 (42%), Gaps = 6/196 (3%)

Query: 62  PLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSD 121
                A   +       EL++ +     C LC     T+        D M++G  P +++
Sbjct: 155 SAQPAAALASVADLGWDELEARVADCQRCRLCEKRTQTVFGVGDREADWMLVGEAPGENE 214

Query: 122 NISGKPFSGKTGNMLDKMLQSIEIMRTQI-HISMISPWHPPGNRNLSNIEMEICRPIIMR 180
           +  G+PF G+ G +LD ML ++ + R+   +I+ +    PPGNRN    E+  C P + R
Sbjct: 215 DKQGEPFVGQAGKLLDSMLHALSLERSNNVYIANVIKCRPPGNRNPEPDEVARCEPYLQR 274

Query: 181 QIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQY 240
           Q+ L+ PK+++ +G         +D        G+          +P + + HP  L++ 
Sbjct: 275 QVALVKPKLIVALGRFAAQTLLKSDGSIAS-MRGRVHQYE----GVPVIVSYHPAYLLRS 329

Query: 241 PLIKKNTWHALITLKK 256
              K   W  L   + 
Sbjct: 330 LPDKSKAWADLCLARD 345


>gi|30249369|ref|NP_841439.1| putative DNA polymerase-related protein [Nitrosomonas europaea ATCC
           19718]
 gi|30180688|emb|CAD85309.1| putative DNA polymerase-related protein, bacteriophage-type
           [Nitrosomonas europaea ATCC 19718]
          Length = 247

 Score =  179 bits (455), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 59/229 (25%), Positives = 95/229 (41%), Gaps = 6/229 (2%)

Query: 34  EATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLC 93
                + +   S  +    I            +  S +        L+ ++     C L 
Sbjct: 18  RPGAIAGQSPDSGKNMSDQIETAAESRPFEESEDRSTSIAHADWGRLRQMVSGCTACPLS 77

Query: 94  STSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHI 152
            T   T+     E  D + IG  P   ++  G+PF G+ G +LD MLQ++ + R   ++I
Sbjct: 78  QTRKQTVFGVGDEQADWLFIGEGPGAREDELGEPFVGQAGKLLDNMLQAVSLRRGQDVYI 137

Query: 153 SMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQN 212
           + I    PPGNRN  + E E CRP ++RQI LI P++++ +G          DA      
Sbjct: 138 ANIVKCRPPGNRNPQDAEAEQCRPYLLRQIALIQPRLIVALGKVAAQNLLATDASIAS-L 196

Query: 213 LGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
            G+        S IP + T HP  L++    K   W  L   +  ++NL
Sbjct: 197 RGRLHEF----SGIPLIVTYHPAYLLRSLGDKAKAWEDLCFARDTMRNL 241


>gi|254455581|ref|ZP_05069010.1| uracil-DNA glycosylase, C-terminal domain protein [Candidatus
           Pelagibacter sp. HTCC7211]
 gi|207082583|gb|EDZ60009.1| uracil-DNA glycosylase, C-terminal domain protein [Candidatus
           Pelagibacter sp. HTCC7211]
          Length = 239

 Score =  179 bits (455), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 52/192 (27%), Positives = 94/192 (48%), Gaps = 1/192 (0%)

Query: 70  IAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFS 129
           +  KA  L +L+S + S  +C L   S + +         +M+IG  P   ++ SG  F 
Sbjct: 45  LGNKADLLKDLQSEINSIENCSLKDNSKNIVLGDGNINSPIMLIGEAPGIEEDKSGSTFK 104

Query: 130 GKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKI 189
           G+ G +L+KML +I I R  I+ S    + PP +R  + +E++     +   I +I+PKI
Sbjct: 105 GEIGELLNKMLLAIGIKRQNIYCSYAINFRPPEDRKPTTLEIKRYSVFLKEHISIINPKI 164

Query: 190 LLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWH 249
           ++ +G+         + + + +  GKW      +   P + + +P  LI++P  KK +W 
Sbjct: 165 IILMGSSAMEAVTGINTKISSE-RGKWKETILKNKTYPVMISFNPSYLIRFPENKKYSWE 223

Query: 250 ALITLKKALKNL 261
            L  +KK +  L
Sbjct: 224 DLKKIKKKIAEL 235


>gi|312602487|ref|YP_004022332.1| uracil DNA glycosylase superfamily protein [Burkholderia
           rhizoxinica HKI 454]
 gi|312169801|emb|CBW76813.1| Uracil DNA glycosylase superfamily protein [Burkholderia
           rhizoxinica HKI 454]
          Length = 384

 Score =  179 bits (455), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 53/242 (21%), Positives = 92/242 (38%), Gaps = 16/242 (6%)

Query: 26  WVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHS----------PLVQQADSIAQKAC 75
            V + PN      +                                 L   AD+      
Sbjct: 139 AVVEVPNARRALAAPVSPAETVPTGLGDARSLQAEPMGGQGEAAAPALGVAADAQPVPML 198

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
               LK+ +     C LC    +T+     E  D M++G  P ++++  G+PF G+ G +
Sbjct: 199 DWEALKARVAGCTLCRLCERRTNTVFGVGDETADWMLVGEAPGENEDKQGEPFVGQAGKL 258

Query: 136 LDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           LD ML+++++ R   ++I+ +    PPGNRN    E+  C P + RQ+ L+ P +++ +G
Sbjct: 259 LDNMLRALQMRRGDNVYIANVLKCRPPGNRNPQPDEVMRCEPYLKRQVALVKPNVIVALG 318

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITL 254
                     DA       G+          +P + T HP  L++    K   W  L   
Sbjct: 319 RFAAQSLLKTDASIAS-LRGRVHEYE----GVPVIVTYHPAYLLRSLHDKHKAWSDLCLA 373

Query: 255 KK 256
           + 
Sbjct: 374 RA 375


>gi|71082815|ref|YP_265534.1| DNA-directed DNA polymerase [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|71061928|gb|AAZ20931.1| probable DNA-directed DNA polymerase [Candidatus Pelagibacter
           ubique HTCC1062]
          Length = 243

 Score =  179 bits (454), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 61/261 (23%), Positives = 115/261 (44%), Gaps = 23/261 (8%)

Query: 2   TSKRILSQEQILTIALFYADSGVYWVFDE-PNNEATYESQRKEKSIDSAIQPITNIRHIH 60
            SK++++Q+       F   +G  ++FDE P N     S   +K +              
Sbjct: 1   MSKKVINQKTNFDS-EFLNSTGSDFIFDEKPINRLKNTSNDLKKDL-------------- 45

Query: 61  SPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDS 120
                 +     K   L  LK  + S  DC+L + S   I         +M+IG  P   
Sbjct: 46  ------SIQKIDKVKELANLKEQINSISDCNLKNNSKKIILGDGNINSPIMLIGEAPGVE 99

Query: 121 DNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMR 180
           ++ +G  F G+ G++L KML +I I +  I+ +    + PP +R  ++ E++     + +
Sbjct: 100 EDNAGLTFMGEVGDLLKKMLIAINIEKQNIYTTYAVNFRPPEDRKPNSTEIKRYSQFLQK 159

Query: 181 QIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQY 240
            I +I+PKI++ +G+         ++ K     GKW  +   ++    + T +P  L++ 
Sbjct: 160 HISIINPKIIILMGSTAMESLTGLNS-KISIERGKWKEVIVKNTSYNVIITFNPSYLLRA 218

Query: 241 PLIKKNTWHALITLKKALKNL 261
           P  KK++W  L  +K+ +  L
Sbjct: 219 PENKKHSWDDLKKIKQKILEL 239


>gi|237793391|ref|YP_002860943.1| uracil-DNA glycosylase [Clostridium botulinum Ba4 str. 657]
 gi|229263750|gb|ACQ54783.1| uracil-DNA glycosylase [Clostridium botulinum Ba4 str. 657]
          Length = 190

 Score =  179 bits (454), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 41/186 (22%), Positives = 74/186 (39%), Gaps = 6/186 (3%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
             +L     + + C L     + +         +M IG  P   ++ +G+PF GK G +L
Sbjct: 4   WSQLYDECINCNKCTLVKNRTNMVFGEGNISAPIMFIGEAPGADEDRTGRPFVGKAGQLL 63

Query: 137 DKMLQSIEIMRT-QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
            K L +++  R    +I  +    P  NR     E   C   +  Q+ L+ PKI++ +G 
Sbjct: 64  TKALLALDFKRDEHYYICNVCKCRPENNRTPKEEEAMTCLHYLRNQVALVKPKIMICLGA 123

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
               +    +  +  ++ GKW            + T HP  L +    KK  W  L +++
Sbjct: 124 TALKYIMG-EQFRITRDRGKWIE----RKGYYIMVTFHPAALFRDESKKKLLWQDLKSIR 178

Query: 256 KALKNL 261
           +    L
Sbjct: 179 EKYDEL 184


>gi|224826345|ref|ZP_03699447.1| phage SPO1 DNA polymerase-related protein [Lutiella nitroferrum
           2002]
 gi|224601446|gb|EEG07627.1| phage SPO1 DNA polymerase-related protein [Lutiella nitroferrum
           2002]
          Length = 284

 Score =  179 bits (454), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 49/200 (24%), Positives = 88/200 (44%), Gaps = 6/200 (3%)

Query: 63  LVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDN 122
                 + A+   S  EL+  +     C LC T   T+          +IIG  P + ++
Sbjct: 87  AAPTLPAPAKPVLSWDELEQTVARCSHCRLCETRTQTVFGRGNPQARWLIIGEAPGEQED 146

Query: 123 ISGKPFSGKTGNMLDKMLQSIEIM-RTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQ 181
             GKPF G+ G +LD ML +I +     ++I+ +    PPGNRN S  E+  C+  + +Q
Sbjct: 147 KQGKPFVGRAGQLLDNMLAAIGLDSNHDVYIANVLKCRPPGNRNPSADEIVACQDYLRQQ 206

Query: 182 IELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
           I  I P ++L +G        +++     +  G+          +P + + HP  L++  
Sbjct: 207 IAHIRPTLILALGRFAAQTLLDSN-DSIARLRGRVHRYQ----DVPMIVSFHPAYLLRNL 261

Query: 242 LIKKNTWHALITLKKALKNL 261
             K  +W  L+  ++  + L
Sbjct: 262 PDKAKSWQDLVFARRTFRQL 281


>gi|328953988|ref|YP_004371322.1| phage SPO1 DNA polymerase-related protein [Desulfobacca acetoxidans
           DSM 11109]
 gi|328454312|gb|AEB10141.1| phage SPO1 DNA polymerase-related protein [Desulfobacca acetoxidans
           DSM 11109]
          Length = 251

 Score =  179 bits (454), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 48/217 (22%), Positives = 96/217 (44%), Gaps = 5/217 (2%)

Query: 43  EKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICA 102
           +  +   +    +I      L   ++   Q+  +L E+++ L     C L  T    +  
Sbjct: 36  KPIVAEPVVKSESIPAPELTLQPASEVPPQEVITLEEVRAELGDCQRCKLWRTRTHLVFG 95

Query: 103 TQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPG 162
                  L+ IG  P ++++  G+PF G+ G +L+++L  +EI R +++I+ I+   PP 
Sbjct: 96  AGDPHARLVFIGEAPGEAEDRQGEPFVGRAGQLLNRLLSKLEISRQEVYITNINKCRPPN 155

Query: 163 NRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTP 222
           NR     E+  CRP + +Q++ I P++++ +G    +      A    +  G W      
Sbjct: 156 NRTPEADEIAACRPFLWKQLQAIRPQVIVTLGAVAIHALLETKAPLN-RLRGHWQQW--- 211

Query: 223 HSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALK 259
              I  + T HP  L++ P  +  TW  +  +    +
Sbjct: 212 -RGIAVMPTFHPSYLLRVPQERVKTWEDMQQVLALYR 247


>gi|206890143|ref|YP_002248500.1| uracil-DNA glycosylase, family 4 [Thermodesulfovibrio yellowstonii
           DSM 11347]
 gi|206742081|gb|ACI21138.1| uracil-DNA glycosylase, family 4 [Thermodesulfovibrio yellowstonii
           DSM 11347]
          Length = 237

 Score =  179 bits (453), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 42/180 (23%), Positives = 83/180 (46%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKM 139
           L   ++    C L ++  + +C        LM +G  P   +++ G+PF G+ G +L  +
Sbjct: 58  LNEEIKKCKKCPLSNSRKNPVCGEGNINAKLMFVGEAPGVDEDLQGRPFVGEAGKLLTSL 117

Query: 140 LQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKN 199
           ++ +   R  ++I+     HPP NR+    E+  C   + R+IE+ISP++++ +G     
Sbjct: 118 IEKMGFKREDVYITNTVKCHPPMNRDPFESEISTCFDYLKREIEIISPQVIISLGKVATY 177

Query: 200 FFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALK 259
                + +    ++ K      P++ IP + T HP  L++    K  TW       + L+
Sbjct: 178 TLMGMNGKLKDLHISKLRGKVFPYNQIPVIPTFHPAYLLRNKKDKWLTWEDAQEALRRLR 237


>gi|91762762|ref|ZP_01264727.1| probable DNA-directed DNA polymerase [Candidatus Pelagibacter
           ubique HTCC1002]
 gi|91718564|gb|EAS85214.1| probable DNA-directed DNA polymerase [Candidatus Pelagibacter
           ubique HTCC1002]
          Length = 243

 Score =  179 bits (453), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 62/261 (23%), Positives = 116/261 (44%), Gaps = 23/261 (8%)

Query: 2   TSKRILSQEQILTIALFYADSGVYWVFDE-PNNEATYESQRKEKSIDSAIQPITNIRHIH 60
            SK++++Q+       F   +G  ++FDE P N     S   +K +              
Sbjct: 1   MSKKVINQKTNFDS-EFLNSTGSDFIFDEKPINRLKNTSNDLKKDL-------------- 45

Query: 61  SPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDS 120
                 +     K   L  LK  + S  DC+L + S   I         +MIIG  P   
Sbjct: 46  ------SIQKIDKVKELENLKEQINSISDCNLKNNSKKIILGDGNINSLIMIIGEAPGIE 99

Query: 121 DNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMR 180
           ++ +G  F G+ G++L KML +I I +  I+ +    + PP +R  ++ E++     + +
Sbjct: 100 EDNAGLTFMGEVGDLLKKMLIAINIKKQNIYATYAVNFRPPEDRKPNSTEIKRYSQFLQK 159

Query: 181 QIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQY 240
            I +I+PKI++ +G+         ++ K     GKW  +   ++    + T +P  L++ 
Sbjct: 160 HISIINPKIIILMGSTAMESLTGLNS-KISIERGKWKEVIIKNTSYNVIITFNPSYLLRA 218

Query: 241 PLIKKNTWHALITLKKALKNL 261
           P  KK++W  L  +K+ + +L
Sbjct: 219 PENKKHSWDDLKKIKQKILDL 239


>gi|118578530|ref|YP_899780.1| phage SPO1 DNA polymerase-like protein [Pelobacter propionicus DSM
           2379]
 gi|118501240|gb|ABK97722.1| phage SPO1 DNA polymerase-related protein [Pelobacter propionicus
           DSM 2379]
          Length = 264

 Score =  179 bits (453), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 49/247 (19%), Positives = 91/247 (36%), Gaps = 18/247 (7%)

Query: 7   LSQEQILTIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQ 66
           L    +        +SGV  +           S        +   P        SP   Q
Sbjct: 9   LVTASLRAYLQGLQESGVDGI---------PASLAGISPATAVEIPPDTPPEPDSPAATQ 59

Query: 67  ADSIAQKA----CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDN 122
           A            SL  ++S L     C L +T    +  T      L+  G  P   ++
Sbjct: 60  APQAVAPPVVERESLEIIRSDLGECQRCKLGATRTHLVFGTGNPRARLVFAGEGPGRDED 119

Query: 123 ISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQI 182
           + G+PF G+ G +L++++ ++ + R  ++I  +    PPGNR+    E+  C   ++RQ+
Sbjct: 120 LQGEPFVGEAGQVLNRIITAMGLKREDVYICNLVKCRPPGNRDPEADEIAACSTFLLRQL 179

Query: 183 ELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPL 242
             I+P++++ +G            +   +  G +         IP + T HP  L++   
Sbjct: 180 RSINPEVIVALGKFAAQTLLATK-EPISRLRGTFGEF----HGIPLMPTFHPSYLLRNRG 234

Query: 243 IKKNTWH 249
                W 
Sbjct: 235 NSAPFWE 241


>gi|253999990|ref|YP_003052053.1| phage SPO1 DNA polymerase-like protein [Methylovorus sp. SIP3-4]
 gi|253986669|gb|ACT51526.1| phage SPO1 DNA polymerase-related protein [Methylovorus sp. SIP3-4]
          Length = 377

 Score =  179 bits (453), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 51/202 (25%), Positives = 91/202 (45%), Gaps = 6/202 (2%)

Query: 61  SPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDS 120
           +  + Q    +        L+S + +   C L  T   T+        + +I+G  P   
Sbjct: 166 ATSLGQGRRDSIAQLDWQGLQSCVANCQACSLSRTRTQTVFGVGDPAAEWLIVGEAPGAE 225

Query: 121 DNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIM 179
           ++  G+PF G+ G +LD ML +I++ R   ++I+ +    PP NR+    E++ C P + 
Sbjct: 226 EDKRGEPFVGQAGQLLDNMLGAIQLKRGQNVYIANVLKCRPPQNRDPQGEEVQQCDPFLK 285

Query: 180 RQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ 239
           RQ+ELI PK++L +G        N+DA       G+          +P + T HP  L++
Sbjct: 286 RQVELIKPKLILALGKFAAQSLLNSDATIGS-MRGRQHEYN----GVPVIVTYHPAYLLR 340

Query: 240 YPLIKKNTWHALITLKKALKNL 261
             + K   W  L   +  ++ L
Sbjct: 341 NLMDKAKAWEDLCLARATMRKL 362


>gi|20806609|ref|NP_621780.1| Uracil-DNA glycosylase [Thermoanaerobacter tengcongensis MB4]
 gi|20515053|gb|AAM23384.1| Uracil-DNA glycosylase [Thermoanaerobacter tengcongensis MB4]
          Length = 186

 Score =  179 bits (453), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 45/185 (24%), Positives = 84/185 (45%), Gaps = 5/185 (2%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L EL         C L  T  + +         +M +G  P   +++ G+PF G+ G +L
Sbjct: 6   LKELYLACLHCTKCDLHKTKTNMVFGEGNLRAKVMFVGEGPGRDEDLQGRPFVGRAGQLL 65

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
           +KML+ + + R +++I+ +    PP NR     E++ C P +  Q+ +I+PKI++ +G  
Sbjct: 66  NKMLEDVGLKREEVYIANVVKCRPPNNRVPLQSEIDACLPYLRNQVAIIAPKIIVCLGAT 125

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
                 + D + T    G+W         +  +AT HP  +++ P   +        +K+
Sbjct: 126 AAKAIIDKDFKITT-MRGQWFE----RKGVKIIATYHPAAILRDPEKLQPAMEDFKKIKE 180

Query: 257 ALKNL 261
            L  L
Sbjct: 181 ELDKL 185


>gi|332796184|ref|YP_004457684.1| phage SPO1 DNA polymerase-like protein [Acidianus hospitalis W1]
 gi|332693919|gb|AEE93386.1| phage SPO1 DNA polymerase-related protein [Acidianus hospitalis W1]
          Length = 207

 Score =  179 bits (453), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 44/188 (23%), Positives = 81/188 (43%), Gaps = 3/188 (1%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           SL E+   +R    C L  T  + +        ++M+IG  P  +++  G+PF G  G +
Sbjct: 2   SLEEIAKQVRECTKCKLHLTRKNAVPGEGNPSAEIMLIGEAPGANEDEEGRPFVGAAGKL 61

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           L ++L SI + R  + I+ +    PP NR+    E+  C P +  QI +I PKI++ +G 
Sbjct: 62  LTELLSSIGLNRKDVFITNLVKCRPPNNRDPEEDEIIACSPYLDEQIRIIKPKIIVTLGK 121

Query: 196 KTKNFFFNN---DAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALI 252
            +  +         +      GK+      +  I    T HP   +  P ++   +    
Sbjct: 122 HSTTYILGKIGIKVKSISAVRGKFFTWNYGNVTISVFPTYHPAAALYNPSLRDELFSDFK 181

Query: 253 TLKKALKN 260
            + + L +
Sbjct: 182 KISERLNS 189


>gi|225181124|ref|ZP_03734570.1| phage SPO1 DNA polymerase-related protein [Dethiobacter
           alkaliphilus AHT 1]
 gi|225168093|gb|EEG76898.1| phage SPO1 DNA polymerase-related protein [Dethiobacter
           alkaliphilus AHT 1]
          Length = 222

 Score =  178 bits (452), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 45/200 (22%), Positives = 89/200 (44%), Gaps = 5/200 (2%)

Query: 60  HSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSD 119
               V     + ++  ++  L   +     C L S +   +        DL+ +G  P  
Sbjct: 25  KPAKVFAPLPVVEQPQTIAALSKDVLDCAQCGLRSQATQVVFGEGNPDADLLFVGEAPGA 84

Query: 120 SDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIM 179
            ++  G+PF G+ G +L+K+L + EI R +++I+ +    PP NR  +  E   C   + 
Sbjct: 85  EEDAQGRPFVGEAGKLLNKILAAAEISREEVYITNVVKCRPPKNRTPNPDEAAACSEHLQ 144

Query: 180 RQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ 239
           +QI L+ P+I++ +G+       +  A+      G+W         +  +AT HP  L++
Sbjct: 145 KQIALLKPRIVVCLGSLATQALIDPQARV-SAVRGRWFT----KDGLQMMATFHPAALLR 199

Query: 240 YPLIKKNTWHALITLKKALK 259
            P  K+  W  +  ++ A +
Sbjct: 200 DPSRKRPVWEDIQKIRDAYR 219


>gi|161524407|ref|YP_001579419.1| phage SPO1 DNA polymerase-like protein [Burkholderia multivorans
           ATCC 17616]
 gi|189350838|ref|YP_001946466.1| bacteriophage-type DNA polymerase [Burkholderia multivorans ATCC
           17616]
 gi|160341836|gb|ABX14922.1| phage SPO1 DNA polymerase-related protein [Burkholderia multivorans
           ATCC 17616]
 gi|189334860|dbj|BAG43930.1| bacteriophage-type DNA polymerase [Burkholderia multivorans ATCC
           17616]
          Length = 358

 Score =  178 bits (452), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 52/235 (22%), Positives = 88/235 (37%), Gaps = 6/235 (2%)

Query: 23  GVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKS 82
           G           +           D A           +    +A            L +
Sbjct: 113 GALTAIMSAPAASPSADMPPAADDDFAWFDAAPPGDSATAAEPRAAEAPVAMLDWDALAA 172

Query: 83  LLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQS 142
            +     C LC    +T+        D M+IG  P ++++  G+PF G+ G +LD ML+S
Sbjct: 173 RVADCTRCRLCEKRTNTVFGVGDREADWMLIGEAPGENEDKQGEPFVGQAGKLLDNMLRS 232

Query: 143 IEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFF 201
           + + R   ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G       
Sbjct: 233 LSLQRGENVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVALVKPKLIVALGRFAAQTL 292

Query: 202 FNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
              DA       G+          +P + T HP  L++    K   W  L   + 
Sbjct: 293 LKTDASIAS-LRGRVHAYE----GVPVIVTYHPAYLLRSLPDKAKAWADLCLARD 342


>gi|238026879|ref|YP_002911110.1| phage SPO1 DNA polymerase-like protein [Burkholderia glumae BGR1]
 gi|237876073|gb|ACR28406.1| Phage SPO1 DNA polymerase-related protein [Burkholderia glumae
           BGR1]
          Length = 362

 Score =  178 bits (452), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 50/237 (21%), Positives = 91/237 (38%), Gaps = 8/237 (3%)

Query: 25  YWVFDEPNNEATYESQRKEKSIDSAIQ--PITNIRHIHSPLVQQADSIAQKACSLHELKS 82
                    +             S     P+++  H   P                EL++
Sbjct: 121 DTAAPAGAADQMPPDADPSLEDPSWFDLVPMSDAGHSFEPAEPAVARSPVAGLGWDELEA 180

Query: 83  LLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQS 142
            +     C LC     T+        D M+IG  P ++++  G+PF G+ G +LD ML +
Sbjct: 181 RVAECRRCRLCEKRTRTVFGVGDREADWMLIGEAPGENEDKQGEPFVGQAGKLLDSMLHA 240

Query: 143 IEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFF 201
           + + R   ++I+ +    PPGNRN    E+  C P + RQ+EL+ PK+++ +G       
Sbjct: 241 LSLKRGENVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVELVKPKLIVAMGRFAAQTL 300

Query: 202 FNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
             +         G+  +       +P + + HP  L++    K   W  L   +  +
Sbjct: 301 LKSTGSIAS-MRGRIHHYE----GVPVVVSYHPAYLLRSLPDKAKAWADLCLARDTI 352


>gi|327537178|gb|EGF23927.1| phage SPO1 DNA polymerase-related protein [Rhodopirellula baltica
           WH47]
          Length = 321

 Score =  178 bits (452), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 52/235 (22%), Positives = 94/235 (40%), Gaps = 13/235 (5%)

Query: 30  EPNNEAT-------YESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKS 82
           EP  +A+        E +   ++ +  +QP+ +      P    +  IA++   L  L S
Sbjct: 87  EPPPQASAGGSSIGPEVKTPPRAPEGRLQPVESFSASDDPYPGTSLPIAERENQLTNLAS 146

Query: 83  LLRSFHDCHL-CSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQ 141
           ++     C L       T+             G  P   ++  G+PF GK G +LDKM+Q
Sbjct: 147 VVAGCTKCTLLAKCRTQTVFGEGNPAARFAFFGEAPGADEDRLGRPFIGKAGQLLDKMVQ 206

Query: 142 SIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFF 201
           + ++ R  I++       PP NRN    E+  CR    +Q++++ P+ ++ +G  + +  
Sbjct: 207 ACKLQREDIYLLNTVKCRPPENRNPEPTELANCREYFEQQLQILRPEYIVCLGAVSAHSL 266

Query: 202 FNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
                       G+       +     L   HP  L++ P  KK  W  L  L +
Sbjct: 267 LKTKLSI-----GRLRQRFHQYHESKVLVIYHPAYLLRNPDAKKAAWADLQMLMR 316


>gi|302877854|ref|YP_003846418.1| phage SPO1 DNA polymerase-related protein [Gallionella
           capsiferriformans ES-2]
 gi|302580643|gb|ADL54654.1| phage SPO1 DNA polymerase-related protein [Gallionella
           capsiferriformans ES-2]
          Length = 324

 Score =  178 bits (452), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 44/237 (18%), Positives = 88/237 (37%), Gaps = 12/237 (5%)

Query: 30  EPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQK-------ACSLHELKS 82
            P ++    +   +  +                          K            EL+ 
Sbjct: 89  SPLSQDAGNAIEVQAPVVDLFASDFQFAAPGEAADNSLREFQLKNSGGLLGTTDWPELQQ 148

Query: 83  LLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQS 142
            ++   +C L +     +  T       + +G  P   ++   +PF G +G +LD ML +
Sbjct: 149 KVQGCTECKLRAECTQPVFGTGDPHARWLFVGEAPGAEEDELCEPFVGASGRLLDNMLLA 208

Query: 143 IEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFF 202
           I + R++++++ +    P  +R+    E+  C P + RQI L+ P +++ +G    +   
Sbjct: 209 IGLQRSEVYLANVIKCRPLDDRHPHVGEIAACLPYLKRQIGLLQPAVIVALGKTAASALL 268

Query: 203 NNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALK 259
           + DA       G   +       IP + T HP  L++ PL K   W  L    + + 
Sbjct: 269 DTDATIAS-LRGIVHDY----KGIPLVVTYHPAYLLRSPLEKARAWQDLCLAVQTMD 320


>gi|168182317|ref|ZP_02616981.1| uracil-DNA glycosylase [Clostridium botulinum Bf]
 gi|182674592|gb|EDT86553.1| uracil-DNA glycosylase [Clostridium botulinum Bf]
          Length = 190

 Score =  178 bits (452), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 42/186 (22%), Positives = 75/186 (40%), Gaps = 6/186 (3%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
             +L     + + C L     + +         +M IG  P   ++ +G+PF GK G +L
Sbjct: 4   WSQLYDECINCNKCTLVKNRTNMVFGEGNISAPIMFIGEAPGADEDRTGRPFVGKAGQLL 63

Query: 137 DKMLQSIEIMRT-QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
            K L +++  R    +I  +    P  NR     E   C   +  Q+ L+ PKI++ +G 
Sbjct: 64  TKALLALDFKRDEHYYICNVCKCRPENNRTPKEEEAMTCLHYLRNQVALVKPKIMICLGA 123

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
               +    +  +  ++ GKW            +AT HP  L +    KK  W  L +++
Sbjct: 124 TALKYIMG-EQFRITRDRGKWIE----RKGYYIMATFHPAALFRDESKKKLLWQDLKSIR 178

Query: 256 KALKNL 261
           +    L
Sbjct: 179 EKYDEL 184


>gi|15639221|ref|NP_218669.1| DNA polymerase [Treponema pallidum subsp. pallidum str. Nichols]
 gi|189025462|ref|YP_001933234.1| DNA polymerase, bacteriophage-type [Treponema pallidum subsp.
           pallidum SS14]
 gi|3322496|gb|AAC65215.1| DNA polymerase, bacteriophage-type [Treponema pallidum subsp.
           pallidum str. Nichols]
 gi|189018037|gb|ACD70655.1| DNA polymerase, bacteriophage-type [Treponema pallidum subsp.
           pallidum SS14]
          Length = 277

 Score =  178 bits (452), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 53/239 (22%), Positives = 90/239 (37%), Gaps = 15/239 (6%)

Query: 32  NNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKAC--------SLHELKSL 83
            +    E        DS I P        +   ++A S A            +   L+  
Sbjct: 37  LDLFRTEGIGPRPRNDSVILP-NAACSPRNHAGKRAQSTADACVRSSDGSVYTDETLREE 95

Query: 84  LRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSI 143
           + +   C L       +        D++++G  P   ++ SG+PF G++G +LD ML +I
Sbjct: 96  IFACRACELYQRRTHAVVGEGVADADVLVVGEAPGAEEDRSGRPFVGRSGKLLDAMLAAI 155

Query: 144 EIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFF 202
            + R Q  +I+ +    PP NR  +  E   C   +   + L  P  +L +G        
Sbjct: 156 GLSRQQNCYITNVVKCRPPRNRTPTPHETACCARFLHAHLTLHRPCAILVLGRCAAQHML 215

Query: 203 NNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
                   +  G++         IP LAT HP  L++   +K+  W  L T +  L  L
Sbjct: 216 Q-TTDGIGKLRGRFFTYQ----GIPLLATYHPSALLRDEALKRPAWEDLKTFRARLLQL 269


>gi|218960625|ref|YP_001740400.1| Uracil-DNA glycosylase [Candidatus Cloacamonas acidaminovorans]
 gi|167729282|emb|CAO80193.1| Uracil-DNA glycosylase [Candidatus Cloacamonas acidaminovorans]
          Length = 217

 Score =  178 bits (451), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 63/255 (24%), Positives = 102/255 (40%), Gaps = 44/255 (17%)

Query: 7   LSQEQILTIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQ 66
           +S   +     F  +SG+  ++  P                                   
Sbjct: 1   MSVNALRQYLEFLKNSGIKELYYPP----------------------------------- 25

Query: 67  ADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGK 126
               + K   L EL+    +   C L ++    +          M+IG  P + ++I+G+
Sbjct: 26  ----SDKQKKLTELQKQYSTCTKCPLHNSRRKFVYGEGNPNAIAMLIGEGPGEQEDITGR 81

Query: 127 PFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELIS 186
           PF G  G +L+KML +I + R+ ++I+ I    PPGNRN  + E + C P ++ QI++I 
Sbjct: 82  PFVGAAGQLLEKMLSAINLQRSDVYITNIVKCRPPGNRNPESEERKACLPYLLEQIQIIQ 141

Query: 187 PKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKN 246
           PKILL +G        NN+      + GK          IP   T HP  L++    KK 
Sbjct: 142 PKILLILGLVAAQTLLNNNNTL-GWHRGKIHYFM----DIPAFVTYHPSALLRNQEWKKP 196

Query: 247 TWHALITLKKALKNL 261
            W  L   +K  + L
Sbjct: 197 AWIDLQEFQKEYEKL 211


>gi|51894053|ref|YP_076744.1| Uracil-DNA glycosylase [Symbiobacterium thermophilum IAM 14863]
 gi|51857742|dbj|BAD41900.1| Uracil-DNA glycosylase [Symbiobacterium thermophilum IAM 14863]
          Length = 206

 Score =  178 bits (451), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 47/191 (24%), Positives = 83/191 (43%), Gaps = 6/191 (3%)

Query: 72  QKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGK 131
            +  ++  L  +++    C L +     +         LM IG  P   ++  G+PF G+
Sbjct: 11  DRIPTMEALAEVVKGCQRCGLRAGCTQVVFGEGVWPAGLMCIGEGPGADEDRLGRPFVGR 70

Query: 132 TGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKIL 190
            G +LD++L+     R    +I+ I    PPGNR     E + C P +  QI L+ PKI+
Sbjct: 71  AGQLLDRILEVSGFDRKRNCYIANIVKCRPPGNRAPEPAERQACWPYLRAQIRLVRPKII 130

Query: 191 LFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHA 250
           + +G        +  A +  +  G+W         I  + T HP  L++ P  KK+ W+ 
Sbjct: 131 VLLGATALQGIIDPSA-RITRMRGQWIERE----GIHFMPTYHPAALLRDPSKKKDVWND 185

Query: 251 LITLKKALKNL 261
           +  +    + L
Sbjct: 186 MKQVIARYREL 196


>gi|193215644|ref|YP_001996843.1| phage SPO1 DNA polymerase-like protein [Chloroherpeton thalassium
           ATCC 35110]
 gi|193089121|gb|ACF14396.1| phage SPO1 DNA polymerase-related protein [Chloroherpeton
           thalassium ATCC 35110]
          Length = 208

 Score =  178 bits (451), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 52/203 (25%), Positives = 83/203 (40%), Gaps = 5/203 (2%)

Query: 58  HIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTP 117
           +         +   QK  +L  L    +    C L       +     E   L++IG  P
Sbjct: 8   NAEQSEPLSPEEALQKYKTLSALYDATKDCKKCQLGELRTKYVFGEGNERAKLVLIGEAP 67

Query: 118 SDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPI 177
              ++  G+PF G++G +L K++++I   R +I+I  I    PP NR     E+  C P 
Sbjct: 68  GADEDAQGRPFVGRSGQLLTKIMEAIHFSREEIYICNILKCRPPNNREPQADEVAACLPH 127

Query: 178 IMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQEL 237
           + RQ+E+I PKI+L +G    N     + Q      GK               T HP  L
Sbjct: 128 LYRQLEIIKPKIILALGRVAANVLL-ENKQSMSAMRGKVIKWRNSD----VFVTYHPAAL 182

Query: 238 IQYPLIKKNTWHALITLKKALKN 260
           ++ P  K+  W  +  LK+    
Sbjct: 183 LRNPNWKRLCWEDVQALKRHYDE 205


>gi|32473807|ref|NP_866801.1| DNA polymerase [Rhodopirellula baltica SH 1]
 gi|32444343|emb|CAD74341.1| DNA polymerase, bacteriophage-type [Rhodopirellula baltica SH 1]
          Length = 321

 Score =  178 bits (451), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 49/221 (22%), Positives = 89/221 (40%), Gaps = 6/221 (2%)

Query: 37  YESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHL-CST 95
            E +   ++ +  +QP+ +      P    +  IA++   L  L S++     C L    
Sbjct: 101 PEVKTPPRAPEGRLQPVESFSACDDPYPGTSLPIAERENQLTNLASVVAGCTKCTLLAKC 160

Query: 96  SLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMI 155
              T+             G  P   ++  G+PF GK G +LDKM+Q+ ++ R  I++   
Sbjct: 161 RTQTVFGEGNPAARFAFFGEAPGADEDRLGRPFIGKAGQLLDKMVQACKLQREDIYLLNT 220

Query: 156 SPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGK 215
               PP NRN    E+  CR    +Q++++ P+ ++ +G  + +              G+
Sbjct: 221 VKCRPPENRNPEPTELANCREYFEQQLQILRPEYIVCLGAVSAHSLLKTKLSI-----GR 275

Query: 216 WSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
                  +     L   HP  L++ P  KK  W  L  L +
Sbjct: 276 LRQRFHQYHESKVLVIYHPAYLLRNPDAKKAAWADLQMLMR 316


>gi|270159414|ref|ZP_06188070.1| uracil-DNA glycosylase family 4 protein [Legionella longbeachae
           D-4968]
 gi|289165775|ref|YP_003455913.1| C-terminal part of DNA polymerase, bacteriophage-type [Legionella
           longbeachae NSW150]
 gi|269987753|gb|EEZ94008.1| uracil-DNA glycosylase family 4 protein [Legionella longbeachae
           D-4968]
 gi|288858948|emb|CBJ12874.1| putative C-terminal part of DNA polymerase, bacteriophage-type
           [Legionella longbeachae NSW150]
          Length = 211

 Score =  178 bits (450), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 57/186 (30%), Positives = 88/186 (47%), Gaps = 5/186 (2%)

Query: 75  CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
             L  L   + S   C L  T   T+     E   LMI+G  P   ++  G PF GK G 
Sbjct: 28  KDLSSLAKEVSSCTRCPLHKTRTQTVFYRGHEKAKLMIVGEAPGFYEDQQGLPFVGKAGG 87

Query: 135 MLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           +L++ML+SIE++   ++I+ +    PP NR+    E+  C   ++RQIEL+ P ++L +G
Sbjct: 88  LLNQMLRSIEMVEKDVYIANVLKCRPPDNRDPHLDEIAQCSSFLVRQIELVKPHLILALG 147

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITL 254
                F  N       Q      +       IP + + HP  L++ P  KK T+  L+T+
Sbjct: 148 RFAGQFLLN-KPLSLKQLRNTIHHYNN----IPFIVSYHPAYLLRNPSDKKKTYIDLLTV 202

Query: 255 KKALKN 260
           KK L  
Sbjct: 203 KKLLAE 208


>gi|255020844|ref|ZP_05292900.1| putative DNA polymerase-like protein, bacteriophage type
           [Acidithiobacillus caldus ATCC 51756]
 gi|254969635|gb|EET27141.1| putative DNA polymerase-like protein, bacteriophage type
           [Acidithiobacillus caldus ATCC 51756]
          Length = 297

 Score =  178 bits (450), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 51/221 (23%), Positives = 87/221 (39%), Gaps = 7/221 (3%)

Query: 35  ATYESQRKEKSIDSAIQPITNIRHIHSPL-VQQADSIAQKACSLHELKSLLRSFHDCHLC 93
                     + +   +P+        P    Q    A  A     LK  + +   C L 
Sbjct: 74  TAALVIDPASAEEQEHEPLAVEPMEVMPADRDQVRRQAISAMDWQALKERIETCRACSLG 133

Query: 94  STSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHI 152
           ST  + +    +       +G  P   ++  G+ F G+ G +LD ML ++ + R  +++I
Sbjct: 134 STRQNAVVGAGSPEGSWCFVGEAPGAEEDRRGEAFVGRGGQLLDAMLAAMSLSRAREVYI 193

Query: 153 SMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQN 212
           + +    PP NR+    E+  C P + RQI L+ P+IL+ +G           +    Q 
Sbjct: 194 ANVLKCRPPNNRDPLGPEVRSCLPYLERQIALVQPRILVALGRFAAQSLLQ-TSTPIGQL 252

Query: 213 LGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALIT 253
            G+          IP + T HP  L++ PL K+  W  L  
Sbjct: 253 RGRVWEY----RGIPLVVTYHPAYLLRNPLEKRKVWEDLKL 289


>gi|269792546|ref|YP_003317450.1| phage SPO1 DNA polymerase-like protein [Thermanaerovibrio
           acidaminovorans DSM 6589]
 gi|269100181|gb|ACZ19168.1| phage SPO1 DNA polymerase-related protein [Thermanaerovibrio
           acidaminovorans DSM 6589]
          Length = 196

 Score =  178 bits (450), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 46/198 (23%), Positives = 89/198 (44%), Gaps = 10/198 (5%)

Query: 69  SIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPF 128
           S+  ++  L ++++   S   C LCS+  + +         LM +G  P   ++  G PF
Sbjct: 2   SLEDRSLMLEQIRNRALSCERCGLCSSRTNVVFGEGVLEGGLMFVGEGPGADEDQQGVPF 61

Query: 129 SGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPK 188
            G+ G +L ++L +  I R Q++I+ +    PPGNR  +  EM  C   +  QI L+ P+
Sbjct: 62  VGRAGQLLTQILSAAGISRDQVYITNVVKCRPPGNRVPTYEEMMACDQFLQAQILLVRPR 121

Query: 189 ILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLI----- 243
           +L+ +G+    +      +   +  G+W         +  +   HP  L++ P       
Sbjct: 122 LLVLLGSTPTKWILK-TQEAISKLRGQWFQW----RGMEVMPMFHPSYLLRNPSNKVGSP 176

Query: 244 KKNTWHALITLKKALKNL 261
           K  TW  +  +K+   ++
Sbjct: 177 KHLTWEDIQEVKRRWDSV 194


>gi|254563580|ref|YP_003070675.1| phage DNA polymerase [Methylobacterium extorquens DM4]
 gi|254270858|emb|CAX26863.1| putative phage DNA polymerase [Methylobacterium extorquens DM4]
          Length = 344

 Score =  178 bits (450), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 69/230 (30%), Positives = 105/230 (45%), Gaps = 2/230 (0%)

Query: 31  PNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDC 90
           P         R   + +                   A + A +  +L EL+ LLR F  C
Sbjct: 110 PLEFRRELPSRDAPAREPPRTYGNAAGAKPGEAADDARARAAQMKTLEELEELLRGFEGC 169

Query: 91  HLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQI 150
            L  T+ + + A       +M +G  P   ++  GKPF G++G +LD+M+ +I + RT  
Sbjct: 170 GLRFTAKNLVFADGNPQARVMFVGEAPGADEDRIGKPFMGRSGQLLDRMMAAIGLDRTSA 229

Query: 151 HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTY 210
           +IS + PW PPGNRN +  E+ ICRP + RQIEL +P IL+ +G                
Sbjct: 230 YISNVVPWRPPGNRNPTPQEISICRPFVERQIELANPDILVCLGAPATQTLTGTK-DGIL 288

Query: 211 QNLGKWSNLCTP-HSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALK 259
           +  G++          I  LAT+HP  L++ P+ K+  W     LK AL 
Sbjct: 289 KARGRFYPYRLGDGREIRALATLHPAYLLRQPVQKRLAWRDFRMLKSALD 338



 Score = 40.9 bits (94), Expect = 0.21,   Method: Composition-based stats.
 Identities = 12/56 (21%), Positives = 24/56 (42%), Gaps = 2/56 (3%)

Query: 1  MTSKRILSQE--QILTIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPIT 54
          MT+    +     +++   F+  +GV  V DE  ++   E++       S  +P T
Sbjct: 4  MTANHADTDARGDLISYLDFHVAAGVDAVLDEQPHDRFAEAESVRADAASQAEPAT 59


>gi|307729307|ref|YP_003906531.1| phage SPO1 DNA polymerase-related protein [Burkholderia sp.
           CCGE1003]
 gi|307583842|gb|ADN57240.1| phage SPO1 DNA polymerase-related protein [Burkholderia sp.
           CCGE1003]
          Length = 342

 Score =  177 bits (449), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 56/245 (22%), Positives = 93/245 (37%), Gaps = 19/245 (7%)

Query: 26  WVFDEPNNEATYESQRKEKSIDSAIQPITNIR----------HIHSPLVQQADSIAQKA- 74
                    A+ + Q  +    +   P                +H P    A   A  A 
Sbjct: 89  EPQRATPGTASGDPQPAQARPSADPFPFDAPPDDGFAWFDDLPLHPPGESDAAVPALPAI 148

Query: 75  --CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKT 132
                  L   + +   C LC     T+        D M+IG  P ++++  G+PF G+ 
Sbjct: 149 NTLDWDALSERVATCERCRLCEKRTKTVFGVGDREADWMLIGEAPGENEDRVGEPFVGQA 208

Query: 133 GNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILL 191
           G +LD ML+S+ + R   ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++
Sbjct: 209 GKLLDNMLRSLTLARGANVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVALVKPKLIV 268

Query: 192 FIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
            +G          DA       G+          +P + T HP  L++    K   W  L
Sbjct: 269 ALGRFAAQSLLKTDA-SISSLRGRVHEYE----GVPVVVTYHPAYLLRSLPDKAKAWADL 323

Query: 252 ITLKK 256
              + 
Sbjct: 324 CLARD 328


>gi|148378081|ref|YP_001252622.1| uracil-DNA glycosylase [Clostridium botulinum A str. ATCC 3502]
 gi|153933715|ref|YP_001382480.1| uracil-DNA glycosylase [Clostridium botulinum A str. ATCC 19397]
 gi|153935117|ref|YP_001386032.1| uracil-DNA glycosylase [Clostridium botulinum A str. Hall]
 gi|148287565|emb|CAL81629.1| putative uracil-DNA glycosylase [Clostridium botulinum A str. ATCC
           3502]
 gi|152929759|gb|ABS35259.1| uracil-DNA glycosylase [Clostridium botulinum A str. ATCC 19397]
 gi|152931031|gb|ABS36530.1| uracil-DNA glycosylase [Clostridium botulinum A str. Hall]
          Length = 190

 Score =  177 bits (449), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 43/186 (23%), Positives = 76/186 (40%), Gaps = 6/186 (3%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
             +L     + + C L     + +         +M IG  P   ++ +G+PF GK G +L
Sbjct: 4   WSQLYDECINCNKCTLVKNRTNMVFGEGNISAPIMFIGEAPGADEDRTGRPFVGKAGQLL 63

Query: 137 DKMLQSIEIMRT-QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
            K L +++  R    +I  +    P  NR     E   C P +  Q+ L+ PKI++ +G 
Sbjct: 64  TKALLALDFKRDEHYYICNVCKCRPENNRTPKEEEAMTCLPYLRNQVALVKPKIMICLGA 123

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
               +    +  +  ++ GKW            +AT HP  L +    KK  W  L +++
Sbjct: 124 TALKYIMG-EQFRITRDRGKWIE----RKGYYIMATFHPAALFRDESKKKLLWQDLKSIR 178

Query: 256 KALKNL 261
           +    L
Sbjct: 179 EKYDEL 184


>gi|22299499|ref|NP_682746.1| hypothetical protein tll1956 [Thermosynechococcus elongatus BP-1]
 gi|22295682|dbj|BAC09508.1| tll1956 [Thermosynechococcus elongatus BP-1]
          Length = 235

 Score =  177 bits (449), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 59/238 (24%), Positives = 100/238 (42%), Gaps = 13/238 (5%)

Query: 30  EPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHD 89
           EP   + ++S  + +   +   P+    +   PL  +    A    +L  L    +    
Sbjct: 3   EPLQFSLFDSPTEAEPAPAT--PLDPATYDQIPLRAEVPIPAGTYRNLEALAVHCQQCQR 60

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIM-RT 148
           C L +T    + +       LMIIG  P  +++ SG+PF GK G +LDK+L S+ +    
Sbjct: 61  CGLAATRTHVVVSRGNPAAKLMIIGEGPGQAEDESGRPFVGKAGQLLDKILASVNLDSER 120

Query: 149 QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQK 208
             +I  I    PPGNR  + IE   C P ++ QI L++P+I+L  G    +     D + 
Sbjct: 121 DAYICNIVKCRPPGNRVPTPIEAAACIPYLLEQIRLVNPRIILLAGATAVSGLLK-DHRG 179

Query: 209 TYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLI-----KKNTWHALITLKKALKNL 261
             +  G+W            +   HP  L++         K  TW  +  ++  L+ L
Sbjct: 180 ITKIRGQWIEWQGRW----CMPIFHPAYLLRNNSREPGSPKWLTWQDIQAVRDRLRQL 233


>gi|194337589|ref|YP_002019383.1| phage SPO1 DNA polymerase-related protein [Pelodictyon
           phaeoclathratiforme BU-1]
 gi|194310066|gb|ACF44766.1| phage SPO1 DNA polymerase-related protein [Pelodictyon
           phaeoclathratiforme BU-1]
          Length = 203

 Score =  177 bits (449), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 55/200 (27%), Positives = 89/200 (44%), Gaps = 5/200 (2%)

Query: 62  PLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSD 121
           P V   +  A  +  L  L    R    C L  T L+ +         L +IG  P   +
Sbjct: 2   PPVSCVEEPASSSQELALLFETARKCRKCQLAETRLNFVFGEGDPAAKLAVIGEAPGAEE 61

Query: 122 NISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQ 181
           + SG+PF G++G +LDK+LQ+    R +++I  I    PPGNRN    E+E C P ++ Q
Sbjct: 62  DASGRPFVGRSGQLLDKILQAAGFNRPEVYICNILKCRPPGNRNPLPDEIENCIPWLLEQ 121

Query: 182 IELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
           +++++PK++L +G    N  F N        LG                T HP  L++ P
Sbjct: 122 LQIVNPKVILILGKVAANTIFENKLS-----LGSMRGKAIKWKGYDCFITYHPAALLRNP 176

Query: 242 LIKKNTWHALITLKKALKNL 261
             K+  W  +  + +    +
Sbjct: 177 EWKRGCWDDIQLMMRHYATI 196


>gi|153940469|ref|YP_001389438.1| uracil-DNA glycosylase [Clostridium botulinum F str. Langeland]
 gi|168177407|ref|ZP_02612071.1| uracil-DNA glycosylase [Clostridium botulinum NCTC 2916]
 gi|170756172|ref|YP_001779700.1| uracil-DNA glycosylase [Clostridium botulinum B1 str. Okra]
 gi|226947298|ref|YP_002802389.1| uracil-DNA glycosylase [Clostridium botulinum A2 str. Kyoto]
 gi|152936365|gb|ABS41863.1| uracil-DNA glycosylase [Clostridium botulinum F str. Langeland]
 gi|169121384|gb|ACA45220.1| uracil-DNA glycosylase [Clostridium botulinum B1 str. Okra]
 gi|182671008|gb|EDT82982.1| uracil-DNA glycosylase [Clostridium botulinum NCTC 2916]
 gi|226842858|gb|ACO85524.1| uracil-DNA glycosylase [Clostridium botulinum A2 str. Kyoto]
 gi|322804346|emb|CBZ01896.1| uracil-DNA glycosylase, family 4 [Clostridium botulinum H04402 065]
          Length = 190

 Score =  177 bits (449), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 43/186 (23%), Positives = 76/186 (40%), Gaps = 6/186 (3%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
             +L     + + C L     + +         +M IG  P   ++ +G+PF GK G +L
Sbjct: 4   WSQLYDECINCNKCTLVKNRTNMVFGEGNISAPIMFIGEAPGADEDRTGRPFVGKAGQLL 63

Query: 137 DKMLQSIEIMRT-QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
            K L +++  R    +I  +    P  NR     E   C P +  Q+ L+ PKI++ +G 
Sbjct: 64  TKALLALDFKRDEHYYICNVCKCRPENNRTPKEEEAMTCLPYLRNQVALVKPKIMICLGA 123

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
               +    +  +  ++ GKW            +AT HP  L +    KK  W  L +++
Sbjct: 124 TALKYIMG-EQFRITRDRGKWIE----RKGYYIMATFHPAALFRDESKKKLLWQDLKSIR 178

Query: 256 KALKNL 261
           +    L
Sbjct: 179 EKYDEL 184


>gi|291059633|gb|ADD72368.1| DNA polymerase, bacteriophage-type [Treponema pallidum subsp.
           pallidum str. Chicago]
          Length = 270

 Score =  177 bits (448), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 53/239 (22%), Positives = 90/239 (37%), Gaps = 15/239 (6%)

Query: 32  NNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKAC--------SLHELKSL 83
            +    E        DS I P        +   ++A S A            +   L+  
Sbjct: 30  LDLFRTEGIGPRPRNDSVILP-NAACSPRNHAGKRAQSTADACVRSSDGSVYTDETLREE 88

Query: 84  LRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSI 143
           + +   C L       +        D++++G  P   ++ SG+PF G++G +LD ML +I
Sbjct: 89  IFACRACELYQRRTHAVVGEGVADADVLVVGEAPGAEEDRSGRPFVGRSGKLLDAMLAAI 148

Query: 144 EIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFF 202
            + R Q  +I+ +    PP NR  +  E   C   +   + L  P  +L +G        
Sbjct: 149 GLSRQQNCYITNVVKCRPPRNRTPTPHETACCARFLHAHLTLHRPCAILVLGRCAAQHML 208

Query: 203 NNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
                   +  G++         IP LAT HP  L++   +K+  W  L T +  L  L
Sbjct: 209 Q-TTDGIGKLRGRFFTYQ----GIPLLATYHPSALLRDEALKRPAWEDLKTFRARLLQL 262


>gi|170760011|ref|YP_001785403.1| uracil-DNA glycosylase [Clostridium botulinum A3 str. Loch Maree]
 gi|169407000|gb|ACA55411.1| uracil-DNA glycosylase [Clostridium botulinum A3 str. Loch Maree]
          Length = 190

 Score =  177 bits (448), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 44/186 (23%), Positives = 76/186 (40%), Gaps = 6/186 (3%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
             +L     + + C L     + +         +M IG  P   ++ +G+PF GK G +L
Sbjct: 4   WSQLYDECINCNKCTLVKNRTNMVFGEGNISAPIMFIGEAPGADEDRTGRPFVGKAGQLL 63

Query: 137 DKMLQSIEIMRT-QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
            K L +++  R    +I  +    P  NR     E   C P +  Q+ LI PKI++ +G 
Sbjct: 64  TKALLALDFKRDEHYYICNVCKCRPENNRTPKEEEAMTCLPYLRNQVALIKPKIMICLGA 123

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
               +    +  +  ++ GKW            +AT HP  L +    KK  W  L +++
Sbjct: 124 TALKYIMG-EQFRITRDRGKWIE----RKGYYIMATFHPAALFRDESKKKLLWQDLKSIR 178

Query: 256 KALKNL 261
           +    L
Sbjct: 179 EKYDEL 184


>gi|222148035|ref|YP_002548992.1| DNA polymerase [Agrobacterium vitis S4]
 gi|221735023|gb|ACM35986.1| DNA polymerase [Agrobacterium vitis S4]
          Length = 302

 Score =  177 bits (448), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 75/221 (33%), Positives = 107/221 (48%), Gaps = 1/221 (0%)

Query: 39  SQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLS 98
                          T +       +  A   A+ A SL ELK+ L  F  C+L +++ S
Sbjct: 83  PALNRDRPAPRPAASTPLAIPDETAINDARFAAESARSLAELKAALEGFSSCNLKTSARS 142

Query: 99  TICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPW 158
           TI A       +M+IG  PS  D+  G  FSG+TG +LD+ML +I + R  + ++   PW
Sbjct: 143 TIFAEGPAEAGIMVIGPIPSADDDREGLAFSGRTGALLDRMLAAIGLRRDALLLTTAIPW 202

Query: 159 HPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSN 218
             PG+R  +  E  ICRP I RQI L  PK +L +GN T  FFF   A       G+W +
Sbjct: 203 RGPGDRMPTPAEAAICRPFIERQIALAEPKAVLLLGNFTARFFFGGTATIHS-MRGEWRD 261

Query: 219 LCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALK 259
           +      +  +AT HPQEL+Q P  K   W  L+  ++ L 
Sbjct: 262 VAAGGHGVAAMATFHPQELLQAPATKALAWRDLLAFRQRLA 302


>gi|254436695|ref|ZP_05050189.1| uracil-DNA glycosylase, family 4, putative [Octadecabacter
           antarcticus 307]
 gi|198252141|gb|EDY76455.1| uracil-DNA glycosylase, family 4, putative [Octadecabacter
           antarcticus 307]
          Length = 264

 Score =  177 bits (448), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 63/260 (24%), Positives = 120/260 (46%), Gaps = 12/260 (4%)

Query: 12  ILTIALFYADSGVYWVF-DEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSI 70
              +  +  + GV     D+P +    +  +       A   + +     +    + + I
Sbjct: 6   AKALLDWQVEMGVDEAIGDDPVDRYALQDVKPAPKAAQAPSTLPSAPPAVATAAPEINQI 65

Query: 71  AQKA------CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNIS 124
           +           L  L++ + +F  C L + + + + +  T G  +MII   P   D+ +
Sbjct: 66  SAANNAANAAQDLAGLRAAMGAFEGCALKAAARNLVFSGGTAGAPVMIIADAPDRDDDRA 125

Query: 125 GKPFSGKTGNMLDKMLQSIEIMRT---QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQ 181
           G+ F+G+TG +LDKML +I + R+    I+ + + PW+PP NR+ +  EM +  P + R 
Sbjct: 126 GELFAGRTGALLDKMLAAIGLGRSGDAPIYAAPVLPWNPPQNRDPNADEMAMMLPFLQRH 185

Query: 182 IELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
           I L +PK+L+ +GN       N       +  G W+++    + +P +    P  L+  P
Sbjct: 186 ITLAAPKVLILMGNGPCQALLNKSG--MTRLHGGWTDVQIGSASLPAIPMFAPSYLLTKP 243

Query: 242 LIKKNTWHALITLKKALKNL 261
             K++ W  L++LK  LK+L
Sbjct: 244 SAKRDAWSDLLSLKAHLKDL 263


>gi|91774769|ref|YP_544525.1| phage SPO1 DNA polymerase-related protein [Methylobacillus
           flagellatus KT]
 gi|91708756|gb|ABE48684.1| phage SPO1 DNA polymerase-related protein [Methylobacillus
           flagellatus KT]
          Length = 330

 Score =  177 bits (448), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 52/247 (21%), Positives = 90/247 (36%), Gaps = 16/247 (6%)

Query: 26  WVFDEPNNEATYESQRKEKSIDSAIQPIT----------NIRHIHSPLVQQADSIAQKAC 75
            V  EP  EA        +      + +                     Q     A  A 
Sbjct: 79  AVQAEPACEADSHEAGAIQPDPEYFEAMQTWPEFGESVVPPLIEEVSAPQGDRRTAIMAM 138

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
               L+  +     C L      T+        + + +G  P   ++  G+PF G  G +
Sbjct: 139 DWQALQQSVSECEACDLAQKRTQTVFGIGDPNAEWLFVGEAPGAEEDRWGEPFVGPAGQL 198

Query: 136 LDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           LD ML +I + R   ++I+ +    PP NR+    E+  C P + RQ+ELI PK+++ +G
Sbjct: 199 LDNMLAAIALKRGENVYIANVLKCRPPANRDPQGEEVVKCDPYLKRQVELIKPKLIVALG 258

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITL 254
                    +D        G   +       +P + T HP  L++    K   W  L   
Sbjct: 259 KFAAQSLLASDKSIAG-LRGALHDF----HGVPVIVTYHPAYLLRNLADKAKAWDDLCFA 313

Query: 255 KKALKNL 261
           ++ +++L
Sbjct: 314 RETMQHL 320


>gi|78187754|ref|YP_375797.1| Phage SPO1 DNA polymerase-related protein [Chlorobium luteolum DSM
           273]
 gi|78167656|gb|ABB24754.1| Phage SPO1 DNA polymerase-related protein [Chlorobium luteolum DSM
           273]
          Length = 199

 Score =  177 bits (448), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 51/190 (26%), Positives = 84/190 (44%), Gaps = 5/190 (2%)

Query: 72  QKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGK 131
             A +L  L+        C L  T  + +         L++IG  P   ++ +GKPF G+
Sbjct: 5   PTAEALGALRLETLECRKCRLAETRNTVVFGEGDPESKLVVIGEGPGAEEDATGKPFVGR 64

Query: 132 TGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILL 191
           +G +L K+L +I   R ++ I  I    PP NRN ++ E+  C P +  QIE+I PK++L
Sbjct: 65  SGQLLTKILAAIGFSREEVFICNIVKCRPPQNRNPAHDEIAACTPWLKSQIEIIRPKVIL 124

Query: 192 FIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
            +G    N     ++       GK          +    T HP  L++ P  K+  W  +
Sbjct: 125 LLGKVAANTILQ-NSLSMGAMRGKVLQWE----GVDCFVTYHPAALLRNPNWKRGCWEDV 179

Query: 252 ITLKKALKNL 261
             L+    N+
Sbjct: 180 QLLRHHYDNI 189


>gi|282901222|ref|ZP_06309151.1| Phage SPO1 DNA polymerase-related protein [Cylindrospermopsis
           raciborskii CS-505]
 gi|281193922|gb|EFA68890.1| Phage SPO1 DNA polymerase-related protein [Cylindrospermopsis
           raciborskii CS-505]
          Length = 223

 Score =  177 bits (448), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 48/192 (25%), Positives = 79/192 (41%), Gaps = 11/192 (5%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +++EL     + H C L       +         +MIIG  P   ++ +G PF GK+G +
Sbjct: 34  NVNELALQCENCHRCGLGKNRTHAVVGRGNPQAKIMIIGEAPGQHEDETGLPFVGKSGQL 93

Query: 136 LDKMLQSIE-IMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           LDK+L S+       ++I  I    PP NR  ++ E+  CRP ++ QI LI PKI+L  G
Sbjct: 94  LDKILASVNLTTEQDVYICNIVKCRPPENRVPTSEEINACRPYLLEQIRLIDPKIILLTG 153

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLI-----KKNTWH 249
                    +      +  G+W            +   HP  L++ P       K   W 
Sbjct: 154 ATAVKGVTGSKL-PITKIRGQWLEWE----GRLCMPIFHPSYLLRNPSKEQGSPKWLMWQ 208

Query: 250 ALITLKKALKNL 261
            +  ++     +
Sbjct: 209 DIQQIRNRYDQI 220


>gi|226939479|ref|YP_002794552.1| DNA-directed DNA polymerase, bacteriophage-type [Laribacter
           hongkongensis HLHK9]
 gi|226714405|gb|ACO73543.1| Probable DNA-directed DNA polymerase, bacteriophage-type
           [Laribacter hongkongensis HLHK9]
          Length = 259

 Score =  176 bits (447), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 46/231 (19%), Positives = 79/231 (34%), Gaps = 10/231 (4%)

Query: 26  WVFDEP----NNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELK 81
           W   +P       A+      +  +            +                    L 
Sbjct: 16  WCLRQPESGLPARASEVMTLPQPEVLPPATGTEPAPAVVLAPPTAVMEQVTATDDWDNLS 75

Query: 82  SLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQ 141
             +     C LC T   T+         LM+IG  P + +++ G+PF G  G +LD ML 
Sbjct: 76  RQVSGCRSCRLCETRTRTVLERGNRQAPLMLIGEGPGEQEDLQGRPFVGPAGKLLDAMLT 135

Query: 142 SIEI-MRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNF 200
           +        +++  +    PPGNRN    EM  C+  +  QI L+ P++++ +G      
Sbjct: 136 ATGWSPEQDMYVCNVVKCRPPGNRNPQPDEMAACQAYLQTQIRLVRPRLIVALGRVAAQS 195

Query: 201 FFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
               +     +  G+           P + T HP  L++    K   W  L
Sbjct: 196 LLATELSV-ARLRGQTHQYA----GYPLVVTYHPAYLLRNLPDKARAWQDL 241


>gi|307266580|ref|ZP_07548111.1| phage SPO1 DNA polymerase-related protein [Thermoanaerobacter
           wiegelii Rt8.B1]
 gi|326391764|ref|ZP_08213285.1| phage SPO1 DNA polymerase-related protein [Thermoanaerobacter
           ethanolicus JW 200]
 gi|306918377|gb|EFN48620.1| phage SPO1 DNA polymerase-related protein [Thermoanaerobacter
           wiegelii Rt8.B1]
 gi|325992202|gb|EGD50673.1| phage SPO1 DNA polymerase-related protein [Thermoanaerobacter
           ethanolicus JW 200]
          Length = 186

 Score =  176 bits (447), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 44/185 (23%), Positives = 84/185 (45%), Gaps = 5/185 (2%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L EL         C L  T  + +         +M +G  P   +++ G+PF G+ G +L
Sbjct: 6   LKELYLECLHCTKCDLSKTKTNMVFGEGNLRAKVMFVGEGPGRDEDLQGRPFVGRAGQLL 65

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
           +KML+ + + R +++I+ +    PP NR     E++ C P +  Q+ +I+PKI++ +G  
Sbjct: 66  NKMLEEVGLKREEVYIANVVKCRPPNNRVPLQSEIDACLPYLRNQVAIIAPKIIVCLGAT 125

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
                 + + + T    G+W         +  +AT HP  +++ P   +        +K+
Sbjct: 126 AAKAIIDKNFKITT-MRGQWFE----RKGVKIIATYHPAAILRDPEKLEPAMEDFKKIKE 180

Query: 257 ALKNL 261
            L  L
Sbjct: 181 ELNKL 185


>gi|237746081|ref|ZP_04576561.1| DNA polymerase bacteriophage-type [Oxalobacter formigenes HOxBLS]
 gi|229377432|gb|EEO27523.1| DNA polymerase bacteriophage-type [Oxalobacter formigenes HOxBLS]
          Length = 317

 Score =  176 bits (447), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 52/225 (23%), Positives = 83/225 (36%), Gaps = 7/225 (3%)

Query: 42  KEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTIC 101
                     P  ++    +     A   A    S  +L   +     CHLC T    + 
Sbjct: 88  PPPPASGTGFPAFDVADAATASALSA-ETAAGPDSWEKLLGEIGHCERCHLCKTRNKVVP 146

Query: 102 ATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHP 160
                  D + IG  P   ++  G+PF G++G +LD M+ ++ + R   ++I+ I     
Sbjct: 147 GIGDREADWLFIGEGPGFHEDRQGEPFVGRSGKLLDAMMAAMRMKRGENVYIANIVKCRA 206

Query: 161 PG----NRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNN-DAQKTYQNLGK 215
                 +R  +  E  IC P + RQI+LI PKI++ +G        N            +
Sbjct: 207 SNESGKDRQPTEEEAAICMPYLERQIDLIRPKIMVALGKTAAVALLNTGRDVSLGSLRNR 266

Query: 216 WSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
                T    IP + T HP  L++ P  KK  W  L         
Sbjct: 267 EHFFRTGGRKIPLVVTYHPSYLLRTPGGKKQAWQDLCRALDIYDE 311


>gi|296158932|ref|ZP_06841760.1| phage SPO1 DNA polymerase-related protein [Burkholderia sp. Ch1-1]
 gi|295890807|gb|EFG70597.1| phage SPO1 DNA polymerase-related protein [Burkholderia sp. Ch1-1]
          Length = 391

 Score =  176 bits (446), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 57/251 (22%), Positives = 91/251 (36%), Gaps = 24/251 (9%)

Query: 25  YWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSP------------------LVQQ 66
                EP    T    R+ K      +          P                      
Sbjct: 132 DAAQAEPGRAQTPAETRQPKQPQQPSRTPEPPAFDAPPEDDFAWFDDLPTHAPADAPDAA 191

Query: 67  ADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGK 126
             + A        L   + +   C LC    ST+      G D M+IG  P ++++  G+
Sbjct: 192 PPAPAIHTLDWDALSERVAACRLCRLCEKRRSTVFGVGDRGADWMLIGEAPGENEDRLGE 251

Query: 127 PFSGKTGNMLDKMLQSIEIMRTQI-HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELI 185
           PF G+ G +LD ML+S+ + R    +I+ +    PPGNRN    E+  C P + RQ+ L+
Sbjct: 252 PFVGQAGKLLDNMLRSLTLARDTNVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVALV 311

Query: 186 SPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKK 245
            PK+++ +G          DA       G+          +P + T HP  L++    K 
Sbjct: 312 KPKLIVALGRFAAQSLLKTDA-SISSLRGRVHEYE----GVPVIVTYHPAYLLRSLPDKA 366

Query: 246 NTWHALITLKK 256
             W  L   + 
Sbjct: 367 KAWADLCLARD 377


>gi|91784145|ref|YP_559351.1| Phage SPO1 DNA polymerase-related protein [Burkholderia xenovorans
           LB400]
 gi|91688099|gb|ABE31299.1| Phage SPO1 DNA polymerase-related protein [Burkholderia xenovorans
           LB400]
          Length = 401

 Score =  176 bits (446), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 52/243 (21%), Positives = 91/243 (37%), Gaps = 25/243 (10%)

Query: 34  EATYESQRKEKSIDSAIQPITNIRHIHSPLVQQ-------------------ADSIAQKA 74
            A   ++ ++                 +P                         + A   
Sbjct: 147 RAQTPAETRQPKQPQQPSRTPEPPAFDAPPEDDFAWFDDLPTHAPADAADAAPPATAIHT 206

Query: 75  CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
                L   + +   C LC    +T+      G D M+IG  P ++++  G+PF G+ G 
Sbjct: 207 LDWDALSERVAACRLCRLCEKRTNTVFGVGDRGADWMLIGEAPGENEDRLGEPFVGQAGK 266

Query: 135 MLDKMLQSIEIMRT-QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFI 193
           +LD ML+S+ + R   ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +
Sbjct: 267 LLDNMLRSLTLARDANVYIANVIKCRPPGNRNPEPDEVARCEPYLQRQVALVKPKLIVAL 326

Query: 194 GNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALIT 253
           G          DA       G+          +P + T HP  L++    K   W  L  
Sbjct: 327 GRFAAQSLLKTDA-SISSLRGRVHEYE----GVPVIVTYHPAYLLRSLPDKAKAWADLCL 381

Query: 254 LKK 256
            + 
Sbjct: 382 ARD 384


>gi|217076510|ref|YP_002334226.1| uracil-DNA glycosylase [Thermosipho africanus TCF52B]
 gi|217036363|gb|ACJ74885.1| uracil-DNA glycosylase [Thermosipho africanus TCF52B]
          Length = 199

 Score =  176 bits (446), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 43/184 (23%), Positives = 79/184 (42%), Gaps = 9/184 (4%)

Query: 82  SLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQ 141
             +++   C L     + +         +M +G  P + +++SG+PF G+ G +L K+L+
Sbjct: 12  ERIKNCKACPLHENRTNVVPGEGNLDSPIMFVGEGPGEDEDLSGRPFVGRAGQLLTKILE 71

Query: 142 SIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFF 201
           S+ I R  ++I+ I    PP NR  +  E  IC   +  QIE+I+P++++ +G      F
Sbjct: 72  SVNIKREDVYITNIVKCRPPNNRTPTKEEASICSHYLFAQIEVINPRMIVTLGKPALELF 131

Query: 202 FNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLI-----KKNTWHALITLKK 256
               +    +  G           I      HP  L++ P       K  TW  +  ++K
Sbjct: 132 LG-KSVAITKVRGNEFEWK---GGIIIFPMFHPSYLLRNPSKAKGSPKDLTWQDIKRVRK 187

Query: 257 ALKN 260
               
Sbjct: 188 YYDQ 191


>gi|221198347|ref|ZP_03571393.1| uracil-DNA glycosylase, family 4 [Burkholderia multivorans CGD2M]
 gi|221208286|ref|ZP_03581290.1| uracil-DNA glycosylase, family 4 [Burkholderia multivorans CGD2]
 gi|221171934|gb|EEE04377.1| uracil-DNA glycosylase, family 4 [Burkholderia multivorans CGD2]
 gi|221182279|gb|EEE14680.1| uracil-DNA glycosylase, family 4 [Burkholderia multivorans CGD2M]
          Length = 358

 Score =  176 bits (446), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 49/205 (23%), Positives = 84/205 (40%), Gaps = 6/205 (2%)

Query: 53  ITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMI 112
                   +    +A            L + +     C LC    +T+        D M+
Sbjct: 143 AAPPGDSATAAEPRAAEAPVAMLDWDALAARVADCTRCRLCEKRTNTVFGVGDREADWML 202

Query: 113 IGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEM 171
           IG  P ++++  G+PF G+ G +LD ML+S+ + R   ++I+ +    PPGNRN    E+
Sbjct: 203 IGEAPGENEDKQGEPFVGQAGKLLDNMLRSLSLQRGENVYIANVIKCRPPGNRNPEPDEV 262

Query: 172 EICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLAT 231
             C P + RQ+ L+ PK+++ +G          DA       G+          +P + T
Sbjct: 263 ARCEPYLQRQVALVKPKLIVALGRFAAQTLLKTDASIAS-LRGRVHAYE----GVPVIVT 317

Query: 232 VHPQELIQYPLIKKNTWHALITLKK 256
            HP  L++    K   W  L   + 
Sbjct: 318 YHPAYLLRSLPDKAKAWADLCLARD 342


>gi|167038549|ref|YP_001666127.1| phage SPO1 DNA polymerase-like protein [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|256752669|ref|ZP_05493520.1| phage SPO1 DNA polymerase-related protein [Thermoanaerobacter
           ethanolicus CCSD1]
 gi|320116945|ref|YP_004187104.1| phage SPO1 DNA polymerase-like protein [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
 gi|166857383|gb|ABY95791.1| phage SPO1 DNA polymerase-related protein [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|256748431|gb|EEU61484.1| phage SPO1 DNA polymerase-related protein [Thermoanaerobacter
           ethanolicus CCSD1]
 gi|319930036|gb|ADV80721.1| phage SPO1 DNA polymerase-related protein [Thermoanaerobacter
           brockii subsp. finnii Ako-1]
          Length = 186

 Score =  176 bits (446), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 44/185 (23%), Positives = 81/185 (43%), Gaps = 5/185 (2%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L EL         C L  T  + +         +M +G  P   +++ G+PF G+ G  L
Sbjct: 6   LKELYLECLHCTKCDLSKTKTNMVFGEGNLRAKVMFVGEGPGRDEDLQGRPFVGRAGQFL 65

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
           +KML+ + + R +++I+ I    PP NR     E++ C P +  Q+ +I+PK+++ +G  
Sbjct: 66  NKMLEDVGLKREEVYIANIVKCRPPNNRVPLQSEIDACLPYLRNQVAIIAPKMIVCLGAT 125

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
                 +    K     G+W         +  +AT HP  +++ P   +        +K+
Sbjct: 126 AAKAIID-KNFKITVMRGQWFE----RKGVKIIATYHPAAILRDPEKLEPAMEDFKKIKE 180

Query: 257 ALKNL 261
            L  L
Sbjct: 181 ELDKL 185


>gi|313201963|ref|YP_004040621.1| phage spo1 DNA polymerase-like protein [Methylovorus sp. MP688]
 gi|312441279|gb|ADQ85385.1| phage SPO1 DNA polymerase-related protein [Methylovorus sp. MP688]
          Length = 377

 Score =  176 bits (446), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 51/202 (25%), Positives = 91/202 (45%), Gaps = 6/202 (2%)

Query: 61  SPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDS 120
           +  + Q    +        L+S + +   C L  T   T+        + +I+G  P   
Sbjct: 166 ATSLGQGRRDSIAQLDWQGLQSCVANCQACSLSRTRTQTVFGVGDPAAEWLIVGEAPGAE 225

Query: 121 DNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIM 179
           ++  G+PF G+ G +LD ML +I++ R   ++I+ +    PP NR+    E++ C P + 
Sbjct: 226 EDKRGEPFVGQAGQLLDNMLGAIQLKRGQNVYIANVLKCRPPQNRDPQGEEVQQCDPFLK 285

Query: 180 RQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ 239
           RQ+ELI PK++L +G        N+DA       G+          +P + T HP  L++
Sbjct: 286 RQVELIKPKLILALGKFAAQSLLNSDATIGS-MRGRQHEYN----GVPVIVTYHPAYLLR 340

Query: 240 YPLIKKNTWHALITLKKALKNL 261
             + K   W  L   +  ++ L
Sbjct: 341 NLMDKAKAWEDLCLARATMRKL 362


>gi|254415738|ref|ZP_05029496.1| uracil-DNA glycosylase, family 4 [Microcoleus chthonoplastes PCC
           7420]
 gi|196177444|gb|EDX72450.1| uracil-DNA glycosylase, family 4 [Microcoleus chthonoplastes PCC
           7420]
          Length = 237

 Score =  176 bits (446), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 46/219 (21%), Positives = 83/219 (37%), Gaps = 11/219 (5%)

Query: 49  AIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQ 108
                ++ +    P   +         S+  L         C L +T    +        
Sbjct: 18  TSSTPSDFQPELIPTDAKVPIPPGTYDSMESLADHCNGCQRCELAATRTHAVVGRGNVHA 77

Query: 109 DLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIM-RTQIHISMISPWHPPGNRNLS 167
            +MIIG  P  +++  G PF G+ G +L+K+L ++++     ++I  ++   PPGNR  +
Sbjct: 78  PIMIIGEAPGQNEDEQGLPFVGRAGQLLEKILAAVKLDSERDVYICNMNKCRPPGNRVPT 137

Query: 168 NIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIP 227
             E+  C+P ++ QI L+ PKI+L  G                +  G W           
Sbjct: 138 PDEVAACKPYLLEQIRLVDPKIILLTGATAVKGLTGEKR-GITKIRGTWMEWE----GRL 192

Query: 228 TLATVHPQELIQYPLI-----KKNTWHALITLKKALKNL 261
            +   HP  L++ P       K   W  +  ++  L  L
Sbjct: 193 CMPIFHPAYLLRNPSREQGKPKWFMWQDIQAVRAKLNEL 231


>gi|167040413|ref|YP_001663398.1| phage SPO1 DNA polymerase-like protein [Thermoanaerobacter sp.
           X514]
 gi|300913700|ref|ZP_07131017.1| phage SPO1 DNA polymerase-related protein [Thermoanaerobacter sp.
           X561]
 gi|307723285|ref|YP_003903036.1| phage SPO1 DNA polymerase-like protein [Thermoanaerobacter sp.
           X513]
 gi|166854653|gb|ABY93062.1| phage SPO1 DNA polymerase-related protein [Thermoanaerobacter sp.
           X514]
 gi|300890385|gb|EFK85530.1| phage SPO1 DNA polymerase-related protein [Thermoanaerobacter sp.
           X561]
 gi|307580346|gb|ADN53745.1| phage SPO1 DNA polymerase-related protein [Thermoanaerobacter sp.
           X513]
          Length = 186

 Score =  176 bits (446), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 44/185 (23%), Positives = 81/185 (43%), Gaps = 5/185 (2%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L EL         C L  T    +         +M +G  P   +++ G+PF G+ G +L
Sbjct: 6   LKELYLACLYCTKCDLHKTKTHMVFGEGNLRAKVMFVGEGPGKDEDLQGRPFVGRAGQLL 65

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
           +KML+ + + R +++I+ +    PP NR     E++ C P +  Q+ +I+PKI++ +G  
Sbjct: 66  NKMLEDVGLKREEVYIANVVKCRPPNNRVPLQSEVDACLPYLRNQVAIIAPKIIVCLGAT 125

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
                 +    K     G+W         +  +AT HP  +++ P   +        +K+
Sbjct: 126 AAKAIID-KNFKITAMRGQWFE----RKGVKIIATYHPAAILRDPEKLEPAMEDFKKIKE 180

Query: 257 ALKNL 261
            L  L
Sbjct: 181 ELDKL 185


>gi|110597629|ref|ZP_01385914.1| phage SPO1 DNA polymerase-related protein [Chlorobium ferrooxidans
           DSM 13031]
 gi|110340749|gb|EAT59226.1| phage SPO1 DNA polymerase-related protein [Chlorobium ferrooxidans
           DSM 13031]
          Length = 218

 Score =  176 bits (446), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 52/203 (25%), Positives = 90/203 (44%), Gaps = 5/203 (2%)

Query: 58  HIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTP 117
            + S         A  A  L EL+    +   C L  T  + +    +   ++++IG  P
Sbjct: 8   PVVSTPSGSEHPSASAAEQLAELQKAAMACRKCRLAETRRNVVVGEGSPLAEIVVIGEAP 67

Query: 118 SDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPI 177
              ++ SG+PF G++G +L K+LQ++   R +++I  I    PPGNRN    E+  CRP 
Sbjct: 68  GAEEDASGRPFVGRSGQLLTKILQAVHFEREKVYICNILKCRPPGNRNPLEDEIGFCRPW 127

Query: 178 IMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQEL 237
           + +Q++++ PKI+L +G    N     +        GK               T HP  L
Sbjct: 128 LQQQLQILKPKIILILGKVAANTIL-ENKLSMGMMRGKLIEW----KGFDCFVTYHPAAL 182

Query: 238 IQYPLIKKNTWHALITLKKALKN 260
           ++ P  K+  W  +  ++   K 
Sbjct: 183 LRNPNWKRACWEDVQMMEHHYKK 205


>gi|317052571|ref|YP_004113687.1| phage SPO1 DNA polymerase-like protein [Desulfurispirillum indicum
           S5]
 gi|316947655|gb|ADU67131.1| phage SPO1 DNA polymerase-related protein [Desulfurispirillum
           indicum S5]
          Length = 279

 Score =  176 bits (445), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 51/227 (22%), Positives = 95/227 (41%), Gaps = 3/227 (1%)

Query: 34  EATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHL- 92
            +  +   +  S     Q  T       P      ++     S   L+  L+    C L 
Sbjct: 33  RSLSDPGPRSASRPPVFQQTTRPAAEPPPRQTTTPAVIPSQDSWQRLEEDLKDCQACALA 92

Query: 93  CSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHI 152
                + +        D+M+IG  P   ++  G+PF GK+G  LD+++ ++   R +++I
Sbjct: 93  RQGRKTIVMGEGNRQADIMLIGEGPGFDEDRLGRPFVGKSGQKLDQIMLAVGFQREELYI 152

Query: 153 SMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQN 212
           + +    PPGNRN    E+ IC+  + RQI L++P+ +L +G    NF +        + 
Sbjct: 153 ANVVKCRPPGNRNPEPGEISICQQFLQRQIRLVNPRFILALGKFAANFLYGESGAP--RT 210

Query: 213 LGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALK 259
           LG        +  I  + T HP  L++   +++  W  +  L+    
Sbjct: 211 LGSMREKILHYGDIQVVVTYHPSALLRNENLRRPVWDDVRVLRNLYD 257


>gi|288931880|ref|YP_003435940.1| phage SPO1 DNA polymerase-related protein [Ferroglobus placidus DSM
           10642]
 gi|288894128|gb|ADC65665.1| phage SPO1 DNA polymerase-related protein [Ferroglobus placidus DSM
           10642]
          Length = 198

 Score =  176 bits (445), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 40/187 (21%), Positives = 79/187 (42%), Gaps = 3/187 (1%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L E+   ++    C L  T  + +     E   ++ +G  P   +++ G+PF G  G  
Sbjct: 2   TLEEIHEEIKKCRKCELYKTKTNYVPGEGNEKAKIVFVGEAPGREEDLQGRPFVGAAGQY 61

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           L K L+   I R+++ I+ I    PP NR+    E+E C P +++Q+  I P +++ +G 
Sbjct: 62  LTKTLEKCGIKRSEVFITNILKCRPPNNRDPKPEEVEKCFPYLVKQLHEIKPDVIVCLGR 121

Query: 196 KTKNFFF---NNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALI 252
            +            +    + GK          +  + T HP  ++  P +K+     + 
Sbjct: 122 HSAREILNFFGKKFKGISADRGKIFEAELDGKKVKIIPTYHPAAVLYKPQLKEYFEEDIR 181

Query: 253 TLKKALK 259
            +    K
Sbjct: 182 KVASFFK 188


>gi|260654952|ref|ZP_05860440.1| uracil-DNA glycosylase [Jonquetella anthropi E3_33 E1]
 gi|260630267|gb|EEX48461.1| uracil-DNA glycosylase [Jonquetella anthropi E3_33 E1]
          Length = 208

 Score =  176 bits (445), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 48/190 (25%), Positives = 87/190 (45%), Gaps = 10/190 (5%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L +L   +     C LC T  ST+    +    LMI+G  P   ++  G+PF G+ G +L
Sbjct: 20  LRQLNQEVGGCSRCGLCETRHSTVPGEGSGENGLMIVGEGPGADEDEQGRPFVGRAGQLL 79

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
            ++LQ+  I R++  I+ +    PP NR     E+  C+  +  Q+ L+ PK+++ +GN 
Sbjct: 80  SQILQAAGIDRSRSWITNVVKCRPPKNRTPQIEEVLACQDWLEAQLILLQPKVIVSMGNT 139

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLI-----KKNTWHAL 251
              +F  + +    +  G+W +       +  +   HP  L++         K  TW  +
Sbjct: 140 PTKWFL-HSSMGITKLRGQWFSW----RGVDLMPMFHPSYLLREDSRSVGSPKYLTWQDI 194

Query: 252 ITLKKALKNL 261
             +KK L  +
Sbjct: 195 QNVKKRLDEV 204


>gi|291541525|emb|CBL14635.1| uracil-DNA glycosylase, family 4 [Ruminococcus bromii L2-63]
          Length = 191

 Score =  176 bits (445), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 49/188 (26%), Positives = 95/188 (50%), Gaps = 6/188 (3%)

Query: 75  CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
            +  ELKS   + H C LC T  + +     E  ++M IG  P +++++ G+PF G+ G 
Sbjct: 3   NTWEELKSACENCHRCELCETRTNVVVGVGNENAEVMFIGEGPGENEDLQGEPFVGRAGK 62

Query: 135 MLDKMLQSIEIMRTQI-HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFI 193
           +LDKML ++++ R +  +I+ +    PP NR+    E E+C   +  Q+ +I PKI++ +
Sbjct: 63  LLDKMLAAVDLDRNKNIYIANMVKCRPPKNRDPKPEEQEMCIEWLRTQVRMIKPKIIVCL 122

Query: 194 GNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALIT 253
           G         +D  K  +  G+W       + +  +A +HP  +++ P  K + +   + 
Sbjct: 123 GRIAAARLIKSD-IKITKEHGQWIE----KNGVLMMAMLHPAAILRDPRRKPDAFDDFLK 177

Query: 254 LKKALKNL 261
           L+  +  +
Sbjct: 178 LRDKINEV 185


>gi|125975586|ref|YP_001039496.1| phage SPO1 DNA polymerase-related protein [Clostridium thermocellum
           ATCC 27405]
 gi|256005909|ref|ZP_05430854.1| phage SPO1 DNA polymerase-related protein [Clostridium thermocellum
           DSM 2360]
 gi|281416598|ref|ZP_06247618.1| phage SPO1 DNA polymerase-related protein [Clostridium thermocellum
           JW20]
 gi|125715811|gb|ABN54303.1| phage SPO1 DNA polymerase-related protein [Clostridium thermocellum
           ATCC 27405]
 gi|255990113|gb|EEU00250.1| phage SPO1 DNA polymerase-related protein [Clostridium thermocellum
           DSM 2360]
 gi|281408000|gb|EFB38258.1| phage SPO1 DNA polymerase-related protein [Clostridium thermocellum
           JW20]
 gi|316939705|gb|ADU73739.1| phage SPO1 DNA polymerase-related protein [Clostridium thermocellum
           DSM 1313]
          Length = 189

 Score =  176 bits (445), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 47/186 (25%), Positives = 86/186 (46%), Gaps = 5/186 (2%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           S  EL  +  +   C L  T  + +         +M++G  P + +++ G PF G  G +
Sbjct: 3   SWEELIKVCSNCTKCGLSKTRTNIVIGRGNINAPMMLVGEGPGEQEDLQGLPFVGPAGKL 62

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           LD +L+++ I     +I+ I    PPGNR  ++ E E+C P +  Q+ L+ P+I++ +G 
Sbjct: 63  LDLLLKAMRIKEDMYYIANIVKCRPPGNRVPTDDEAEMCLPYLRNQLVLVKPRIIVCLGA 122

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
               +  + +A K     G+W            +AT HP  L++    K   W     +K
Sbjct: 123 TAMKYIIDRNA-KITNVRGQWIE----RKGYWIIATFHPAALLRDESKKVLMWEDFKKVK 177

Query: 256 KALKNL 261
           + L ++
Sbjct: 178 QRLDSI 183


>gi|289208938|ref|YP_003461004.1| phage SPO1 DNA polymerase-related protein [Thioalkalivibrio sp.
           K90mix]
 gi|288944569|gb|ADC72268.1| phage SPO1 DNA polymerase-related protein [Thioalkalivibrio sp.
           K90mix]
          Length = 264

 Score =  176 bits (445), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 53/217 (24%), Positives = 88/217 (40%), Gaps = 10/217 (4%)

Query: 47  DSAIQPITNIRHIHSPLVQQADSIAQ---KACSLHELKSLLRSFHDC-HLCSTSLSTICA 102
             + Q          PLV  AD   +         EL++ +R    C  L +    T+  
Sbjct: 47  AESAQAPGAPSETSEPLVSPADVPEEGGVAVLDWPELEARVRECTACAELAAQRTQTVFG 106

Query: 103 TQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPP 161
                   + +G  P   ++  G+PF G+ G +LD ML ++ + R   + I+ +    PP
Sbjct: 107 VGDRRARWLFVGEAPGAEEDRRGEPFVGRAGQLLDSMLAALGLDRGQDVFIANVLKCRPP 166

Query: 162 GNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCT 221
            NR+ S  E   CR  + RQI L+ P++++ +G          D     Q LG+      
Sbjct: 167 NNRDPSPDESRACRGFLDRQIALVQPEVIVALGRIAAQHLLETD-----QPLGRMRGSLH 221

Query: 222 PHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
            +  +P + T HP  L++ P  K   W  L   +  L
Sbjct: 222 RYREVPLVVTYHPAYLLRKPQDKAKAWQDLQRARACL 258


>gi|119486055|ref|ZP_01620117.1| Phage SPO1 DNA polymerase-related protein [Lyngbya sp. PCC 8106]
 gi|119456830|gb|EAW37958.1| Phage SPO1 DNA polymerase-related protein [Lyngbya sp. PCC 8106]
          Length = 243

 Score =  175 bits (444), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 49/218 (22%), Positives = 86/218 (39%), Gaps = 11/218 (5%)

Query: 49  AIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQ 108
           A    ++      P   Q     +   +L E+       H C L +     +        
Sbjct: 17  ATPTPSHFNRDQIPQDVQVQIPPETYQNLDEIADHCNQCHRCVLGNNRTHAVIGRGNLQA 76

Query: 109 DLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIE-IMRTQIHISMISPWHPPGNRNLS 167
            +MIIG  P  +++  G PF G++G +LDK+L+S+      +++IS      PP NR  +
Sbjct: 77  AIMIIGEAPGKNEDEQGLPFVGRSGQLLDKILESVGLSTEREVYISNAIRCRPPENRTPT 136

Query: 168 NIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIP 227
             E+E C+P ++ QI L+ P+I+L  G            Q   +  G+W           
Sbjct: 137 AAEIEACKPYLLEQIRLVDPQIILLTGATAVKSLLAEK-QGITKIRGEWRQWE----GRL 191

Query: 228 TLATVHPQELIQYPLI-----KKNTWHALITLKKALKN 260
            +   HP  L++ P +     K   W  +  ++     
Sbjct: 192 CMPIFHPAYLLRNPSLEPGKPKWLMWEDIKKVRNKYDE 229


>gi|56479144|ref|YP_160733.1| DNA polymerase-related protein,bacteriophage-type [Aromatoleum
           aromaticum EbN1]
 gi|56315187|emb|CAI09832.1| DNA polymerase-related protein,bacteriophage-type [Aromatoleum
           aromaticum EbN1]
          Length = 273

 Score =  175 bits (444), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 50/224 (22%), Positives = 89/224 (39%), Gaps = 9/224 (4%)

Query: 37  YESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTS 96
           + ++  + S      P+     + SP  +       +      L + +R+   C LC   
Sbjct: 53  FSAREPQASHRPHPDPVAAAPAVDSPDERARRI---ETLDWEALDADIRACTACRLCERR 109

Query: 97  LSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ-IHISMI 155
              +          M +G  P   ++  G+PF G  G +LD ML +I + R + ++I+  
Sbjct: 110 RQAVPGVGDRQASWMFVGEGPGAEEDQRGEPFVGAAGKLLDAMLAAIGLKRGEGVYIANA 169

Query: 156 SPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGK 215
               PP NR   N E+E C P + RQI L+ P++L+ +G          D        G+
Sbjct: 170 VKCRPPHNRTPGNDEIEACAPYLARQIALLQPRLLVALGRPAARALLGVD-VAIGAARGQ 228

Query: 216 WSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALK 259
                     +P + T HP  L++    K   W  L   ++ ++
Sbjct: 229 VF----RCRGMPVVVTYHPAYLLRNQRDKAKVWEDLCFARELME 268


>gi|221215432|ref|ZP_03588396.1| uracil-DNA glycosylase, family 4 [Burkholderia multivorans CGD1]
 gi|221164616|gb|EED97098.1| uracil-DNA glycosylase, family 4 [Burkholderia multivorans CGD1]
          Length = 358

 Score =  175 bits (443), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 51/218 (23%), Positives = 86/218 (39%), Gaps = 6/218 (2%)

Query: 40  QRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLST 99
                  D A           +    +A            L + +     C LC    +T
Sbjct: 130 MPPAADDDFAWFDAAPPGDSATAAEPRAAEAPVAMLDWDALAARVADCTRCRLCEKRTNT 189

Query: 100 ICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPW 158
           +        D M+IG  P ++++  G+PF G+ G +LD ML+S+ + R   ++I+ +   
Sbjct: 190 VFGVGDREADWMLIGEAPGENEDKQGEPFVGQAGKLLDNMLRSLSLQRGENVYIANVIKC 249

Query: 159 HPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSN 218
            PPGNRN    E+  C P + RQ+ L+ PK+++ +G          DA       G+   
Sbjct: 250 RPPGNRNPEPDEVARCEPYLQRQVALVKPKLIVALGRFAAQTLLKTDASIAS-LRGRVHA 308

Query: 219 LCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
                  +P + T HP  L++    K   W  L   + 
Sbjct: 309 YE----GVPVIVTYHPAYLLRSLPDKAKAWADLCLARD 342


>gi|297616747|ref|YP_003701906.1| phage SPO1 DNA polymerase-related protein [Syntrophothermus
           lipocalidus DSM 12680]
 gi|297144584|gb|ADI01341.1| phage SPO1 DNA polymerase-related protein [Syntrophothermus
           lipocalidus DSM 12680]
          Length = 228

 Score =  175 bits (443), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 50/187 (26%), Positives = 86/187 (45%), Gaps = 5/187 (2%)

Query: 75  CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
            SL EL +   +   C L S     +     +  DLM++G  P   ++  G+PF G  G 
Sbjct: 41  SSLEELAARAGACSRCRLRSGCRQVVFGEGDQKADLMLVGEGPGQVEDEQGRPFVGPAGQ 100

Query: 135 MLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           +LD++L++  I R +++I+ I    PPGNR  +  E+  CR  +  QI L+SP+I++ +G
Sbjct: 101 LLDRILEACAIRRDEVYITNIVKCRPPGNRLPNPDEVAACRGWLEAQIRLMSPRIIVCLG 160

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITL 254
                      A       G+W         +  +A  HP  L++ P +K+  W     +
Sbjct: 161 LLATRTVIEAKA-TMAGIHGQWF----KRGDVWMMAVYHPAALLRDPRLKRPAWEDFKLI 215

Query: 255 KKALKNL 261
           +   + L
Sbjct: 216 RDKYQQL 222


>gi|15922569|ref|NP_378238.1| DNA-directed DNA polymerase [Sulfolobus tokodaii str. 7]
 gi|15623359|dbj|BAB67347.1| 220aa long hypothetical DNA-directed DNA polymerase,
           bacteriophage-type [Sulfolobus tokodaii str. 7]
          Length = 220

 Score =  175 bits (443), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 43/186 (23%), Positives = 83/186 (44%), Gaps = 4/186 (2%)

Query: 75  CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
            SL ++K  + S   C L     + +        ++M +G  P ++++  G+PF G  G 
Sbjct: 2   DSLEKIKEEVISCKKCKLWQFRTNAVPGEGYPKAEIMFVGEAPGENEDKEGRPFVGAAGK 61

Query: 135 MLDKML-QSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFI 193
           +L +M+ + + + R Q+ I+ +    PP NR+    E+  C P + RQI++I PKI++ +
Sbjct: 62  LLTQMIKEILGLERDQVFITNVVKCRPPNNRDPEEDEITACSPYLDRQIDIIMPKIIVTL 121

Query: 194 GNKTKNFFF---NNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHA 250
           G  +  + F     +     +  GK          I    T HP   +  P ++K     
Sbjct: 122 GRHSTKYIFSKMGENFSSITKVRGKSYVWKYKEKEIIVFPTYHPAAALYNPNLRKILEED 181

Query: 251 LITLKK 256
              +++
Sbjct: 182 FKKIRE 187


>gi|297170986|gb|ADI22001.1| uracil-DNA glycosylase [uncultured myxobacterium HF0200_01L06]
          Length = 257

 Score =  175 bits (443), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 48/263 (18%), Positives = 101/263 (38%), Gaps = 16/263 (6%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVFDEPNNEAT---YESQRKEKSIDSAIQPITNIR 57
           M   +      +L  A  + +       +E  +        +    K ++     + +  
Sbjct: 1   MDPVQAGELRSLLASARSWLE----ECLEEGLDRIERPLPTAPAPRKPVEEEPA-LASPT 55

Query: 58  HIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTP 117
              S  +     + Q    L ++++ L     C L       +        D++ +G  P
Sbjct: 56  AAQSTALPTPGPLTQTRPDLAQVRATLGECTRCALSEKRTQIVFGDGNPDADILFVGEGP 115

Query: 118 SDSDNISGKPFSGKTGNMLDKMLQS-IEIMRTQIHISMISPWHPPGNRNLSNIEMEICRP 176
            + +++ G PF G+ G +L +M++  + + R  ++I  I    PPGNRN    E+  CRP
Sbjct: 116 GEQEDLRGLPFVGRAGELLTQMIEKGMGLARQDVYICNIVKCRPPGNRNPLPTEVNACRP 175

Query: 177 IIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQE 236
            +  QI+ ++P++++ +G    +     D     +  G W         I  + T+HP  
Sbjct: 176 FLDGQIDAVAPRVIVSLGKPAASLLLGRD-VAITRVRGTWHEY----RGIALMPTLHPAY 230

Query: 237 LIQY--PLIKKNTWHALITLKKA 257
           L++      ++  W  L +    
Sbjct: 231 LLRQYTAENRRWVWEDLKSALAR 253


>gi|38493049|pdb|1UI1|A Chain A, Crystal Structure Of Uracil-Dna Glycosylase From Thermus
           Thermophilus Hb8
          Length = 205

 Score =  175 bits (443), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 52/192 (27%), Positives = 89/192 (46%), Gaps = 11/192 (5%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L  L++  ++   C L       +         L I+G  P + ++ +G+PF GK G +
Sbjct: 2   TLELLQAQAQNCTACRLXEGRTRVVFGEGNPDAKLXIVGEGPGEEEDKTGRPFVGKAGQL 61

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEIC-RPIIMRQIELISPKILLFIG 194
           L+++L++  I R +++I+ I    PP NR     E +IC    +++QIELI+P+I++ +G
Sbjct: 62  LNRILEAAGIPREEVYITNIVKCRPPQNRAPLPDEAKICTDKWLLKQIELIAPQIIVPLG 121

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLI-----KKNTWH 249
                FF         +  GKW         I      HP  L++ P       K  TW 
Sbjct: 122 AVAAEFFLGEK-VSITKVRGKWYEW----HGIKVFPXFHPAYLLRNPSRAPGSPKHLTWL 176

Query: 250 ALITLKKALKNL 261
            +  +K+AL  L
Sbjct: 177 DIQEVKRALDAL 188


>gi|218442796|ref|YP_002381116.1| phage SPO1 DNA polymerase-related protein [Cyanothece sp. PCC 7424]
 gi|218175154|gb|ACK73886.1| phage SPO1 DNA polymerase-related protein [Cyanothece sp. PCC 7424]
          Length = 209

 Score =  174 bits (442), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 62/196 (31%), Positives = 92/196 (46%), Gaps = 10/196 (5%)

Query: 71  AQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSG 130
           +     L  LK        C L       +  + T   D+M+IG  P  +++ +GKPF+G
Sbjct: 13  SNSTSPLKTLKKTCARCTQCGLHKNRTKVVFGSGTLEADIMLIGEAPGQTEDKTGKPFTG 72

Query: 131 KTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKIL 190
           K G +LDKML SI + R QI+++ I    PP NR  +  E+E CRP ++ QIE I+PK +
Sbjct: 73  KAGKLLDKMLASINLERGQIYLTNIIKCRPPNNRTPTEKEIETCRPYLLAQIEFINPKFI 132

Query: 191 LFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLI-----KK 245
           +  G            +   Q  GKW            ++  HP  L++ P +     K 
Sbjct: 133 VLAGGSAYRGLTG-KRKPISQVRGKWFKWHNS----KCISIFHPAYLLRNPSLEKGSPKW 187

Query: 246 NTWHALITLKKALKNL 261
            TW  LI+LK+ L  L
Sbjct: 188 LTWQDLISLKRKLNKL 203


>gi|312135590|ref|YP_004002928.1| phage SPO1 DNA polymerase-like protein [Caldicellulosiruptor
           owensensis OL]
 gi|311775641|gb|ADQ05128.1| phage SPO1 DNA polymerase-related protein [Caldicellulosiruptor
           owensensis OL]
          Length = 185

 Score =  174 bits (442), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 53/187 (28%), Positives = 89/187 (47%), Gaps = 6/187 (3%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +  EL++   S   C +     + +     +   L+ +G  P + ++  GKPF G+ G  
Sbjct: 3   TWEELENACISCEKCPISKNRTNVVVGDGNKNAKLVFVGEAPGEEEDKQGKPFVGRAGKF 62

Query: 136 LDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           LD  L S+E+ R    +I  I    PP NR  +  E + C P +  QI+LISPKI++ +G
Sbjct: 63  LDLALTSLELSREKDFYICNILKCRPPNNRVPTEAEAQNCLPFLRAQIKLISPKIIVCLG 122

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITL 254
                +    D  K  Q+ GKW            +AT HP  L++ P  +++ +  L ++
Sbjct: 123 ATAMKYILGKDL-KITQDRGKWFE----KGGFWIMATYHPAALLRDPGKREDFYRDLKSV 177

Query: 255 KKALKNL 261
           K+ L+ L
Sbjct: 178 KQKLEKL 184


>gi|145220372|ref|YP_001131081.1| phage SPO1 DNA polymerase-related protein [Prosthecochloris
           vibrioformis DSM 265]
 gi|145206536|gb|ABP37579.1| phage SPO1 DNA polymerase-related protein [Chlorobium
           phaeovibrioides DSM 265]
          Length = 191

 Score =  174 bits (442), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 52/188 (27%), Positives = 83/188 (44%), Gaps = 5/188 (2%)

Query: 74  ACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTG 133
           + SL  L         C L  T  S +         LM+IG  P   ++ SG+PF G++G
Sbjct: 3   SSSLEALAKEADKCRKCRLADTRHSVVFGEGNPEAGLMVIGEAPGADEDASGRPFIGRSG 62

Query: 134 NMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFI 193
            +L K+LQ++E  R ++ I+ I    PP NRN    E+  C P + +Q+E+I PK++L +
Sbjct: 63  QLLTKILQAVEFSRDEVFIANIVKCRPPENRNPLQDEIACCTPWLEKQLEIIRPKVILLL 122

Query: 194 GNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALIT 253
           G    N     +        GK               T HP  L++ P  K+     +  
Sbjct: 123 GKVAANTIL-VNQTALGTMRGKVLEW----KGTDCFVTYHPAALLRNPNWKRGCREDVQL 177

Query: 254 LKKALKNL 261
           +++   NL
Sbjct: 178 MRRHYDNL 185


>gi|320102815|ref|YP_004178406.1| phage SPO1 DNA polymerase-like protein [Isosphaera pallida ATCC
           43644]
 gi|319750097|gb|ADV61857.1| phage SPO1 DNA polymerase-related protein [Isosphaera pallida ATCC
           43644]
          Length = 334

 Score =  174 bits (442), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 53/239 (22%), Positives = 92/239 (38%), Gaps = 13/239 (5%)

Query: 26  WVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLR 85
            V   P  +A   + R  +S  +++  I                  Q++ +L  L   + 
Sbjct: 95  TVAASPVLKAPERTNRPTRSSPTSV--IATALFEEDGFATPPLPSDQRSNALTVLAEEVS 152

Query: 86  SFHDCH-LCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML-DKMLQSI 143
           S   C  L ++   T+    +    LM IG  P + ++  G PF G+ G +L D +++ +
Sbjct: 153 SCQACPALVASRTQTVFGVGSPTARLMFIGEAPGEEEDAKGVPFVGRAGQLLTDMIVKGM 212

Query: 144 EIMRTQIHISMISPWHPPG----NRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKN 199
            + R Q++I+      P      NR     E+  C   + RQIE++ P+ L  +G     
Sbjct: 213 GLTRDQVYIANACKCRPTDAEGRNRTPDPSEIRNCASYLDRQIEIVRPEFLCLLGKTAAQ 272

Query: 200 FFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
                      Q   +       H  +  + T HP  L++ P  KK  W  L  L  A+
Sbjct: 273 AVLG-TPLPLAQLRKRLH----RHRGMTVVVTFHPAYLLRNPSDKKEAWEDLKMLMSAM 326


>gi|302338167|ref|YP_003803373.1| phage SPO1 DNA polymerase-related protein [Spirochaeta smaragdinae
           DSM 11293]
 gi|301635352|gb|ADK80779.1| phage SPO1 DNA polymerase-related protein [Spirochaeta smaragdinae
           DSM 11293]
          Length = 240

 Score =  174 bits (442), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 52/221 (23%), Positives = 88/221 (39%), Gaps = 6/221 (2%)

Query: 42  KEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTIC 101
           +++   S              L          A  L E+   + S   C L       + 
Sbjct: 24  RKRRHPSLRDAGFTGLKASPALRSVPARDTDPALLLKEIAQEVSSCTACRLHEGRHHAVP 83

Query: 102 ATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQI-HISMISPWHP 160
                   ++IIG  P   ++ SG+PF G  G  LDK +++I + R++   I  +    P
Sbjct: 84  GEGVVHPMVLIIGEGPGAQEDASGRPFVGPAGQYLDKWMKAIGLSRSEHLFIGNVIKCRP 143

Query: 161 PGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLC 220
           PGNR+    E   CRP + RQI+++ PK +L +G        +         +G+     
Sbjct: 144 PGNRDPLPDEAAACRPFLDRQIDILRPKAILTVGRIAMQLLLDT-----TDGIGRRHGKR 198

Query: 221 TPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
             +  IP + T HP  +++ P  +   W  L  L+  L+ L
Sbjct: 199 FEYRGIPLVPTYHPSGVLRNPEYRAPVWKDLKALRSLLEEL 239


>gi|37521977|ref|NP_925354.1| DNA polymerase related protein [Gloeobacter violaceus PCC 7421]
 gi|35212976|dbj|BAC90349.1| glr2408 [Gloeobacter violaceus PCC 7421]
          Length = 229

 Score =  174 bits (442), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 47/217 (21%), Positives = 86/217 (39%), Gaps = 11/217 (5%)

Query: 51  QPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDL 110
                ++    P       +        ++++   +   C L  T    +         L
Sbjct: 14  AAPPQVQFDRIPNDAGVTIVPGTYSDFEQIRTHCNACFRCELGKTRTHAVVGRGNPQALL 73

Query: 111 MIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIM-RTQIHISMISPWHPPGNRNLSNI 169
           M+IG  P ++++++G PF GK G +LDK+L++++      ++++ I    PPGNR  +  
Sbjct: 74  MVIGEGPGENEDLTGIPFVGKAGQLLDKILEAVQFDTEKDVYVANIVKCRPPGNRKPAPE 133

Query: 170 EMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTL 229
           EM+ C   +  QI +I PKILL  G          D +   +  G+W            +
Sbjct: 134 EMKACLGYLNEQIRMIDPKILLLAGGTAVEGLTG-DKRGITKLRGQWLQWQGRW----VM 188

Query: 230 ATVHPQELIQYPLI-----KKNTWHALITLKKALKNL 261
              HP  L++ P       K   W  +  ++     L
Sbjct: 189 PFFHPAFLLRNPSRDAGSPKWLAWQDIQQVRAKYDEL 225


>gi|325107250|ref|YP_004268318.1| phage SPO1 DNA polymerase-related protein [Planctomyces
           brasiliensis DSM 5305]
 gi|324967518|gb|ADY58296.1| phage SPO1 DNA polymerase-related protein [Planctomyces
           brasiliensis DSM 5305]
          Length = 329

 Score =  174 bits (441), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 45/183 (24%), Positives = 76/183 (41%), Gaps = 6/183 (3%)

Query: 77  LHELKSLLRSFHDCH-LCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           L  L   +     C  L  T   T+        ++M IG  P   ++  G+PF G+ G +
Sbjct: 141 LASLAERVAGCKRCPELARTRTQTVFGVGNPMAEVMFIGEAPGADEDKQGEPFVGRAGKL 200

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           L++++++    R +++I  I    PPGNRN + IE   CR  +  QIE ++P+ ++  G 
Sbjct: 201 LNRIIEACGWEREELYICNILRCRPPGNRNPTPIEASHCREYLDGQIETVNPRFIVCWGT 260

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
                    +     +  GK             L T HP  L++ P  +      L  L 
Sbjct: 261 VAAQNLLGVNT-PIGRMRGKLYEY----GRSQVLCTYHPSYLLRNPSARSLVRDDLQILL 315

Query: 256 KAL 258
           K +
Sbjct: 316 KEM 318


>gi|307299315|ref|ZP_07579116.1| phage SPO1 DNA polymerase-related protein [Thermotogales bacterium
           mesG1.Ag.4.2]
 gi|306915111|gb|EFN45497.1| phage SPO1 DNA polymerase-related protein [Thermotogales bacterium
           mesG1.Ag.4.2]
          Length = 205

 Score =  174 bits (441), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 49/190 (25%), Positives = 90/190 (47%), Gaps = 8/190 (4%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L EL S +     C L S+  +T+    +    ++ +G  P   ++ SG+PF G+ G +L
Sbjct: 11  LLELNSKISDCSLCPLSSSRTNTVPGEGSIETPVVFVGEGPGADEDASGRPFVGRAGELL 70

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
            K+L+S+++ R  I I+ I    PP NR  +  E + C P ++ Q+ +I PK+++ +G  
Sbjct: 71  TKILESVKLSREDIFITNIVKCRPPKNRVPTAEEQKACSPYMLSQLAIIRPKLIVALGAT 130

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLI-----KKNTWHAL 251
             ++F N +  +  +  G+  +       I   A  HP  L++         K  TW  +
Sbjct: 131 ALSYFVNEEGIQITKVRGRIFDWI---GGIKVFAMFHPSYLLRNASRAPGSPKSLTWEDI 187

Query: 252 ITLKKALKNL 261
             ++K    L
Sbjct: 188 QNVRKMYDQL 197


>gi|220905704|ref|YP_002481015.1| phage SPO1 DNA polymerase-like protein [Cyanothece sp. PCC 7425]
 gi|219862315|gb|ACL42654.1| phage SPO1 DNA polymerase-related protein [Cyanothece sp. PCC 7425]
          Length = 238

 Score =  174 bits (441), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 56/223 (25%), Positives = 92/223 (41%), Gaps = 11/223 (4%)

Query: 45  SIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQ 104
            +  A    T +     P   Q    A    SL E+       H C L  +    +    
Sbjct: 14  PLPEAEIVSTPVDKEQIPSSAQVPIPAGTYTSLEEMAPHCDRCHRCDLGQSRTHAVVGRG 73

Query: 105 TEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIM-RTQIHISMISPWHPPGN 163
                +MIIG  P  +++ +G PF GK G +L+K+L ++++  +  ++I  I    PPGN
Sbjct: 74  HPQAPIMIIGEGPGQTEDETGLPFVGKAGQLLEKILAAVQLDSQQDVYICNIVKCRPPGN 133

Query: 164 RNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPH 223
           R  +  EM  CRP ++ Q+ L+ PKI+L  G          D +   +  G+W       
Sbjct: 134 RVPTPEEMAACRPYLLEQLRLVDPKIILLTGATAVKGLTG-DKRGITKIRGQWLEWE--- 189

Query: 224 SIIPTLATVHPQELIQYPLI-----KKNTWHALITLKKALKNL 261
                +  +HP  L++ P       K   W  + T++  L  L
Sbjct: 190 -GRLCMPILHPAYLLRNPSKEPGSPKWLMWQDIQTVRAKLDEL 231


>gi|284052961|ref|ZP_06383171.1| phage SPO1 DNA polymerase-related protein [Arthrospira platensis
           str. Paraca]
 gi|291571857|dbj|BAI94129.1| uracil-DNA glycosylase [Arthrospira platensis NIES-39]
          Length = 238

 Score =  174 bits (441), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 44/206 (21%), Positives = 81/206 (39%), Gaps = 11/206 (5%)

Query: 62  PLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSD 121
           P   +         +L ++         C L       +         +MIIG  P   +
Sbjct: 35  PQNAKTPIPPGTYQTLAQIADHCNRCSRCELGKNRTHAVIGRGNPTAPIMIIGEAPGQHE 94

Query: 122 NISGKPFSGKTGNMLDKMLQSIEIMRT-QIHISMISPWHPPGNRNLSNIEMEICRPIIMR 180
           +  G PF G++G +LD +L S+ +    +++IS      PP NR  +  E++ C+P ++ 
Sbjct: 95  DEQGLPFVGRSGKLLDNILDSVGLSTDTEVYISNAIRCRPPENRTPTASELQACKPYLLE 154

Query: 181 QIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQY 240
           QI LI+P+I+L  G          D +   +  G+W            +   HP  L++ 
Sbjct: 155 QIRLINPQIILLTGATAVKSILG-DKRPITKIRGQWFQWE----GRQCMPIFHPAYLLRN 209

Query: 241 PLI-----KKNTWHALITLKKALKNL 261
                   K   W  +  +++ L  +
Sbjct: 210 SSRDVGKPKWLMWQDMQVVRQRLNEI 235


>gi|319941916|ref|ZP_08016237.1| hypothetical protein HMPREF9464_01456 [Sutterella wadsworthensis
           3_1_45B]
 gi|319804569|gb|EFW01439.1| hypothetical protein HMPREF9464_01456 [Sutterella wadsworthensis
           3_1_45B]
          Length = 316

 Score =  174 bits (441), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 55/231 (23%), Positives = 98/231 (42%), Gaps = 7/231 (3%)

Query: 37  YESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQK--ACSLHELKSLLRSFHDCHLCS 94
            ++ +  ++  ++    T  + +  P V  +  +  K  +     L++L +    C L +
Sbjct: 73  PQAPQSARAAQTSAASPTVPQAVAQPAVGMSTELLSKIASADWQALQTLSQHCTACALSA 132

Query: 95  -TSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIE-IMRTQIHI 152
                 + +    G  L+++G  P   +++ G PF GK+G +L  ML S+  + R    I
Sbjct: 133 MGRQHVVFSDGGPGPKLVVVGEAPGAEEDLQGIPFVGKSGKLLTAMLDSLGLVRRRDCVI 192

Query: 153 SMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNN--DAQKTY 210
             +    PP NRN    E+  C   + RQ+ELI P +L   G    +       +     
Sbjct: 193 LNVLKCRPPRNRNPQPEEIVCCGHWLARQLELIKPDVLFLAGRFAISSLLKPADEMFSIS 252

Query: 211 QNLGKWSNLCTP-HSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
           +  G+      P    +P +AT HP  L++ P  K   W  L+ LK A+K 
Sbjct: 253 KMRGRIHLAQLPDGRQVPAVATYHPSYLLRSPAAKSKAWEDLLLLKAAMKQ 303


>gi|320106538|ref|YP_004182128.1| phage SPO1 DNA polymerase-like protein [Terriglobus saanensis
           SP1PR4]
 gi|319925059|gb|ADV82134.1| phage SPO1 DNA polymerase-related protein [Terriglobus saanensis
           SP1PR4]
          Length = 319

 Score =  174 bits (440), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 49/209 (23%), Positives = 91/209 (43%), Gaps = 7/209 (3%)

Query: 49  AIQPITNIRHIHSPLVQQADSIAQ-KACSLHELKSLLRSFHDCHL-CSTSLSTICATQTE 106
           A   +  I       + Q  ++   KA +L  ++  +     C L  +   + + A    
Sbjct: 109 APPDMPLISFNARAELPQHRALPDDKAATLQSVRHHIGDCTRCPLAYAGRRNIVFADGNP 168

Query: 107 GQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNL 166
              LM +G  P   ++ SG PF GK G +L+ M+ ++ + R +++I+ I    PPGNRN 
Sbjct: 169 NARLMFVGEGPGADEDASGVPFVGKAGQLLNNMINAMGLKREEVYIANIVKCRPPGNRNP 228

Query: 167 SNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSII 226
             +E   C   ++ QI+++ P+I++ +G     +             G+W ++       
Sbjct: 229 EPVEANTCSQFLVDQIDIVQPQIIVALGAIAATYLLGVKRPLVA-LRGQWHDV----RGS 283

Query: 227 PTLATVHPQELIQYPLIKKNTWHALITLK 255
            T  T HP  L++ P +K   W  L  + 
Sbjct: 284 KTAVTYHPAYLLRDPSMKGEAWKDLQRVM 312


>gi|289577329|ref|YP_003475956.1| phage SPO1 DNA polymerase-related protein [Thermoanaerobacter
           italicus Ab9]
 gi|297543618|ref|YP_003675920.1| phage SPO1 DNA polymerase-like protein [Thermoanaerobacter
           mathranii subsp. mathranii str. A3]
 gi|289527042|gb|ADD01394.1| phage SPO1 DNA polymerase-related protein [Thermoanaerobacter
           italicus Ab9]
 gi|296841393|gb|ADH59909.1| phage SPO1 DNA polymerase-related protein [Thermoanaerobacter
           mathranii subsp. mathranii str. A3]
          Length = 186

 Score =  174 bits (440), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 44/185 (23%), Positives = 82/185 (44%), Gaps = 5/185 (2%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L EL         C L  T  + +         ++ +G  P   +++ G+PF G+ G +L
Sbjct: 6   LKELYLECLHCTKCDLSKTKTNMVFGEGNLRAKVIFVGEGPGRDEDLQGRPFVGRAGQLL 65

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
           +KML+ + + R +++I+ I    PP NR     E++ C P +  Q+ +I+PKI++ +G  
Sbjct: 66  NKMLEEVGLKRGEVYIANIVKCRPPNNRVPLQSEVDACLPYLRNQVAIIAPKIIVCLGAT 125

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
                 +    K     G+W         +  +AT HP  +++ P   +        +K+
Sbjct: 126 AAKAIID-KNFKITVMRGQWFE----RKGVKIIATYHPAAILRDPEKLEPAMEDFKKIKE 180

Query: 257 ALKNL 261
            L  L
Sbjct: 181 ELDKL 185


>gi|154248846|ref|YP_001409671.1| phage SPO1 DNA polymerase-related protein [Fervidobacterium nodosum
           Rt17-B1]
 gi|154152782|gb|ABS60014.1| phage SPO1 DNA polymerase-related protein [Fervidobacterium nodosum
           Rt17-B1]
          Length = 202

 Score =  174 bits (440), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 44/186 (23%), Positives = 88/186 (47%), Gaps = 9/186 (4%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKM 139
           ++  +++   CHL     +T+         +M +G  P + ++  G+PF GK G +L K+
Sbjct: 10  IEERIKNCQSCHLHLLRKNTVPGEGNIYSPIMFVGEGPGEEEDNQGRPFVGKAGQLLTKI 69

Query: 140 LQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKN 199
           ++S+ I R  ++I+ +    PP NR  +N+E++ C   +  QIE+I+P++++ +G+    
Sbjct: 70  IESVNIKREDVYITNVVKCRPPNNRVPTNLEIQSCSHYLTAQIEIINPRMIIPLGSTAAT 129

Query: 200 FFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKK-----NTWHALITL 254
           FF     +   +  GK          I      HP  L++ P  +K      TW  +  +
Sbjct: 130 FFLG-KEEPITKIRGKKFTWKGD---IIIFPMFHPSYLLRNPSKEKGSPKDLTWQDIKEV 185

Query: 255 KKALKN 260
           ++    
Sbjct: 186 RRYYDQ 191


>gi|305662671|ref|YP_003858959.1| phage SPO1 DNA polymerase-related protein [Ignisphaera aggregans
           DSM 17230]
 gi|304377240|gb|ADM27079.1| phage SPO1 DNA polymerase-related protein [Ignisphaera aggregans
           DSM 17230]
          Length = 214

 Score =  173 bits (439), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 46/189 (24%), Positives = 87/189 (46%), Gaps = 3/189 (1%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           S  EL++ +R+   C L     + +     +   +M IG  P  +++  G+PF G  G +
Sbjct: 6   SWQELENAIRNCTRCQLYRNRKNAVPGEGPKDAFVMFIGEAPGATEDEMGRPFVGAAGKL 65

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           L  +++++ I R  ++I+ +    PP NR  S+ E+E C   +  QI LI PKI++ +GN
Sbjct: 66  LTMIMENLGISRDSVYITNVVKCRPPNNREPSDEEIEKCGIYLETQIRLIKPKIIVTLGN 125

Query: 196 KTKNFFF---NNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALI 252
                 F       +   +  G+  N+      +  + T+HP   +  P +K      L 
Sbjct: 126 IAGKTIFFMGKERWEGIMKMRGRVYNMKIFDLTVYVIPTIHPAAGLYNPNLKNLLIQDLK 185

Query: 253 TLKKALKNL 261
            +K+ +  +
Sbjct: 186 IVKECIDKM 194


>gi|312793048|ref|YP_004025971.1| phage SPO1 DNA polymerase-like protein [Caldicellulosiruptor
           kristjanssonii 177R1B]
 gi|312876719|ref|ZP_07736698.1| phage SPO1 DNA polymerase-related protein [Caldicellulosiruptor
           lactoaceticus 6A]
 gi|311796450|gb|EFR12800.1| phage SPO1 DNA polymerase-related protein [Caldicellulosiruptor
           lactoaceticus 6A]
 gi|312180188|gb|ADQ40358.1| phage SPO1 DNA polymerase-related protein [Caldicellulosiruptor
           kristjanssonii 177R1B]
          Length = 185

 Score =  173 bits (439), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 52/187 (27%), Positives = 90/187 (48%), Gaps = 6/187 (3%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +  EL+S   S   C +     + +     +   L+ +G  P + ++  GKPF G+ G  
Sbjct: 3   TWEELESACLSCEKCPISKNRTNVVVGDGNKNAKLVFVGEAPGEEEDKQGKPFVGRAGKF 62

Query: 136 LDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           LD  L S+E+ R    +I  I    PP NR  + +E + C P +  QI+LI+PKI++ +G
Sbjct: 63  LDLALTSLELSREKDFYICNILKCRPPNNRVPTEVEAQNCLPFLRAQIKLIAPKIIVCLG 122

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITL 254
                +    D  K  Q+ GKW            +AT HP  L++ P  +++ +  L ++
Sbjct: 123 ATAMKYILGKDL-KITQDRGKWFE----KGGFWIMATYHPAALLRDPGKREDFYRDLKSV 177

Query: 255 KKALKNL 261
           K+ L+ +
Sbjct: 178 KEKLEKI 184


>gi|113474288|ref|YP_720349.1| phage SPO1 DNA polymerase-like protein [Trichodesmium erythraeum
           IMS101]
 gi|110165336|gb|ABG49876.1| phage SPO1 DNA polymerase-related protein [Trichodesmium erythraeum
           IMS101]
          Length = 242

 Score =  173 bits (439), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 48/193 (24%), Positives = 85/193 (44%), Gaps = 11/193 (5%)

Query: 75  CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
            ++ ++         C L     + +        ++M+IG  P  +++  G PF GK+G 
Sbjct: 46  KTMEQITFHCNQCRRCELGENRTNAVIGRGNPEAEIMVIGEAPGQNEDEQGLPFVGKSGQ 105

Query: 135 MLDKMLQSIEIMRTQI-HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFI 193
           +LDK+LQS+E+   +  +IS      PP NR  +  E+  C+P ++ QI L++PKI+L  
Sbjct: 106 LLDKILQSVELSSDRHVYISNAIRCRPPENRTPTLKEVGACKPYLLEQIRLVNPKIILLT 165

Query: 194 GNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLI-----KKNTW 248
           G          D +   +  G+W            +   HP  L++ P       K   W
Sbjct: 166 GATAVKALTG-DKRGITKIRGQWIEWE----GRLCMPIFHPAYLLRNPSREPGKPKWLMW 220

Query: 249 HALITLKKALKNL 261
             +  +K+ L+ L
Sbjct: 221 QDIQAVKQKLEEL 233


>gi|70606003|ref|YP_254873.1| uracil DNA glycosylase superfamily protein [Sulfolobus
           acidocaldarius DSM 639]
 gi|68566651|gb|AAY79580.1| uracil DNA glycosylase superfamily protein [Sulfolobus
           acidocaldarius DSM 639]
          Length = 213

 Score =  173 bits (439), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 39/188 (20%), Positives = 80/188 (42%), Gaps = 4/188 (2%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
            L E+ + ++    C L     + +         +M IG  P ++++  G+PF G  G +
Sbjct: 2   ELDEIANEIKVCRKCKLWMDRRNAVPGEGNPKAKVMFIGEAPGETEDEEGRPFVGSAGKL 61

Query: 136 LDKMLQSI-EIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           L K+++    I R ++ I+ +    PP NR+    E+  C   +  QI LI P++++ +G
Sbjct: 62  LTKLIEDTLGIKRDEVFITNVVKCRPPNNRDPEEDEITACSSYLDLQIRLIKPQVIVTLG 121

Query: 195 NKTKNFFF---NNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
             + ++     N +     ++ GK         +I    T HP   +  P ++       
Sbjct: 122 RHSTSYILSKANIEFHSITKSRGKVYEWKIDDHVINIFPTYHPAAALYNPNLRSVLEEDF 181

Query: 252 ITLKKALK 259
             ++K + 
Sbjct: 182 KMIRKLIN 189


>gi|222085329|ref|YP_002543859.1| DNA polymerase bacteriophage-type (uracil-DNA glycosylase) protein
           [Agrobacterium radiobacter K84]
 gi|221722777|gb|ACM25933.1| DNA polymerase bacteriophage-type (uracil-DNA glycosylase) protein
           [Agrobacterium radiobacter K84]
          Length = 255

 Score =  173 bits (439), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 82/238 (34%), Positives = 124/238 (52%), Gaps = 6/238 (2%)

Query: 28  FDEPNNEATYESQRKEKSIDSAIQPITNIRH-----IHSPLVQQADSIAQKACSLHELKS 82
            + P   A    Q + +                        V+QA   A+ A SL ELK+
Sbjct: 15  VETPQPAARPAQQPERRQAAPKAAAPAAKPRSAPAIPDEQAVEQARFAAESARSLSELKT 74

Query: 83  LLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQS 142
            L +F+ C+L +++ STI A+      +M+IG  PS  D+  G PF+G+TG +LDKML +
Sbjct: 75  ALEAFNSCNLKNSARSTIFASGAPEGRIMVIGPMPSADDDREGAPFAGRTGLLLDKMLAA 134

Query: 143 IEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFF 202
           I + R  I ++ + PW PPGNR  S  E+EICRP I RQI L  P+ LL +GN T   FF
Sbjct: 135 IGLKRNDILLTNVIPWRPPGNRAPSAPEIEICRPFIERQITLAEPQALLLLGNFTARHFF 194

Query: 203 NNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
            ++        G+W ++      IP +A++HPQEL+  P+ K+  W+ L+  +  +  
Sbjct: 195 GSNETIHG-LRGQWRDVTISGRAIPAIASLHPQELLTAPINKRLAWNDLLAFRTRIDA 251


>gi|302872283|ref|YP_003840919.1| phage SPO1 DNA polymerase-related protein [Caldicellulosiruptor
           obsidiansis OB47]
 gi|302575142|gb|ADL42933.1| phage SPO1 DNA polymerase-related protein [Caldicellulosiruptor
           obsidiansis OB47]
          Length = 185

 Score =  173 bits (439), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 52/187 (27%), Positives = 90/187 (48%), Gaps = 6/187 (3%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +  EL++   S   C +     + +     +   L+ +G  P + ++  GKPF G+ G  
Sbjct: 3   TWEELENACISCEKCPISKNRTNVVVGDGNKNAKLVFVGEAPGEEEDKQGKPFVGRAGKF 62

Query: 136 LDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           LD  L S+E+ R    +I  I    PP NR  + +E + C P +  QI+LISPKI++ +G
Sbjct: 63  LDLALTSLELSREKDFYICNILKCRPPNNRVPTEVEAQNCLPFLKAQIKLISPKIIVCLG 122

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITL 254
                +    D  K  Q+ GKW            +AT HP  L++ P  +++ +  L ++
Sbjct: 123 ATAMKYILGKDL-KITQDRGKWFE----KGGFWIMATYHPAALLRDPGKREDFYRDLKSV 177

Query: 255 KKALKNL 261
           K+ L+ +
Sbjct: 178 KERLEKI 184


>gi|206560476|ref|YP_002231240.1| uracil DNA glycosylase superfamily protein [Burkholderia
           cenocepacia J2315]
 gi|198036517|emb|CAR52414.1| uracil DNA glycosylase superfamily protein [Burkholderia
           cenocepacia J2315]
          Length = 343

 Score =  173 bits (439), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 54/240 (22%), Positives = 89/240 (37%), Gaps = 18/240 (7%)

Query: 29  DEPNNEATYESQRKEKSIDSAIQP------------ITNIRHIHSPLVQQADSIAQKACS 76
           D P  +A   +            P                         +       A  
Sbjct: 92  DRPRAQAASPASTDTMPPTGDAPPAADDDFAWFDAAPPGESVPVPAAESRPAGTPVAALD 151

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
              L + +     C LC    +T+        D M+IG  P ++++  G+PF G+ G +L
Sbjct: 152 WDALAARVADCTLCRLCEKRTNTVFGVGDREADWMLIGEAPGENEDKQGEPFVGQAGKLL 211

Query: 137 DKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           D MLQS+ + R   ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G 
Sbjct: 212 DNMLQSLSLKRGDNVYIANVIKCRPPGNRNPEPDEVASCEPYLQRQVALVKPKLIVALGR 271

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
                    DA       G+          +P + T HP  L++    K   W  L   +
Sbjct: 272 FAAQTLLKTDASIAS-LRGRVHAYE----GVPVIVTYHPAYLLRSLQDKSKAWADLCLAR 326


>gi|75907116|ref|YP_321412.1| phage SPO1 DNA polymerase-like protein [Anabaena variabilis ATCC
           29413]
 gi|75700841|gb|ABA20517.1| Phage SPO1 DNA polymerase-related protein [Anabaena variabilis ATCC
           29413]
          Length = 227

 Score =  173 bits (438), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 47/206 (22%), Positives = 84/206 (40%), Gaps = 11/206 (5%)

Query: 62  PLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSD 121
           P   +         ++ EL         C L ST    +         +M++G  P  ++
Sbjct: 23  PTDAKIPIPPGTYTNMTELAQHCNQCQRCELGSTRTHAVVGRGNLKAPIMVVGEAPGQNE 82

Query: 122 NISGKPFSGKTGNMLDKMLQSIE-IMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMR 180
           + +G PF G++G +LDK+L S++      ++I+ I+   PP NR  +  EM  C P ++ 
Sbjct: 83  DETGLPFVGRSGQLLDKILASVDLTTEHDVYIANINKCRPPDNRVPTPNEMAACLPYLLE 142

Query: 181 QIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQY 240
           QI L++PKI+L  G          D +   +  G+W            +   HP  L++ 
Sbjct: 143 QIRLVNPKIILLTGATAVKGLTG-DKRGITKIRGQWIEWE----GHLCMPIFHPSYLLRN 197

Query: 241 PLI-----KKNTWHALITLKKALKNL 261
           P       K   W  +  ++     +
Sbjct: 198 PSKEQGSPKWLMWQDIRAVRAKYDEI 223


>gi|134094968|ref|YP_001100043.1| putative DNA polymerase-related protein, bacteriophage-type
           [Herminiimonas arsenicoxydans]
 gi|133738871|emb|CAL61918.1| Putative phage SPO1 DNA polymerase-related protein, uracil-DNA
           glycosylase family [Herminiimonas arsenicoxydans]
          Length = 283

 Score =  173 bits (438), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 50/239 (20%), Positives = 90/239 (37%), Gaps = 12/239 (5%)

Query: 31  PNNEATYESQRKEK---SIDSAIQPITNIRHIHSPLVQQADSIAQKAC-SLHELKSLLRS 86
           P+ + T  +           +A  P+     + +  V  + S A        +LKS++ S
Sbjct: 44  PSMQTTAVAVTTSAWAERTPAAAVPLHAPVTLTASEVATSTSFADIVQMDWAQLKSVVAS 103

Query: 87  FHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIM 146
              C LC +   T+     +    + +G  P  +++  G+PF G  G +LD M  ++ + 
Sbjct: 104 CTQCGLCKSRTQTVFGVGDQKARWLFVGEGPGRNEDFQGEPFVGPAGKLLDNMFGAMGLK 163

Query: 147 R-TQIHISMISPWHPPGNRNLS----NIEMEICRPIIMRQIELISPKILLFIGNKTKNFF 201
           R    +I+ I    P             E+  C P + RQI LI P +++ +G       
Sbjct: 164 RGENTYIANIVKCRPIDAGKHDRPPAAEEVAACIPYLERQIALIKPTVIVALGKTAAISL 223

Query: 202 FNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
              D        GK       ++ +P + T HP  L++    K   W  L    +   +
Sbjct: 224 LKLDPATPV---GKLRGTVHRYADLPLIVTYHPAYLLRNLKDKSKAWADLCLAMQTYAD 279


>gi|210620993|ref|ZP_03292378.1| hypothetical protein CLOHIR_00321 [Clostridium hiranonis DSM 13275]
 gi|210154977|gb|EEA85983.1| hypothetical protein CLOHIR_00321 [Clostridium hiranonis DSM 13275]
          Length = 194

 Score =  173 bits (438), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 47/186 (25%), Positives = 84/186 (45%), Gaps = 5/186 (2%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           S   L+S  ++ + C L     + +         +++IG  P + +++SG PF G  G +
Sbjct: 6   SWEILESACKTCNRCRLAENRTNVVVGGGNRKAKILLIGEGPGEKEDLSGVPFVGPAGQL 65

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           LDKML  I++ R  ++I+ +    PPGNR+    E   C   +  Q  LI P+I++ +G 
Sbjct: 66  LDKMLACIDLSRNDVYIANVVKCRPPGNRDPEPDEKNCCIEYLRYQFALIKPQIIVCLGR 125

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
                  ++   +  +  G W            +AT HP  L++    K+  +  L  +K
Sbjct: 126 IAAQSIIDSK-FRITKEHGIWYKKKNCW----MIATYHPSALLRDAAKKRTAFEDLKEIK 180

Query: 256 KALKNL 261
           K +  L
Sbjct: 181 KKIDEL 186


>gi|152979854|ref|YP_001353212.1| DNA polymerase bacteriophage-type [Janthinobacterium sp. Marseille]
 gi|151279931|gb|ABR88341.1| DNA polymerase bacteriophage-type [Janthinobacterium sp. Marseille]
          Length = 286

 Score =  173 bits (438), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 48/236 (20%), Positives = 85/236 (36%), Gaps = 12/236 (5%)

Query: 31  PNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDC 90
           P  +     Q      D             S ++Q A  IA  +    +LK ++ +  +C
Sbjct: 53  PLRQQVVAEQSLSAWGDETPAAPVLAPAAVSAVLQPARDIA--SMGWEQLKEVVSNCTEC 110

Query: 91  HLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQ 149
            LC     T+     +    + +G  P  +++  G+PF G  G +LD M  ++ + R   
Sbjct: 111 GLCKGRTQTVFGVGDQKAKWLFVGEGPGRNEDFQGEPFVGPAGKLLDNMFIAMGLKRGEN 170

Query: 150 IHISMISPWHPPGNRN----LSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNND 205
            +I+ I    P             E + C P + RQI L++P +++ +G          D
Sbjct: 171 TYIANIVKCRPTDENKRDRAPVAQESDACMPYLQRQIALVNPTVIVALGKTAALSLLKLD 230

Query: 206 A-QKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
                 +  G           IP + T HP  L++    K   W  L    +   +
Sbjct: 231 PATPVARLRGTVHRYA----DIPVVVTYHPAYLLRTLKDKSKAWADLCLAMQTYAD 282


>gi|163783925|ref|ZP_02178897.1| predicted repair protein [Hydrogenivirga sp. 128-5-R1-1]
 gi|159880810|gb|EDP74342.1| predicted repair protein [Hydrogenivirga sp. 128-5-R1-1]
          Length = 214

 Score =  173 bits (438), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 42/182 (23%), Positives = 78/182 (42%), Gaps = 5/182 (2%)

Query: 72  QKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGK 131
            K   L EL   ++    C L       +         LM +G  P   ++  G+PF G+
Sbjct: 30  DKTKLLEELNKEIQECKKCDLYKNRKQAVLGEGNPNAKLMFVGEAPGADEDRLGRPFVGR 89

Query: 132 TGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILL 191
            G +L +++++    R + +I+ ++   PPGNR  +  E E C P + +QIE+I PK+L 
Sbjct: 90  AGQLLTRLIEATGHKREEFYIANVNKCRPPGNRTPTPWEQEACFPFLEKQIEIIDPKVLC 149

Query: 192 FIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
            +G      F         +  G+  N          + T+HP  +++ P  ++  +  +
Sbjct: 150 LLGAAAARAFLK-RPVSITKERGEVLNWE----GRKLILTLHPAYILRNPSAEELLFEDI 204

Query: 252 IT 253
             
Sbjct: 205 KK 206


>gi|186682234|ref|YP_001865430.1| phage SPO1 DNA polymerase-related protein [Nostoc punctiforme PCC
           73102]
 gi|186464686|gb|ACC80487.1| phage SPO1 DNA polymerase-related protein [Nostoc punctiforme PCC
           73102]
          Length = 227

 Score =  173 bits (438), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 47/205 (22%), Positives = 82/205 (40%), Gaps = 11/205 (5%)

Query: 62  PLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSD 121
           P   +         ++ EL       H C L  T    +         +M+IG  P  ++
Sbjct: 23  PTDAKIAIAPGTYSTITELAQHCDRCHRCPLGDTRTHAVVGRGNLKAPIMVIGEAPGQNE 82

Query: 122 NISGKPFSGKTGNMLDKMLQSIE-IMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMR 180
           + +G PF G++G +L+K+L S+       ++I+ I+   PP NR  +  E+  C P ++ 
Sbjct: 83  DETGLPFVGRSGQLLEKILASVNLTTEHDVYIANINKCRPPDNRVPTPTEVAACLPYLLE 142

Query: 181 QIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQY 240
           QI L+ PKI+L  G          D +   +  G+W            +   HP  L++ 
Sbjct: 143 QIRLVDPKIILLTGATAVKGITG-DKRGITKIRGQWLEWE----GRLCMPIFHPSYLLRN 197

Query: 241 PLI-----KKNTWHALITLKKALKN 260
           P       K   W  +  ++  L  
Sbjct: 198 PSKERGAPKWLMWQDIQAVRAKLDE 222


>gi|282895506|ref|ZP_06303643.1| Phage SPO1 DNA polymerase-related protein [Raphidiopsis brookii D9]
 gi|281199539|gb|EFA74402.1| Phage SPO1 DNA polymerase-related protein [Raphidiopsis brookii D9]
          Length = 225

 Score =  173 bits (438), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 48/192 (25%), Positives = 78/192 (40%), Gaps = 11/192 (5%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +++EL     + H C L  T    +         +MIIG  P   ++ +G PF GK+G +
Sbjct: 36  NINELTLHCENCHRCGLGKTRTHAVVGRGNPQAKIMIIGEAPGQHEDETGLPFVGKSGQL 95

Query: 136 LDKMLQSIE-IMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           LDK+L S+       ++I  I    PP NR  ++ E   CRP ++ QI L+ PKI+L  G
Sbjct: 96  LDKILASVNLTTEQDVYICNIVKCRPPENRVPTSEESNACRPYLLEQIRLVDPKIILLTG 155

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLI-----KKNTWH 249
                    N      +  G+W            +   HP  L++         K   W 
Sbjct: 156 ATAVKGVTGNKL-PITKIRGQWLEWE----GRLCMPIFHPSYLLRNSAKGQGSPKWLMWQ 210

Query: 250 ALITLKKALKNL 261
            +  ++     +
Sbjct: 211 DIQEIRNRYDQI 222


>gi|326204226|ref|ZP_08194086.1| phage SPO1 DNA polymerase-related protein [Clostridium
           papyrosolvens DSM 2782]
 gi|325985737|gb|EGD46573.1| phage SPO1 DNA polymerase-related protein [Clostridium
           papyrosolvens DSM 2782]
          Length = 190

 Score =  173 bits (438), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 44/186 (23%), Positives = 84/186 (45%), Gaps = 5/186 (2%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +  +L S   +  +C L  T  + +         +M IG  P + ++I G PF G  G +
Sbjct: 3   NWDQLNSTCSNCRNCDLAGTRTNIVIGRGNPSAPIMFIGEGPGEQEDIQGLPFVGPAGQL 62

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           L+ +L++++    + +I+ +    PP NR  +  E E C P +  Q+ LI P+I++ +G+
Sbjct: 63  LETLLEALKFKPDEYYIANVVKCRPPNNRVPNEEEAEKCLPYLRNQVSLIRPRIIVCLGS 122

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
               +    D  K  +  G+W            + T HP  L++    K+  +  +  +K
Sbjct: 123 TAAKYVVARD-IKITKIRGQWIE----RKKFWIMPTFHPAALLRDQSKKELLFKDIKEVK 177

Query: 256 KALKNL 261
           K +  L
Sbjct: 178 KKINQL 183


>gi|307596060|ref|YP_003902377.1| phage SPO1 DNA polymerase-related protein [Vulcanisaeta distributa
           DSM 14429]
 gi|307551261|gb|ADN51326.1| phage SPO1 DNA polymerase-related protein [Vulcanisaeta distributa
           DSM 14429]
          Length = 215

 Score =  173 bits (438), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 47/187 (25%), Positives = 82/187 (43%), Gaps = 6/187 (3%)

Query: 78  HELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLD 137
            EL +L+ +   C L  +    +         +MIIG  P + ++  G+PF G  G +L 
Sbjct: 14  DELVNLMLNCTKCKLHKSRRRVVPGEGPLNAKIMIIGEAPGEREDEEGRPFVGAAGQLLT 73

Query: 138 KMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT 197
           K+L ++ I R +++I+ +    PP NR+    E+E CRP ++ QI +I P+I++ +G  +
Sbjct: 74  KLLNNVGIRREEVYITNVVKCRPPNNRDPEPDEIEACRPYLITQILMIRPQIIICLGRHS 133

Query: 198 KNFFFNNDAQK------TYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
                                 GK  N+      +  L T HP   +  P ++      L
Sbjct: 134 AREILTMAGYPEKSVSNISSIRGKVFNVKLGDLNVKVLPTYHPAAALYNPRLRGVIEEDL 193

Query: 252 ITLKKAL 258
             +K  L
Sbjct: 194 RKVKTLL 200


>gi|307609081|emb|CBW98520.1| hypothetical protein LPW_03501 [Legionella pneumophila 130b]
          Length = 212

 Score =  173 bits (437), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 51/184 (27%), Positives = 84/184 (45%), Gaps = 5/184 (2%)

Query: 75  CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
             L  L   + S   C L  T   T+ +       LMIIG  P   ++  G+PF GK G 
Sbjct: 29  KHLAALADEVASCVRCSLHKTRTQTVFSRGNPKAKLMIIGEAPGFYEDQKGQPFVGKAGF 88

Query: 135 MLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           +L+KM++SIE+    ++I+ +    PP NR+ +  E+  C   + RQI+LI P ++L +G
Sbjct: 89  LLNKMIRSIEMTENDVYIANVLKCRPPNNRDPALEEISQCSSFLTRQIKLIKPHLILALG 148

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITL 254
                F  +           +  N    +   P + + HP  L++ P  KK  +   + +
Sbjct: 149 RFAGQFLLDKPLPLK-----QLRNHIHYYDNTPFIVSYHPAYLLRNPSDKKKAYIDWLAV 203

Query: 255 KKAL 258
           K  L
Sbjct: 204 KNFL 207


>gi|313903540|ref|ZP_07836930.1| phage SPO1 DNA polymerase-related protein [Thermaerobacter
           subterraneus DSM 13965]
 gi|313466093|gb|EFR61617.1| phage SPO1 DNA polymerase-related protein [Thermaerobacter
           subterraneus DSM 13965]
          Length = 307

 Score =  173 bits (437), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 44/187 (23%), Positives = 83/187 (44%), Gaps = 6/187 (3%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
            +  L+ +++    C L +     +         LM+IG  P   ++  G+PF G+ G +
Sbjct: 13  DMATLEQVVKGCTACGLRAGCRGVVFGDGNPSARLMLIGEGPGADEDRLGRPFVGRAGQL 72

Query: 136 LDKMLQSIEIMRTQI-HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           LD++L +    R +  +I+ I    PPGNR  +  E   C P +  Q+ L+ P I++ +G
Sbjct: 73  LDRILAACGFDRQRHVYIANIVKCRPPGNRTPTPEERAACLPNLRAQMWLVQPVIVVLLG 132

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITL 254
           +       +  A +  +  G+W         +  + T HP  L++ P +K+  WH    +
Sbjct: 133 STALQALVDP-AARISRARGQWIV----RDGVWYMPTYHPAALLRNPALKRECWHDFKKV 187

Query: 255 KKALKNL 261
               + L
Sbjct: 188 IDKYREL 194


>gi|304319860|ref|YP_003853503.1| hypothetical protein PB2503_01417 [Parvularcula bermudensis
           HTCC2503]
 gi|303298763|gb|ADM08362.1| hypothetical protein PB2503_01417 [Parvularcula bermudensis
           HTCC2503]
          Length = 299

 Score =  173 bits (437), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 65/268 (24%), Positives = 102/268 (38%), Gaps = 25/268 (9%)

Query: 7   LSQEQILTIALFYADSGVYWVFDE-------------PNNEATYESQRKEKSID----SA 49
           L +   L +  +Y  SGV                   P   A    +R+         + 
Sbjct: 22  LDRATALALLAWYRASGVDTAESAEPSDMRDWPTHGFPVPRALAGGERRPPLPPGNEVAP 81

Query: 50  IQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQD 109
                +        V  A ++A+   +L  L   +  F  C L + +  T+      G  
Sbjct: 82  TAKPPSSAGGSDEAVMAATALAEATTTLPALADAIAGFDGCPLKAAARRTVVYDGVIGAR 141

Query: 110 LMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIH------ISMISPWHPPGN 163
           L+IIG  P   ++  GKPF GK G +LD ML +I   RT+        I+    W PPGN
Sbjct: 142 LLIIGEGPGRDEDRIGKPFVGKAGGLLDLMLHAIGYSRTEADGRGDVLITNAVYWRPPGN 201

Query: 164 RNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLC-TP 222
           R  +  E  IC P + R I L +P++++ +GN +    +   A    +  G W     + 
Sbjct: 202 RAPTGEEQAICLPFLRRFITLAAPEVIILMGNVSTQALY-PGAPGITRTRGSWREWPLSD 260

Query: 223 HSIIPTLATVHPQELIQYPLIKKNTWHA 250
                 L   HP  L++ P  K+  W  
Sbjct: 261 GRQAAVLPMFHPAFLLRAPAQKRLAWAD 288


>gi|52840517|ref|YP_094316.1| bacteriophage related DNA polymerase [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|52627628|gb|AAU26369.1| bacteriophage related DNA polymerase [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
          Length = 212

 Score =  173 bits (437), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 52/184 (28%), Positives = 84/184 (45%), Gaps = 5/184 (2%)

Query: 75  CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
             L  L   + S   C L  T   T+ +       LMIIG  P   ++  G+PF GK G 
Sbjct: 29  KHLAALADEVASCVRCSLHKTRTQTVFSRGNPKAKLMIIGEAPGFYEDQKGQPFVGKAGL 88

Query: 135 MLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           +L+KM++SIE+    I+I+ +    PP NR+ +  E+  C   + RQI+LI P ++L +G
Sbjct: 89  LLNKMIRSIEMTENDIYIANVLKCRPPNNRDPALEEISQCSSFLTRQIQLIKPHLILALG 148

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITL 254
                F  +           +  N    +   P + + HP  L++ P  KK  +   + +
Sbjct: 149 RFAGQFLLDKPLPLK-----QLRNHIHYYDNTPFIVSYHPAYLLRNPSDKKKAYIDWLAV 203

Query: 255 KKAL 258
           K  L
Sbjct: 204 KNFL 207


>gi|319790238|ref|YP_004151871.1| phage SPO1 DNA polymerase-related protein [Thermovibrio
           ammonificans HB-1]
 gi|317114740|gb|ADU97230.1| phage SPO1 DNA polymerase-related protein [Thermovibrio
           ammonificans HB-1]
          Length = 235

 Score =  173 bits (437), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 51/196 (26%), Positives = 86/196 (43%), Gaps = 4/196 (2%)

Query: 68  DSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKP 127
           +        L ++K   +    C LC T  + +        +LM +G  P + +++ G+P
Sbjct: 40  ERAFDPIEELEKVKEEAQKCCKCRLCKTRHNVVFGEGDPQTNLMFVGEAPGEQEDLQGRP 99

Query: 128 FSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISP 187
           F G+ G +L K L    + R QI+I+ +    PP NR+ +  E+E C P + +QIELISP
Sbjct: 100 FVGRAGQLLSKFLNLYGVTRDQIYITNVLKCRPPNNRDPAPDEIEACYPFLEKQIELISP 159

Query: 188 KILLFIGNKTKNFFFN-NDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKN 246
           K++L +G        N  +     +  GK          +  + T HP  L++    +  
Sbjct: 160 KVILCLGAFAARTILNLPERTPISRIRGKEHKTTIGGVEVTVIPTFHPAYLLRNRRGEPE 219

Query: 247 TWHAL---ITLKKALK 259
               L   + L   LK
Sbjct: 220 FQKDLELALRLAGFLK 235


>gi|254424996|ref|ZP_05038714.1| uracil-DNA glycosylase, family 4 [Synechococcus sp. PCC 7335]
 gi|196192485|gb|EDX87449.1| uracil-DNA glycosylase, family 4 [Synechococcus sp. PCC 7335]
          Length = 233

 Score =  173 bits (437), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 51/224 (22%), Positives = 90/224 (40%), Gaps = 13/224 (5%)

Query: 47  DSAIQPITNIRHIHSPLVQQADSIAQKACS---LHELKSLLRSFHDCHLCSTSLSTICAT 103
            S I+            +  + S+     +   L  L    +S   C L  T  + + + 
Sbjct: 10  ASDIEATPTPTDFDPDKIPTSASVPIPPGTYDSLTPLAVHCKSCQRCELAQTRTNVVVSR 69

Query: 104 QTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIM-RTQIHISMISPWHPPG 162
                 +M+IG  P   ++  G PF G++G +L+K+L ++ +     ++I  I    PPG
Sbjct: 70  GNPNAPIMVIGEGPGQQEDEQGLPFVGRSGQLLEKILGAVRLDTEKDVYICNIVKCRPPG 129

Query: 163 NRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTP 222
           NRN    E+  CRP I+ QI L+ PKI+L  G         ++ +   +  G W      
Sbjct: 130 NRNPLASEINACRPYILEQIRLVDPKIILLTGATAVKGIIPSEKRGITKIRGTWIEWE-- 187

Query: 223 HSIIPTLATVHPQELIQYPLI-----KKNTWHALITLKKALKNL 261
                 +  +HP  L++ P       K   W  +  ++  L  +
Sbjct: 188 --GRQCMPILHPAYLLRNPSRDPGKPKWLMWQDIQAVRAKLDEI 229


>gi|327398392|ref|YP_004339261.1| phage SPO1 DNA polymerase-like protein [Hippea maritima DSM 10411]
 gi|327181021|gb|AEA33202.1| phage SPO1 DNA polymerase-related protein [Hippea maritima DSM
           10411]
          Length = 209

 Score =  173 bits (437), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 43/174 (24%), Positives = 70/174 (40%), Gaps = 5/174 (2%)

Query: 87  FHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIM 146
              C L  T  + +        DLM +G  P   +++ G+PF G+ G +L  +L+ I I 
Sbjct: 41  CKGCELHKTRTNVVFGEGNINADLMFVGEAPGRDEDVQGRPFVGRAGRLLRDILRDIGIK 100

Query: 147 RTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDA 206
              ++I+      PP NR+    E+  C   + +QI LI PKI+  +G  +     N   
Sbjct: 101 PQDVYIANCLKCRPPNNRDPLPEELVACFGYLKQQISLIKPKIIATLGRYSTYELTNQKG 160

Query: 207 QKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
                  GK          I  +   HP  L++ P         L  +K+ L+ 
Sbjct: 161 ALGT-LRGKVFVY----GNIKVIPLYHPAYLLRNPKAVDVFIEDLKKVKQLLEQ 209


>gi|317970146|ref|ZP_07971536.1| phage SPO1 DNA polymerase-related protein [Synechococcus sp.
           CB0205]
          Length = 199

 Score =  173 bits (437), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 54/199 (27%), Positives = 85/199 (42%), Gaps = 15/199 (7%)

Query: 73  KACSLH-ELKSLLRSFHDCHLCS---TSLSTICATQTEGQDLMIIGYTPSDSDNISGKPF 128
            A SL  +L SL  S   C LC    +    + +       LM+IG  P   ++  G+PF
Sbjct: 2   TATSLEQDLASLAESCDACRLCKLGSSRSQVVVSRGNPQARLMVIGEGPGAQEDEQGQPF 61

Query: 129 SGKTGNMLDKMLQSIEIM-RTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISP 187
            G++G +LD+ML+S+ I      ++  I    PP NR  + +EM  C+P + RQI L+ P
Sbjct: 62  VGRSGQLLDRMLESVGIDSNHDAYVCNIVKCRPPENRKPTALEMASCKPWLDRQIALVDP 121

Query: 188 KILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLI---- 243
            ++L  G                +  G+W            +   HP  L++ P      
Sbjct: 122 AVILLAGATAVEGLLGIKG-GMTKIRGQWRQWEGRW----LMPVFHPSYLLRNPSKERGA 176

Query: 244 -KKNTWHALITLKKALKNL 261
            K  TW  L  +++ L  L
Sbjct: 177 PKWLTWQDLQDVQRRLAQL 195


>gi|282856757|ref|ZP_06266018.1| uracil-DNA glycosylase family 4 protein [Pyramidobacter piscolens
           W5455]
 gi|282585380|gb|EFB90687.1| uracil-DNA glycosylase family 4 protein [Pyramidobacter piscolens
           W5455]
          Length = 205

 Score =  172 bits (436), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 40/187 (21%), Positives = 84/187 (44%), Gaps = 10/187 (5%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKM 139
           L+        C LC +  + +    +    +M +G  P + ++ SG+PF G  G +L ++
Sbjct: 22  LRDAANRCEQCGLCRSRKNVVVGEGSLTSRIMFVGEGPGEVEDNSGRPFVGPAGQLLTRI 81

Query: 140 LQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKN 199
           L++ +  R  ++I+ I    PP NR     E+  C+  +  QI L+ P+I++ +GN    
Sbjct: 82  LEAAKFSRDDVYITNIVKCRPPNNRVPEIEEVLSCQRWLEAQIALLQPQIIVCLGNTPLK 141

Query: 200 FFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKK-----NTWHALITL 254
           +F +   +   +  G+W            +   HP  L++    ++      TW  +  +
Sbjct: 142 WFLHGT-EGITKMRGRWFTW----RGAALMPMFHPSYLLRNQSRERGGPKDLTWRDIQEI 196

Query: 255 KKALKNL 261
           ++  ++L
Sbjct: 197 RQRYESL 203


>gi|317121114|ref|YP_004101117.1| phage SPO1 DNA polymerase-related protein [Thermaerobacter
           marianensis DSM 12885]
 gi|315591094|gb|ADU50390.1| phage SPO1 DNA polymerase-related protein [Thermaerobacter
           marianensis DSM 12885]
          Length = 333

 Score =  172 bits (436), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 43/198 (21%), Positives = 89/198 (44%), Gaps = 6/198 (3%)

Query: 65  QQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNIS 124
            + ++   +   +  L+ +++    C L +     +         LM+IG  P   ++  
Sbjct: 2   ARPEAELLRIADMAALEQVVKGCTACRLRAGCRGVVFGDGNPAARLMLIGEGPGADEDRL 61

Query: 125 GKPFSGKTGNMLDKMLQSIEIMRTQI-HISMISPWHPPGNRNLSNIEMEICRPIIMRQIE 183
           G+PF G+ G +LD++L +    R +  +I+ +    PPGNR  +  E   C P +  Q+ 
Sbjct: 62  GRPFVGRAGQLLDRILAACGFDRQRHVYIANVVKCRPPGNRTPTPDERAACLPNLRAQMR 121

Query: 184 LISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLI 243
           L++P I++ +G+       +  A +  +  G+W         +  + T HP  L++ P +
Sbjct: 122 LVNPVIVVLLGSTALQALIDP-AARITRWRGQW----IHRDGVWYMPTYHPAALLRNPSL 176

Query: 244 KKNTWHALITLKKALKNL 261
           K++ WH    +    + L
Sbjct: 177 KRDCWHDFKKVIDKYREL 194


>gi|209524410|ref|ZP_03272959.1| phage SPO1 DNA polymerase-related protein [Arthrospira maxima
           CS-328]
 gi|209495201|gb|EDZ95507.1| phage SPO1 DNA polymerase-related protein [Arthrospira maxima
           CS-328]
          Length = 234

 Score =  172 bits (436), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 45/206 (21%), Positives = 81/206 (39%), Gaps = 11/206 (5%)

Query: 62  PLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSD 121
           P             +L ++         C L       +         +MIIG  P   +
Sbjct: 31  PKNAHTPIPPGTYQTLAQIADHCNRCSRCQLGKNRTHAVIGRGNPTAPIMIIGEAPGQHE 90

Query: 122 NISGKPFSGKTGNMLDKMLQSIEIMRT-QIHISMISPWHPPGNRNLSNIEMEICRPIIMR 180
           +  G PF G++G +LDK+L S+ +    +++IS      PP NR  +  E++ C+P ++ 
Sbjct: 91  DEQGLPFVGRSGQLLDKILDSVGLSTDTEVYISNAIRCRPPENRTPTASELQACKPYLLE 150

Query: 181 QIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQY 240
           QI LI+P+I+L  G          D +   +  G+W            +   HP  L++ 
Sbjct: 151 QIRLINPQIILLTGATAVKSLLG-DKRPITKIRGQWFQWE----GRQCMPIFHPAYLLRN 205

Query: 241 PLI-----KKNTWHALITLKKALKNL 261
                   K   W  +  +++ L  +
Sbjct: 206 SSRDVGKPKWLMWQDMQAVRQRLNEI 231


>gi|222529822|ref|YP_002573704.1| phage SPO1 DNA polymerase-related protein [Caldicellulosiruptor
           bescii DSM 6725]
 gi|222456669|gb|ACM60931.1| phage SPO1 DNA polymerase-related protein [Caldicellulosiruptor
           bescii DSM 6725]
          Length = 185

 Score =  172 bits (436), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 52/187 (27%), Positives = 90/187 (48%), Gaps = 6/187 (3%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +  EL++   S   C +     + +     +   L+ +G  P + ++  GKPF G+ G  
Sbjct: 3   TWEELENACLSCEKCPISKNRTNVVVGDGNKNAKLVFVGEAPGEEEDKQGKPFVGRAGKF 62

Query: 136 LDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           LD  L S+E+ R    +I  I    PP NR  + +E + C P +  QI+LISPKI++ +G
Sbjct: 63  LDLALASLELSREKDFYICNILKCRPPNNRVPTELEAQNCLPFLRAQIKLISPKIIVCLG 122

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITL 254
                +    D  K  Q+ GKW            +AT HP  L++ P  +++ +  L ++
Sbjct: 123 ATAMKYILGKDL-KITQDRGKWFE----KGSFLIMATYHPAALLRDPGKREDFYRDLKSV 177

Query: 255 KKALKNL 261
           K+ L+ +
Sbjct: 178 KERLEKI 184


>gi|187251249|ref|YP_001875731.1| Uracil-DNA glycosylase [Elusimicrobium minutum Pei191]
 gi|186971409|gb|ACC98394.1| Uracil-DNA glycosylase [Elusimicrobium minutum Pei191]
          Length = 297

 Score =  172 bits (436), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 55/235 (23%), Positives = 93/235 (39%), Gaps = 16/235 (6%)

Query: 39  SQRKEKSIDSAIQPITNIRHIHSPLVQQADSI-AQKACSLHELKSLLRSFHDCHLCSTSL 97
           S     S  +  Q +     + +P   +   I + K   L+ L   + +   C L  T L
Sbjct: 55  SAESVLSAQNNAQTLKEDSSMPAPQTPKTKKINSNKEAELNALAEQILTCKKCPLGETRL 114

Query: 98  STICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISP 157
           + +         LM IG  P   ++  G+PF G+ G +L KM++++ + R ++ I+ +  
Sbjct: 115 NAVPGEGNADAKLMFIGEGPGFDEDHQGRPFIGRAGTLLTKMIEAMGLKREEVFIANMVK 174

Query: 158 WH----------PPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQ 207
            H             +R  S  E+  CR  I  QI LI P+ ++ +G          DA 
Sbjct: 175 CHPMTDPSNPEKHGNDRAPSKEEIAYCRKYIEAQIALIQPEFIVALGGVAAKSLIK-DAD 233

Query: 208 KTYQNLGKWSNLCTPH----SIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
                  K   L   +         +AT HP  L++ P  KK+ W  L  + K +
Sbjct: 234 SLGALRNKVHTLELDNFDLEGKTKIVATYHPAALLRNPNWKKDAWADLQMVMKEM 288


>gi|302342653|ref|YP_003807182.1| phage SPO1 DNA polymerase-related protein [Desulfarculus baarsii
           DSM 2075]
 gi|301639266|gb|ADK84588.1| phage SPO1 DNA polymerase-related protein [Desulfarculus baarsii
           DSM 2075]
          Length = 236

 Score =  172 bits (436), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 51/216 (23%), Positives = 81/216 (37%), Gaps = 5/216 (2%)

Query: 45  SIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQ 104
           S D   + +       SP+   A         L  +   +     C L       +    
Sbjct: 26  SADDLARLLALAGAAPSPVASVAAPPPDLPLELESMALAVGQCKRCPLAHGRNKAVFGQG 85

Query: 105 TEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNR 164
            +   LM IG  P   ++  G PF G  G +LD ML ++ + R  ++++ I    PP NR
Sbjct: 86  PDDARLMFIGEAPGAQEDQQGLPFVGPAGRLLDNMLAAVGLRREAVYVTNIVKCRPPNNR 145

Query: 165 NLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHS 224
           +    E+  CRP +  Q   + PK++  +G         +DA       G W        
Sbjct: 146 DPRPEEVAACRPWLEAQARAVGPKVICTLGRPAALAVLGSDA-PISALRGNWHEA----L 200

Query: 225 IIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
               L T HP  L++ P  K   +  +  L  ALK+
Sbjct: 201 GARVLPTFHPAYLLRSPQRKGQAYQDMKALALALKD 236


>gi|148358472|ref|YP_001249679.1| bacteriophage-like DNA polymerase [Legionella pneumophila str.
           Corby]
 gi|296105821|ref|YP_003617521.1| DNA polymerase bacteriophage-type [Legionella pneumophila 2300/99
           Alcoy]
 gi|148280245|gb|ABQ54333.1| bacteriophage related DNA polymerase [Legionella pneumophila str.
           Corby]
 gi|295647722|gb|ADG23569.1| DNA polymerase bacteriophage-type [Legionella pneumophila 2300/99
           Alcoy]
          Length = 212

 Score =  172 bits (436), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 51/184 (27%), Positives = 84/184 (45%), Gaps = 5/184 (2%)

Query: 75  CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
             L  L   + S   C L  T   T+ +       LMIIG  P   ++  G+PF GK G 
Sbjct: 29  KHLAALADEVASCVRCSLHKTRTQTVFSRGNPKAKLMIIGEAPGFYEDQKGQPFVGKAGF 88

Query: 135 MLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           +L+KM++SIE+    ++I+ +    PP NR+ +  E+  C   + RQI+LI P ++L +G
Sbjct: 89  LLNKMIRSIEMTENDVYIANVLKCRPPNNRDPALEEISQCSSFLTRQIKLIKPHLILALG 148

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITL 254
                F  +           +  N    +   P + + HP  L++ P  KK  +   + +
Sbjct: 149 RFAGQFLLDKPLPLK-----QLRNHIHYYDNTPFIVSYHPAYLLRNPSDKKKAYIDWLAV 203

Query: 255 KKAL 258
           K  L
Sbjct: 204 KNFL 207


>gi|302392090|ref|YP_003827910.1| phage SPO1 DNA polymerase-related protein [Acetohalobium arabaticum
           DSM 5501]
 gi|302204167|gb|ADL12845.1| phage SPO1 DNA polymerase-related protein [Acetohalobium arabaticum
           DSM 5501]
          Length = 214

 Score =  172 bits (436), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 57/185 (30%), Positives = 89/185 (48%), Gaps = 5/185 (2%)

Query: 72  QKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGK 131
           Q+  +L E+K +      C L    + T+  T      LM +G  P   ++  G+PF GK
Sbjct: 21  QRFNNLDEIKEVAVECERCELHKECIQTVFGTGNSDTGLMFVGEGPGRQEDEQGEPFVGK 80

Query: 132 TGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILL 191
            G + +K+L++ EI R  ++IS I    PPGNRN    EM+ C   + ++I+LI P I++
Sbjct: 81  AGQLFNKILKAAEIKRKDVYISNIVKCRPPGNRNPKFSEMKSCLWFLAQEIKLIQPMIIV 140

Query: 192 FIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
            +G+       + D  K  +  G W            L T HP  L++    KK TWH  
Sbjct: 141 PLGSIAVKGLLDPDG-KITELRGNWVERE----GYYLLPTFHPAALLRNEQWKKPTWHDF 195

Query: 252 ITLKK 256
           + +KK
Sbjct: 196 LKIKK 200


>gi|150020065|ref|YP_001305419.1| phage SPO1 DNA polymerase-related protein [Thermosipho
           melanesiensis BI429]
 gi|149792586|gb|ABR30034.1| phage SPO1 DNA polymerase-related protein [Thermosipho
           melanesiensis BI429]
          Length = 200

 Score =  172 bits (435), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 41/184 (22%), Positives = 76/184 (41%), Gaps = 9/184 (4%)

Query: 82  SLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQ 141
             ++    C L     + +         ++ +G  P + +++ G+PF G+ G +L K+L+
Sbjct: 12  ERIKECKACPLHENRTNVVPGEGNLDSPIVFVGEGPGEEEDLQGRPFVGRAGQLLTKILE 71

Query: 142 SIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFF 201
           S+ I R  ++I+ I    PP NR  +  E  IC   +  Q+E+I+PK+++ +G      F
Sbjct: 72  SVNIKREDVYITNIVKCRPPNNRTPTKEEASICSHFLFAQLEIINPKMIVTLGKPALELF 131

Query: 202 FNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLI-----KKNTWHALITLKK 256
                    +  G           I      HP  L++ P       K  TW  +  ++K
Sbjct: 132 LGRT-VAITKVRGNEFKWR---GGIIVFPMFHPSYLLRNPSKAKGSPKDLTWQDIKRVRK 187

Query: 257 ALKN 260
               
Sbjct: 188 YYDQ 191


>gi|170290590|ref|YP_001737406.1| Uracil-DNA glycosylase [Candidatus Korarchaeum cryptofilum OPF8]
 gi|170174670|gb|ACB07723.1| Uracil-DNA glycosylase [Candidatus Korarchaeum cryptofilum OPF8]
          Length = 193

 Score =  172 bits (435), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 46/185 (24%), Positives = 79/185 (42%), Gaps = 1/185 (0%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L +L   +     C L       +         +M +G  P  +++  G+PF G  G +L
Sbjct: 3   LEDLAEEILRCEKCPLHLNRKRAVPGEGNPNSRIMFVGEAPGRNEDEMGRPFVGAAGKLL 62

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
           +++L SI + R  + I+ +    PP NR+    E+E C P +  QIELI P+IL+ +G  
Sbjct: 63  EELLISIGLRRQDVFITNVVKCRPPNNRDPRPEEIEACLPYLKAQIELIDPEILVPLGRH 122

Query: 197 TKNFFFNNDAQ-KTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
           +         +    +  GK   +    +I   L T+HP   +  P +K         LK
Sbjct: 123 SVGVLLGRIGEISILRVRGKVYEVEVFGAIRKVLPTLHPAAALYNPRLKPLIREDFEKLK 182

Query: 256 KALKN 260
             + +
Sbjct: 183 SLISS 187


>gi|332157701|ref|YP_004422980.1| hypothetical protein PNA2_0058 [Pyrococcus sp. NA2]
 gi|331033164|gb|AEC50976.1| hypothetical protein PNA2_0058 [Pyrococcus sp. NA2]
          Length = 197

 Score =  172 bits (435), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 44/188 (23%), Positives = 87/188 (46%), Gaps = 3/188 (1%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           + +L+  +++   C L     + +    +    +M +G  P   ++  G PF GK G +L
Sbjct: 8   MKKLEERIKNCKKCPLWELRTNPVPGDGSYNAKVMFVGEAPGYWEDQMGLPFVGKAGKVL 67

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
           D++L+SI + R +++I+ I    PP NR+ +  E++ C P +  QI++I PK+++ +G  
Sbjct: 68  DELLKSIGLSRNEVYITNIVKCRPPNNRDPTEEEIKACSPYLDAQIDIIRPKVIVTLGRF 127

Query: 197 TKNFFF---NNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALIT 253
           +  +         +   +  GK     T    +  +   HP   +  P ++K        
Sbjct: 128 SMGYILRKYGFAVEPISKVHGKVFEARTLFGKLYIIPMYHPAVALYRPQLRKELEEDFKK 187

Query: 254 LKKALKNL 261
           LK  L +L
Sbjct: 188 LKALLASL 195


>gi|312127133|ref|YP_003992007.1| phage SPO1 DNA polymerase-like protein [Caldicellulosiruptor
           hydrothermalis 108]
 gi|311777152|gb|ADQ06638.1| phage SPO1 DNA polymerase-related protein [Caldicellulosiruptor
           hydrothermalis 108]
          Length = 188

 Score =  171 bits (434), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 52/187 (27%), Positives = 90/187 (48%), Gaps = 6/187 (3%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +  EL++   S   C +     + +     +   L+ +G  P + ++  GKPF G+ G  
Sbjct: 3   TWEELENACLSCEKCPISKNRTNVVVGDGNKNAKLVFVGEAPGEEEDKQGKPFVGRAGKF 62

Query: 136 LDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           LD  L S+E+ R    +I  I    PP NR  + +E + C P +  QI+LISPKI++ +G
Sbjct: 63  LDLALTSLELSREKDFYICNILKCRPPNNRVPTEVEAQNCLPFLRAQIKLISPKIIVCLG 122

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITL 254
                +    D  K  Q+ GKW            +AT HP  L++ P  +++ +  L ++
Sbjct: 123 ATAMKYILGKDL-KITQDRGKWFE----KGNFLIMATYHPAALLRDPGKREDFYRDLKSV 177

Query: 255 KKALKNL 261
           K+ L+ +
Sbjct: 178 KERLEKI 184


>gi|54296304|ref|YP_122673.1| hypothetical protein lpp0333 [Legionella pneumophila str. Paris]
 gi|53750089|emb|CAH11481.1| hypothetical protein lpp0333 [Legionella pneumophila str. Paris]
          Length = 200

 Score =  171 bits (434), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 51/184 (27%), Positives = 82/184 (44%), Gaps = 5/184 (2%)

Query: 75  CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
             L  L   + S   C L  T   T+ +       LMIIG  P   ++  G+PF GK G 
Sbjct: 17  KHLATLADEVASCVRCSLHKTRTQTVFSRGNPKAKLMIIGEAPGFYEDQKGQPFVGKAGF 76

Query: 135 MLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           +L+KM++SIE+    ++I+ +    PP NR+ +  E+  C   + RQI+LI P ++L +G
Sbjct: 77  LLNKMIRSIEMTENDVYIANVLKCRPPNNRDPALEEISQCSSFLTRQIKLIKPHLILALG 136

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITL 254
                F  +       Q               P + + HP  L++ P  KK  +   + +
Sbjct: 137 RFAGQFLLD-KPLPLKQLRNHIHYYNN----TPFIVSYHPAYLLRNPSDKKKAYIDWLAV 191

Query: 255 KKAL 258
           K  L
Sbjct: 192 KSFL 195


>gi|17230510|ref|NP_487058.1| hypothetical protein alr3018 [Nostoc sp. PCC 7120]
 gi|17132112|dbj|BAB74717.1| alr3018 [Nostoc sp. PCC 7120]
          Length = 227

 Score =  171 bits (434), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 47/206 (22%), Positives = 84/206 (40%), Gaps = 11/206 (5%)

Query: 62  PLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSD 121
           P   +         ++ EL         C L ST    +         +M++G  P  ++
Sbjct: 23  PKDAKIPIPPGTYTNMTELAQHCNQCQRCELGSTRTHAVVGRGNLKAPIMVVGEAPGQNE 82

Query: 122 NISGKPFSGKTGNMLDKMLQSIE-IMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMR 180
           + +G PF G++G +LDK+L S++      ++I+ I+   PP NR  +  EM  C P ++ 
Sbjct: 83  DETGLPFVGRSGQLLDKILASVDLTTEHDVYIANINKCRPPDNRVPTPNEMAACLPYLLE 142

Query: 181 QIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQY 240
           QI L++PKI+L  G          D +   +  G+W            +   HP  L++ 
Sbjct: 143 QIRLVNPKIILLTGATAVKGLTG-DKRGITKIRGQWIEWA----GHLCMPIFHPSYLLRN 197

Query: 241 PLI-----KKNTWHALITLKKALKNL 261
           P       K   W  +  ++     +
Sbjct: 198 PSKEQGSPKWLMWQDIRAVRTKYDEI 223


>gi|54293266|ref|YP_125681.1| hypothetical protein lpl0314 [Legionella pneumophila str. Lens]
 gi|53753098|emb|CAH14545.1| hypothetical protein lpl0314 [Legionella pneumophila str. Lens]
          Length = 200

 Score =  171 bits (434), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 51/184 (27%), Positives = 84/184 (45%), Gaps = 5/184 (2%)

Query: 75  CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
             L  L   + S   C L  T   T+ +       LMIIG  P   ++  G+PF GK G 
Sbjct: 17  KHLAALADEVASCVRCSLHKTRTQTVFSRGNPKAKLMIIGEAPGFYEDQKGQPFVGKAGF 76

Query: 135 MLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           +L+KM++SIE+    ++I+ +    PP NR+ +  E+  C   + RQI+LI P ++L +G
Sbjct: 77  LLNKMIRSIEMTENDVYIANVLKCRPPNNRDPALEEISQCSSFLTRQIKLIKPHLILALG 136

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITL 254
                F  +           +  N    +   P + + HP  L++ P  KK  +   + +
Sbjct: 137 RFAGQFLLDKPLPLK-----QLRNHIHYYDNTPFIVSYHPAYLLRNPSDKKKAYIDWLAV 191

Query: 255 KKAL 258
           K  L
Sbjct: 192 KNFL 195


>gi|325967890|ref|YP_004244082.1| uracil-DNA glycosylase [Vulcanisaeta moutnovskia 768-28]
 gi|323707093|gb|ADY00580.1| predicted Uracil-DNA glycosylase [Vulcanisaeta moutnovskia 768-28]
          Length = 214

 Score =  171 bits (434), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 47/192 (24%), Positives = 83/192 (43%), Gaps = 6/192 (3%)

Query: 75  CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
               EL  L+ S   C L +T    +         +MIIG  P + ++  G+PF G  G 
Sbjct: 11  ADYDELVQLMLSCTKCDLHTTRKRVVPGEGPLNARIMIIGEAPGEKEDEEGRPFVGAAGQ 70

Query: 135 MLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           +L K+L ++ I R +++I+ I    PPGNR+    E+E C+P ++ QI +I P++++ +G
Sbjct: 71  LLTKLLSNVGIRREEVYITNIVKCRPPGNRDPEPNEIEACKPYLITQIFMIKPQVIICLG 130

Query: 195 NKTKNFFFNNDAQK------TYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTW 248
             +                      GK  N+      +  L T HP   +  P ++    
Sbjct: 131 RHSAREILVMAGYPEKSVSNISSIRGKVFNVRLGDLNVKVLPTYHPAAALYNPKLRGVIE 190

Query: 249 HALITLKKALKN 260
             L  ++  +  
Sbjct: 191 DDLRKIRAIINK 202


>gi|312621954|ref|YP_004023567.1| phage SPO1 DNA polymerase-like protein [Caldicellulosiruptor
           kronotskyensis 2002]
 gi|312202421|gb|ADQ45748.1| phage SPO1 DNA polymerase-related protein [Caldicellulosiruptor
           kronotskyensis 2002]
          Length = 185

 Score =  171 bits (434), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 52/187 (27%), Positives = 89/187 (47%), Gaps = 6/187 (3%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +  EL+S       C +     + +     +   L+ +G  P + ++  GKPF G+ G  
Sbjct: 3   TWEELESACLLCEKCPISKNRTNVVVGDGNKNAKLVFVGEAPGEEEDKQGKPFVGRAGKF 62

Query: 136 LDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           LD  L S+E+ R    +I  I    PP NR  + +E + C P +  QI+LISPKI++ +G
Sbjct: 63  LDLALTSLELSREKDFYICNILKCRPPNNRVPTEVEAQNCLPFLRAQIKLISPKIIVCLG 122

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITL 254
                +    D  K  Q+ GKW            +AT HP  L++ P  +++ +  L ++
Sbjct: 123 ATAMKYILGKDL-KITQDRGKWFE----KGGFWIMATYHPAALLRDPGKREDFYRDLKSV 177

Query: 255 KKALKNL 261
           K+ L+ +
Sbjct: 178 KERLEKI 184


>gi|295111555|emb|CBL28305.1| uracil-DNA glycosylase, family 4 [Synergistetes bacterium SGP1]
          Length = 207

 Score =  171 bits (433), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 43/196 (21%), Positives = 80/196 (40%), Gaps = 10/196 (5%)

Query: 71  AQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSG 130
           A    +  +L+  + +   C LC    +T+         ++++G  P   ++  G  F G
Sbjct: 8   AAWEAAWEDLRGRVAACRRCGLCEARTNTVFGQGAVRTPIVMVGEGPGADEDAQGLAFVG 67

Query: 131 KTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKIL 190
           + G +L K+L +  I R  + I+ +    PP NR  +  EM  C   +  Q+ L+ P+IL
Sbjct: 68  RAGQLLTKILSAAGIDRESVFITNVVKCRPPNNRTPTQEEMLKCADFLEAQLLLLRPRIL 127

Query: 191 LFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLI-----KK 245
           + +GN    +     ++      G+W +       +      HP  L++         K 
Sbjct: 128 VCLGNTPLKWLL-RTSEGITALRGRWFDW----RGVQLFPMFHPSYLLRNDSRQKGSPKD 182

Query: 246 NTWHALITLKKALKNL 261
            TW  +  LK  L  +
Sbjct: 183 LTWQDVQNLKARLDEI 198


>gi|325294639|ref|YP_004281153.1| phage SPO1 DNA polymerase-related protein [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325065087|gb|ADY73094.1| phage SPO1 DNA polymerase-related protein [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 222

 Score =  171 bits (433), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 50/183 (27%), Positives = 84/183 (45%), Gaps = 6/183 (3%)

Query: 75  CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
             L +LK  + +   C LC T  + +        +LM IG  P + +++ G+PF G+ G 
Sbjct: 38  KELEKLKEEVLNCCKCRLCKTRTNVVFGEGDTTTNLMFIGEAPGEQEDLQGRPFVGRAGQ 97

Query: 135 MLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           +L + L    I R +I I+ +    PPGNRN +  E++ C P + +QIE+I PK++L +G
Sbjct: 98  LLTRFLNLYGISRDKIFITNVVKCRPPGNRNPAQDEIKSCYPFLEKQIEIIKPKVILCLG 157

Query: 195 NKTKNFFFN-NDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL-I 252
                   N  +     +  GK          I  + T HP  L++    +      L +
Sbjct: 158 AFAARTILNLPEKTPISRIRGK----EQKLGEIVVIPTFHPAYLLRNRKGEPEFQKDLEL 213

Query: 253 TLK 255
            L+
Sbjct: 214 ALR 216


>gi|220929817|ref|YP_002506726.1| phage SPO1 DNA polymerase-related protein [Clostridium
           cellulolyticum H10]
 gi|220000145|gb|ACL76746.1| phage SPO1 DNA polymerase-related protein [Clostridium
           cellulolyticum H10]
          Length = 190

 Score =  171 bits (433), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 46/186 (24%), Positives = 84/186 (45%), Gaps = 5/186 (2%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +  +L S   +  +C L  T  + +         +M IG  P + +++ G PF G  G +
Sbjct: 3   NWEQLNSTCNNCRNCDLAGTRTNIVIGRGNPNAPIMFIGEGPGEQEDLRGLPFVGPAGQL 62

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           LD +L++++    + +I+ +    PP NR  +  E E C P +  Q+ LI P+I++ +G+
Sbjct: 63  LDTLLEALKFKPDEYYIANVVKCRPPNNRVPNEEEAEKCLPYLRNQVALIRPRIIVCLGS 122

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
               +    DA K  Q  G W            + T HP  L++    K+  +  +  +K
Sbjct: 123 TAAKYIVARDA-KITQIRGHW----IQRKKFWIMPTFHPAALLRDQSKKELLFKDIKEVK 177

Query: 256 KALKNL 261
           K +  L
Sbjct: 178 KKINQL 183


>gi|145592499|ref|YP_001154501.1| phage SPO1 DNA polymerase-related protein [Pyrobaculum arsenaticum
           DSM 13514]
 gi|145284267|gb|ABP51849.1| phage SPO1 DNA polymerase-related protein [Pyrobaculum arsenaticum
           DSM 13514]
          Length = 192

 Score =  171 bits (432), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 42/179 (23%), Positives = 82/179 (45%), Gaps = 3/179 (1%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L EL  ++++   C L  T  + +         +MI+G  P  S++  G+PF G  G +
Sbjct: 2   TLEELHEVIKNCTRCPLHKTRRNAVPGEGDIKLGIMIVGEAPGASEDEVGRPFVGAAGQL 61

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           L K L  + I R  ++I+ +    PPGNR  +  E+E C P +++QI ++ PK ++ +G 
Sbjct: 62  LTKALAELGIQRGDVYITNVVKCRPPGNRPPAREEVEACLPYLLKQISILKPKRVVALGA 121

Query: 196 KTKNFFFNNDAQKTYQ---NLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
            +         ++  +     GK          +    T HP  +++ P + ++    +
Sbjct: 122 VSAKTLLGLVGKEVEKVGDVRGKCYPGKIAGVQLEICVTYHPAAILRNPRLGEDFRRDI 180


>gi|119383192|ref|YP_914248.1| phage SPO1 DNA polymerase-related protein [Paracoccus denitrificans
           PD1222]
 gi|119372959|gb|ABL68552.1| phage SPO1 DNA polymerase-related protein [Paracoccus denitrificans
           PD1222]
          Length = 271

 Score =  171 bits (432), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 70/276 (25%), Positives = 118/276 (42%), Gaps = 23/276 (8%)

Query: 1   MTSKRI-----LSQEQILTIALFYADSGVYW-VFDEPNNEATYE-----SQRKEKSIDSA 49
           MT+        L  E  L +  + A+ G      D P +          S     +   A
Sbjct: 1   MTADPTYRGFALDAETALALLQWQAELGADEPCLDAPLDRYAMPDRAEPSPAPATAAPQA 60

Query: 50  IQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQD 109
             P + +R     LV +A+++A  A +L EL +   +F    L   + +           
Sbjct: 61  ANPRSPVRDEAEDLVARAEAMATAATTLAELAAAQEAFDGIELKKGARNFCFCDGNPAAR 120

Query: 110 LMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQI------HISMISPWHPPGN 163
           +MIIG  P + ++  G+PF G+ G +LD+M  +I + R  +      +I+ +  W PPGN
Sbjct: 121 IMIIGEAPGEEEDRQGRPFVGRAGQLLDQMFGAIGLSREAVDAERALYITNVLTWRPPGN 180

Query: 164 RNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPH 223
           R     E+ +  P + R +EL  P++L+ +GN       N       +  GKW+      
Sbjct: 181 RRPEPAEIAMMLPFLTRHVELAQPQLLVLMGNTPCIAALNQQG--ILKLRGKWTTAF--- 235

Query: 224 SIIPTLATVHPQELIQYPLIKKNTWHALITLKKALK 259
             +P L   HP  L++ PL K+  W  L++L   L+
Sbjct: 236 -GLPALPMAHPAYLLRTPLAKREAWADLLSLSARLE 270


>gi|331270600|ref|YP_004397092.1| uracil-DNA glycosylase [Clostridium botulinum BKT015925]
 gi|329127150|gb|AEB77095.1| uracil-DNA glycosylase [Clostridium botulinum BKT015925]
          Length = 185

 Score =  171 bits (432), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 48/186 (25%), Positives = 79/186 (42%), Gaps = 6/186 (3%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
             +L    R+   C+L    ++ +         LM IG  P   ++ +G+PF G+ G +L
Sbjct: 4   WKDLYKECRACSKCNLGEVKINMVFGEGNPKAKLMFIGEAPGADEDRTGRPFVGRAGQLL 63

Query: 137 DKMLQSIEIMRT-QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
            K L ++ + R    +I+ I    P  NRN    E   C P +  Q+ LI PKI++ +G 
Sbjct: 64  TKGLLALNLHRDKDYYITNICKCRPENNRNPMEDEAYACIPYLRNQVGLIKPKIIVCLGA 123

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
               +  N    K  ++ GKW N       I  +   HP  +++    K   W  L  +K
Sbjct: 124 IAGKYIIN-SGLKITRDRGKWIN----KKGIYIMPIFHPAAILRDDSKKALFWRDLKEIK 178

Query: 256 KALKNL 261
           K    +
Sbjct: 179 KKFDEI 184


>gi|300865821|ref|ZP_07110571.1| phage SPO1 DNA polymerase-related protein [Oscillatoria sp. PCC
           6506]
 gi|300336187|emb|CBN55726.1| phage SPO1 DNA polymerase-related protein [Oscillatoria sp. PCC
           6506]
          Length = 229

 Score =  170 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 45/214 (21%), Positives = 86/214 (40%), Gaps = 11/214 (5%)

Query: 54  TNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMII 113
            +++    P   +         ++ ++       H C L     + +         +MII
Sbjct: 17  ASLQRDSIPNDAKIPIPPGTYETMEQIAEHCNRCHRCELGKNRQNAVIGRGNLQAPIMII 76

Query: 114 GYTPSDSDNISGKPFSGKTGNMLDKMLQSIE-IMRTQIHISMISPWHPPGNRNLSNIEME 172
           G  P  +++ +G PF G++G +LDK+L+S+       + I  ++   PP NR  +  E +
Sbjct: 77  GEAPGQNEDETGLPFVGRSGQLLDKILESVGLSTERDVFICNVNKCRPPDNRTPTPKERD 136

Query: 173 ICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATV 232
            C+P ++ QI +++P+I+L  G            Q   +  G+W            +A  
Sbjct: 137 ACKPYLLEQIRIVNPQIILLTGATALKGLTGEK-QAISKIRGQWIEWE----GRQCMAIF 191

Query: 233 HPQELIQYPLI-----KKNTWHALITLKKALKNL 261
           HP  L++ P       K   W  +  +K     L
Sbjct: 192 HPSYLLRNPSREPGSPKWLMWQDIQIVKAKFDEL 225


>gi|189219157|ref|YP_001939798.1| Uracil-DNA glycosylase [Methylacidiphilum infernorum V4]
 gi|189186015|gb|ACD83200.1| Uracil-DNA glycosylase [Methylacidiphilum infernorum V4]
          Length = 276

 Score =  170 bits (431), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 49/193 (25%), Positives = 86/193 (44%), Gaps = 13/193 (6%)

Query: 75  CSLHELKSLLRSFHDCH-LCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTG 133
             L  LK  + +  +C  L S    T+  T     +LM +G  P   +++ G+PF G  G
Sbjct: 74  KELSLLKEKVEACRNCPHLVSFRTQTVFGTGNPYAELMFVGEAPGAEEDLQGEPFVGPAG 133

Query: 134 NMLDKMLQSIEIMRTQIHISMISPWHPP------GNRNLSNIEMEICRPIIMRQIELISP 187
            +L KM++++ + R Q++I+ +    P       GNR  +  EM  C P ++ Q++LI+P
Sbjct: 134 QLLTKMIRAMGLSREQVYIANVLKCRPDIPKGQKGNRKPTTEEMSTCLPYLLSQLKLINP 193

Query: 188 KILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPL--IKK 245
           K+++ +G             K  +  G+  +          + T HP  L+  P    K+
Sbjct: 194 KVIVALGATAYEGLTGKVGIKISEVRGRCFSFN----GATLIPTYHPSFLLHNPSLTNKR 249

Query: 246 NTWHALITLKKAL 258
             W  L+T    L
Sbjct: 250 KVWEDLLTAMGKL 262


>gi|14591260|ref|NP_143337.1| hypothetical protein PH1472 [Pyrococcus horikoshii OT3]
 gi|3257896|dbj|BAA30579.1| 197aa long hypothetical protein [Pyrococcus horikoshii OT3]
          Length = 197

 Score =  170 bits (431), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 44/195 (22%), Positives = 89/195 (45%), Gaps = 3/195 (1%)

Query: 69  SIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPF 128
           S+  K   + +L+  +R    C L     + +    +    +M +G  P   ++  G PF
Sbjct: 3   SVPSKEELMKKLEEKIRKCKKCPLWEVRTNPVPGDGSYDTKIMFVGEAPGYWEDQMGLPF 62

Query: 129 SGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPK 188
            GK G +LD++L+ I + R++++I+ I    PP NR+ +  E++ C P +  QI++I PK
Sbjct: 63  VGKAGKVLDELLKLIGLKRSEVYITNIVKCRPPNNRDPTEEEIKACAPYLDAQIDIIKPK 122

Query: 189 ILLFIGNKTKNFFF---NNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKK 245
           +++ +G  +  +       + +   +  G+     T    I  +   HP   +  P +++
Sbjct: 123 VIVTLGRFSTAYIMKKYGFNVEPISKIHGRVFEARTLFGKIYIVPMYHPAVALYRPQLRR 182

Query: 246 NTWHALITLKKALKN 260
                   LK  L +
Sbjct: 183 ELEEDFKKLKSLLSS 197


>gi|157363942|ref|YP_001470709.1| phage SPO1 DNA polymerase-related protein [Thermotoga lettingae
           TMO]
 gi|157314546|gb|ABV33645.1| phage SPO1 DNA polymerase-related protein [Thermotoga lettingae
           TMO]
          Length = 194

 Score =  170 bits (431), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 43/185 (23%), Positives = 79/185 (42%), Gaps = 9/185 (4%)

Query: 81  KSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKML 140
            S +     C L +T  + +         +M +G  P + ++ +G+PF G+ G +L K+L
Sbjct: 11  ASRIEKCTSCPLFNTRTNVVVGEGNLYAPIMFVGEGPGEEEDKTGRPFVGRAGQLLTKIL 70

Query: 141 QSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNF 200
           +S+ I R  ++I  I    PP NR     E + C   +M QI ++ P I++ +G+   +F
Sbjct: 71  ESVNIDREDVYICNIVKCRPPENRVPKAEEQKACGHYLMAQIMIVDPAIIVPLGSTALSF 130

Query: 201 FFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLI-----KKNTWHALITLK 255
           F   +     +  GK  +              HP  L++ P       K  TW  +  ++
Sbjct: 131 FLGQN-VSITEFRGKELDWKAGK---KLFPMFHPSYLLRNPSKAKGSPKDLTWQDIKKVR 186

Query: 256 KALKN 260
           +    
Sbjct: 187 EFFDQ 191


>gi|255527794|ref|ZP_05394645.1| phage SPO1 DNA polymerase-related protein [Clostridium
           carboxidivorans P7]
 gi|255508507|gb|EET84896.1| phage SPO1 DNA polymerase-related protein [Clostridium
           carboxidivorans P7]
          Length = 190

 Score =  170 bits (431), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 45/186 (24%), Positives = 77/186 (41%), Gaps = 6/186 (3%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
             EL       + C L +   + +         ++ +G  P   ++  G PF G+ G +L
Sbjct: 4   WRELYEECLQCNKCDLGNKRTNMVFGDGNSRGKIVFVGEAPGADEDRIGLPFVGRAGQLL 63

Query: 137 DKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
            K L +++++R    +I  +    P  NR     E E C P +  Q+ LI PKI++ +G 
Sbjct: 64  TKGLTALDLIRENDYYICNVCKCRPDNNRVPYENEAEACLPYLRNQVALIKPKIIVCLGA 123

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
               +   ND  +  ++ GKW            +AT HP  L +    K   W  L ++K
Sbjct: 124 TAMKYILGND-FRITRDRGKWIE----RKGCYIIATFHPAALFRDENKKVLFWEDLKSVK 178

Query: 256 KALKNL 261
           K    +
Sbjct: 179 KKYDEI 184


>gi|160931927|ref|ZP_02079320.1| hypothetical protein CLOLEP_00759 [Clostridium leptum DSM 753]
 gi|156869264|gb|EDO62636.1| hypothetical protein CLOLEP_00759 [Clostridium leptum DSM 753]
          Length = 193

 Score =  170 bits (430), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 49/188 (26%), Positives = 89/188 (47%), Gaps = 6/188 (3%)

Query: 75  CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
            + + L+      H C LC    + +     E  ++M IG  P +++++ G+PF G+ G 
Sbjct: 3   ETWNSLQEACLQCHKCGLCEGRHNVVFGIGVETAEVMFIGEGPGENEDLQGEPFVGRGGQ 62

Query: 135 MLDKMLQSIEIMRTQI-HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFI 193
           +LDKML ++++ R +  +I+ I    PP NR+    E E C   +  Q  LI PKI++ +
Sbjct: 63  LLDKMLAAVDLSREKNIYIANIVKCRPPQNRDPLPEEQEACIDWLRNQTALIRPKIIVCL 122

Query: 194 GNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALIT 253
           G          D + T     K   +    + +  +AT+HP  L++ P  K   +   + 
Sbjct: 123 GRIAAAKIIKPDIKIT-----KEHGVFFEKNGVVMMATLHPAALLRNPSQKPGAFDDFLK 177

Query: 254 LKKALKNL 261
           L++ +  L
Sbjct: 178 LREKIHEL 185


>gi|254252036|ref|ZP_04945354.1| hypothetical protein BDAG_01247 [Burkholderia dolosa AUO158]
 gi|124894645|gb|EAY68525.1| hypothetical protein BDAG_01247 [Burkholderia dolosa AUO158]
          Length = 348

 Score =  170 bits (430), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 55/250 (22%), Positives = 91/250 (36%), Gaps = 23/250 (9%)

Query: 29  DEPNNEATYESQRKEKSIDSAIQPITNIRHIHSP-----------------LVQQADSIA 71
           D P   A   +      +       T                            ++    
Sbjct: 92  DAPRVAANDPADSDRAPVLRDPPASTPQTPPTPDDDFAWFDAAPPSAAVPAAAPRSAETP 151

Query: 72  QKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGK 131
             A     L + +     C LC    +T+        D M+IG  P ++++  G+PF G+
Sbjct: 152 VAALDWDALAARVADCTRCRLCEKRTNTVFGVGDRDADWMLIGEAPGENEDKQGEPFVGQ 211

Query: 132 TGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKIL 190
            G +LD MLQS+ + R   + I+ +    PPGNRN    E+  C P + RQ+ L+ PK++
Sbjct: 212 AGKLLDNMLQSLSLRRGDNVFIANVIKCRPPGNRNPEPDEVARCEPYLQRQVALVKPKLI 271

Query: 191 LFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHA 250
           + +G          DA       G+          +P + T HP  L++    K   W  
Sbjct: 272 VALGRFAAQTLLKTDASIAS-LRGRVHAYE----GVPVIVTYHPAYLLRSLPDKAKAWAD 326

Query: 251 LITLKKALKN 260
           L   +   +N
Sbjct: 327 LCLARDTFRN 336


>gi|312143585|ref|YP_003995031.1| phage SPO1 DNA polymerase-related protein [Halanaerobium sp.
           'sapolanicus']
 gi|311904236|gb|ADQ14677.1| phage SPO1 DNA polymerase-related protein [Halanaerobium sp.
           'sapolanicus']
          Length = 210

 Score =  170 bits (430), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 54/184 (29%), Positives = 90/184 (48%), Gaps = 5/184 (2%)

Query: 78  HELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLD 137
            +LK        C L     + +         +M+IG  P  +++   +PF G+ G ++D
Sbjct: 23  QKLKEKALKCTRCQLREGCSNVVMGEGNLDNKIMLIGEGPGATEDRMARPFVGRAGKLMD 82

Query: 138 KMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT 197
           K+LQS+ + R +I+I+ +    PP NR     E++ C  I+  +IELI PK+++ +G+  
Sbjct: 83  KILQSVNLKRDEIYITNVVKCRPPDNRVPYKKEVKACSAILKAEIELIEPKVVVTLGSTA 142

Query: 198 KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKA 257
            NF  N +     +  GKW         I  LAT HP  L++   +KK +WH    +KKA
Sbjct: 143 TNFLLNPE-DSITKMRGKW----LKRGDIYFLATFHPAYLLRNENMKKYSWHDFKLIKKA 197

Query: 258 LKNL 261
              +
Sbjct: 198 ADRI 201


>gi|189485553|ref|YP_001956494.1| uracil-DNA glycosylase [uncultured Termite group 1 bacterium
           phylotype Rs-D17]
 gi|170287512|dbj|BAG14033.1| uracil-DNA glycosylase [uncultured Termite group 1 bacterium
           phylotype Rs-D17]
          Length = 253

 Score =  170 bits (430), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 49/202 (24%), Positives = 86/202 (42%), Gaps = 15/202 (7%)

Query: 68  DSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKP 127
             I+     L EL+  +     C L    L+ +    +   DL+ +G  P   ++  GKP
Sbjct: 53  AEISSSGEELGELREKVSFCKKCPLGEKRLNAVFGCGSPDADLVFVGEGPGYDEDHIGKP 112

Query: 128 FSGKTGNMLDKMLQSIEIMRTQIHISMISPWH----------PPGNRNLSNIEMEICRPI 177
           F G+ G +L K+++++   R  ++I+ I   H             +R  +  EMEICRP 
Sbjct: 113 FVGRAGQLLTKIIEAMGQARESVYIANIVKCHAMIDPSNPEKRSNDRPPTLEEMEICRPY 172

Query: 178 IMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQEL 237
           +  Q+E+I PKI++ +G  +     N   +   +  G           I  + T HP  L
Sbjct: 173 LDMQLEIIKPKIIVTLGASSTKGLLN-SIESISRIRGSVREY----KGIKLIPTFHPAAL 227

Query: 238 IQYPLIKKNTWHALITLKKALK 259
           ++   +KK  W  +  +   L 
Sbjct: 228 LRNQDLKKFVWEDMKKVMHYLD 249


>gi|220931987|ref|YP_002508895.1| Uracil-DNA glycosylase [Halothermothrix orenii H 168]
 gi|219993297|gb|ACL69900.1| Uracil-DNA glycosylase [Halothermothrix orenii H 168]
          Length = 210

 Score =  170 bits (430), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 50/185 (27%), Positives = 81/185 (43%), Gaps = 8/185 (4%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKM 139
           LK        C L       +       + +M +G  P   ++  GKPF GK G +L K+
Sbjct: 25  LKEKALKCDRCQLRQGCTQVVMGYGPIDRKIMFVGEGPGADEDRLGKPFVGKAGKLLTKI 84

Query: 140 LQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKN 199
           L S+ + R  ++I+ I    PP NR  +  E E C PI+  +I+LI P +++ +G+    
Sbjct: 85  LNSVGLEREDVYITNIVKCRPPNNRQPTRSEAEACSPILKAEIKLIDPLVIVPLGSVALK 144

Query: 200 FFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK--- 256
              +  A    +  GKW  +           T HP  L++ P +KK  W     ++K   
Sbjct: 145 NLVDEKASIM-RTRGKWKKI----GKYYFFPTFHPAFLLRNPKMKKLVWRDFKVIRKAVD 199

Query: 257 ALKNL 261
            +K L
Sbjct: 200 RIKEL 204


>gi|253680837|ref|ZP_04861640.1| uracil-DNA glycosylase [Clostridium botulinum D str. 1873]
 gi|253562686|gb|EES92132.1| uracil-DNA glycosylase [Clostridium botulinum D str. 1873]
          Length = 185

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 44/186 (23%), Positives = 80/186 (43%), Gaps = 6/186 (3%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
             +L    +    C+L +  ++ +         LM IG  P   ++ +G+PF G+ G +L
Sbjct: 4   WKDLYKKCKDCSKCNLSNGKINMVFGEGNPKAKLMFIGEAPGADEDKTGRPFVGRAGQLL 63

Query: 137 DKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
            K L ++ + R    +I+ I    P  NRN    E   C P +  Q+ LI PKI++ +G 
Sbjct: 64  TKGLLALNLHREQDYYITNICKCRPENNRNPMEHEACACIPYLRNQVALIKPKIIICLGA 123

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
               +  N++  +  ++ GKW         I  +   HP  +++    K   W  L  +K
Sbjct: 124 IAGKYIINSNL-RITRDRGKWIE----KKGIYIMPIFHPAAILRDNSKKSLFWRDLKEIK 178

Query: 256 KALKNL 261
           +    +
Sbjct: 179 RKFDEI 184


>gi|14520900|ref|NP_126375.1| hypothetical protein PAB0474 [Pyrococcus abyssi GE5]
 gi|5458117|emb|CAB49606.1| Thermostable uracil-DNA glycosylase [Pyrococcus abyssi GE5]
          Length = 196

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 44/195 (22%), Positives = 89/195 (45%), Gaps = 3/195 (1%)

Query: 70  IAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFS 129
           +A K   + +L+  +R+   C L     + +    +    +M +G  P   ++  G PF 
Sbjct: 1   MASKEELMKKLEEKIRNCKKCPLWQLRTNPVPGDGSYDAKVMFVGEAPGYWEDQQGLPFV 60

Query: 130 GKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKI 189
           GK G +LD++L+ I + R +++I+ I    PP NR+ +  E++ C P +  QI++I P+I
Sbjct: 61  GKAGKVLDELLKGIGLNRREVYITNIVKCRPPNNRDPTEEEIKACAPYLDAQIDIIRPRI 120

Query: 190 LLFIGNKTKNFFF---NNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKN 246
           ++ +G  +  +         +   +  GK     T    +  +   HP   +  P ++K 
Sbjct: 121 IVTLGRFSMGYILRKYGFQVEPISKIHGKVFEARTLFGKVYIVPMYHPAVALYRPQLRKE 180

Query: 247 TWHALITLKKALKNL 261
                  LK  ++ +
Sbjct: 181 LEEDFRKLKDLIEKV 195


>gi|114798144|ref|YP_760609.1| uracil-DNA glycosylase [Hyphomonas neptunium ATCC 15444]
 gi|114738318|gb|ABI76443.1| uracil-DNA glycosylase, family 4 [Hyphomonas neptunium ATCC 15444]
          Length = 246

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 62/223 (27%), Positives = 108/223 (48%), Gaps = 4/223 (1%)

Query: 41  RKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTI 100
            + ++++ A       R + +  V++A++IA    +L EL +    F    L ++  +T+
Sbjct: 25  EQAQALEPAPLRKRGARTV-ADWVREAETIAAGCANLDELTAAAGQFSGSPLRASCENTV 83

Query: 101 CATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIH-ISMISPWH 159
               T G  L++IG  P   ++  GKPF GK G +LDKML +I   R +   I+ ++ W 
Sbjct: 84  VYDGTPGASLLVIGEGPGAQEDRQGKPFVGKAGQLLDKMLAAIGRNRAENALITNVNYWR 143

Query: 160 PPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNL 219
           PPGNR+    E+ +CRP + R IE+  P++++  G         +      +  G     
Sbjct: 144 PPGNRSPEADELAVCRPFVDRFIEVSRPRLIVAAGGIPAVSLLGSREGIM-KLRGNEYCY 202

Query: 220 CTPHS-IIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
            TP    +P +  +HP  L++ P  K   W  L+ ++K L  L
Sbjct: 203 TTPGGYRVPLIPMLHPAYLLRRPQDKSRAWRDLLLIEKRLGEL 245


>gi|87302163|ref|ZP_01084988.1| hypothetical protein WH5701_08179 [Synechococcus sp. WH 5701]
 gi|87283088|gb|EAQ75044.1| hypothetical protein WH5701_08179 [Synechococcus sp. WH 5701]
          Length = 218

 Score =  169 bits (429), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 50/206 (24%), Positives = 81/206 (39%), Gaps = 11/206 (5%)

Query: 62  PLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSD 121
                  + A +  +L +L         C L       + +       LM+IG  P   +
Sbjct: 4   DPGTAGQATALREGALQQLAGGCAECRRCSLADGRQQVVVSRGDPHAALMVIGEGPGAQE 63

Query: 122 NISGKPFSGKTGNMLDKMLQSIEIM-RTQIHISMISPWHPPGNRNLSNIEMEICRPIIMR 180
           + SG PF G+ G +LD+ML S+ I      +I  +    PP NR  +  EM  C P +++
Sbjct: 64  DASGSPFVGRAGQLLDRMLASVGIDSNRDAYICNVVKCRPPENRKPTPQEMAACLPWLLQ 123

Query: 181 QIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQY 240
           Q+EL+ P+++L  G                +  G+W            L   HP  L++ 
Sbjct: 124 QVELVQPQVVLLAGATAVEGVLGIKG-GITRLRGQWRTWQGRW----CLPIFHPSYLLRN 178

Query: 241 PLI-----KKNTWHALITLKKALKNL 261
           P       K +TW  L  ++  L  L
Sbjct: 179 PSREPETPKWHTWQDLKAVRSRLDQL 204


>gi|78066821|ref|YP_369590.1| Phage SPO1 DNA polymerase-related protein [Burkholderia sp. 383]
 gi|77967566|gb|ABB08946.1| Phage SPO1 DNA polymerase-related protein [Burkholderia sp. 383]
          Length = 336

 Score =  169 bits (429), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 53/233 (22%), Positives = 93/233 (39%), Gaps = 20/233 (8%)

Query: 25  YWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLL 84
                 P++ A +++            P+   R + +P+                    +
Sbjct: 107 DMPPAGPDDFAWFDAAPP-----GDPVPVAESRPVGTPVAALDWDALAA---------RV 152

Query: 85  RSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIE 144
                C LC    +T+        D M+IG  P ++++  G+PF G+ G +LD MLQS+ 
Sbjct: 153 SDCTLCRLCEKRTNTVFGVGDREADWMLIGEAPGENEDKQGEPFVGQAGKLLDNMLQSLS 212

Query: 145 IMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFN 203
           + R   ++I+ +    PPGNRN    E+  C P + RQ+ L+ PK+++ +G         
Sbjct: 213 LKRGDNVYIANVIKCRPPGNRNPEPDEVASCEPYLQRQVALVKPKLIVALGRFAAQTLLK 272

Query: 204 NDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
            DA       G+          +P + T HP  L++    K   W  L   + 
Sbjct: 273 TDASIAS-LRGRVHAYE----GVPVIVTYHPAYLLRSLQDKSKAWADLCLARD 320


>gi|254293439|ref|YP_003059462.1| phage SPO1 DNA polymerase-related protein [Hirschia baltica ATCC
           49814]
 gi|254041970|gb|ACT58765.1| phage SPO1 DNA polymerase-related protein [Hirschia baltica ATCC
           49814]
          Length = 268

 Score =  169 bits (429), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 72/264 (27%), Positives = 116/264 (43%), Gaps = 13/264 (4%)

Query: 8   SQEQIL--TIALFYADSGVYWVFDEPNNEA-----TYESQRKEKSIDSAIQPITNIRHIH 60
           S E++   ++  ++ D+GV    D+P +       T  ++       +        R + 
Sbjct: 4   SPEELALKSLHEWWIDAGV--PPDQPISLKKKTAPTAATKTPAPISKAEKSAPAQPRRLR 61

Query: 61  SPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDS 120
           +  +  A  +A  A ++ +LK  +  F  C L +T+ ST+        D+MII   P   
Sbjct: 62  TDQILAAQKLADHALTIEDLKKSVNDFTGCDLRTTARSTVLCDGNINADMMIICGAPDRE 121

Query: 121 DNISGKPFSGKTGNMLDKMLQSIEIMRTQI-HISMISPWHPPGNRNLSNIEMEICRPIIM 179
           ++ SG+P +G  G +LDKM  +I   R    +I+ + PWH  G RN  + E  ICRP + 
Sbjct: 122 EDKSGRPAAGANGQLLDKMFAAINFTRQDNLYIASLMPWHMLGERNPDDQEWAICRPFLQ 181

Query: 180 RQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTP--HSIIPTLATVHPQEL 237
           RQIEL+SPKI++ IG  +     N       +  G+            IP      P  L
Sbjct: 182 RQIELVSPKIIVTIGKMSSQILLN-KTDNIAKLRGQEFQYKQESLSQEIPCFPLFAPSYL 240

Query: 238 IQYPLIKKNTWHALITLKKALKNL 261
              P  K  TW  L  ++K  + L
Sbjct: 241 RVRPAEKAKTWKDLQLIRKRAEQL 264


>gi|298492683|ref|YP_003722860.1| phage SPO1 DNA polymerase-like protein ['Nostoc azollae' 0708]
 gi|298234601|gb|ADI65737.1| phage SPO1 DNA polymerase-related protein ['Nostoc azollae' 0708]
          Length = 226

 Score =  169 bits (429), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 49/206 (23%), Positives = 82/206 (39%), Gaps = 11/206 (5%)

Query: 62  PLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSD 121
           P   +    +    ++ EL     +   C L       +         +MIIG  P  S+
Sbjct: 22  PTDAKIPIPSGTYANMPELAQHCNNCRRCGLGDNRTHAVVGRGNLQAKIMIIGEAPGQSE 81

Query: 122 NISGKPFSGKTGNMLDKMLQSIE-IMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMR 180
           + +G PF GK+G +L+K+L S+       ++I  I+   PP NR  +  EM  C+P ++ 
Sbjct: 82  DETGLPFVGKSGQLLEKILASVNLSTEEDVYIGNINKCRPPENRVPTAEEMAACKPYLLE 141

Query: 181 QIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQY 240
           QI L+ PKI+L  G         +  Q   +  G+W            +   HP  L++ 
Sbjct: 142 QIRLVDPKIILLTGATAVKGITGSK-QGITKIRGQWLESE----GRLCMPIFHPSYLLRN 196

Query: 241 PLI-----KKNTWHALITLKKALKNL 261
           P       K   W  +  +K     +
Sbjct: 197 PSREKGSPKWLMWQDIQAVKAKYDEI 222


>gi|167646129|ref|YP_001683792.1| phage SPO1 DNA polymerase-like protein [Caulobacter sp. K31]
 gi|167348559|gb|ABZ71294.1| phage SPO1 DNA polymerase-related protein [Caulobacter sp. K31]
          Length = 272

 Score =  169 bits (429), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 63/264 (23%), Positives = 113/264 (42%), Gaps = 13/264 (4%)

Query: 7   LSQEQILTIALFYADSGVYWVF-DEPNNEATYESQRKEKSIDSAIQPITNIRHIH----- 60
           +    + ++  F+AD+GV   + D+P +     +       + A   +  +         
Sbjct: 5   VDPRAVESLLAFWADAGVEASYADDPIDRLAQGAAMLRARKEPAPVAVAPVVTPVLGRGP 64

Query: 61  --SPLVQQADSIAQKACSLHELKSLLRSFHDCHLC-STSLSTICATQTEGQDLMIIGYTP 117
                + +A ++A     L  L + + +F  C L    +   + +       LMIIG  P
Sbjct: 65  DLGAAIAEAKALAAACADLPALAAAIAAFDGCPLKTQGARQAVVSRGPADAPLMIIGEAP 124

Query: 118 SDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPI 177
              +++ G PF G+ G +LD+ML++  +   +  ++    W PPGNR  +  E  +C P 
Sbjct: 125 GADEDLQGAPFVGRAGQLLDRMLKAAGL-LDRAFVTNTVFWRPPGNRTPTPQEQAVCAPF 183

Query: 178 IMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHS--IIPTLATVHPQ 235
           + R I L+ PKILL +G  +       D        G+W    +      +P L T+HP 
Sbjct: 184 LERAIALVQPKILLLVGGASAKSLLRRDEGILS-LRGRWFEWTSSDGQNELPALPTLHPA 242

Query: 236 ELIQYPLIKKNTWHALITLKKALK 259
            L++ P  KK  W  ++ L + L 
Sbjct: 243 FLLRQPAAKKKAWTDMLMLSERLD 266


>gi|296535656|ref|ZP_06897832.1| uracil-DNA glycosylase [Roseomonas cervicalis ATCC 49957]
 gi|296264007|gb|EFH10456.1| uracil-DNA glycosylase [Roseomonas cervicalis ATCC 49957]
          Length = 287

 Score =  169 bits (428), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 60/241 (24%), Positives = 106/241 (43%), Gaps = 15/241 (6%)

Query: 25  YWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLL 84
                 P             ++  A  P  +I    + L   A  +A     + +++S  
Sbjct: 46  DVAPGAPMLPDAAAVIAACDALYIAAPPAAHIPLARAALAAAAPDLAALRAVIEQIES-- 103

Query: 85  RSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIE 144
                  L  T+ + + A  +    LM+IG  P   ++  GKPF G +G +LD+ML SI 
Sbjct: 104 ------PLRDTATNLVFADGSPESGLMLIGEAPGGDEDRQGKPFVGVSGQLLDRMLASIG 157

Query: 145 IMR------TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTK 198
           + R         +I+ I PW PPGNR  ++ E+ +  P+++R I L+ P+ ++ +G    
Sbjct: 158 LDRGQAAPGQGFYITNILPWRPPGNRTPTDAEIALFLPVVLRHIALVRPRHVVLLGGTAA 217

Query: 199 NFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
                   +   +  G+W +L      +P L T+HP  L++ P  K+  W  L+ L++ L
Sbjct: 218 KALLRAK-EGITRLRGRWHDLPQEAGGLPALPTLHPAYLLRNPAAKREAWADLLMLRRTL 276

Query: 259 K 259
            
Sbjct: 277 D 277


>gi|227826496|ref|YP_002828275.1| phage SPO1 DNA polymerase-related protein [Sulfolobus islandicus
           M.14.25]
 gi|229583658|ref|YP_002842159.1| phage SPO1 DNA polymerase-related protein [Sulfolobus islandicus
           M.16.27]
 gi|227458291|gb|ACP36977.1| phage SPO1 DNA polymerase-related protein [Sulfolobus islandicus
           M.14.25]
 gi|228018707|gb|ACP54114.1| phage SPO1 DNA polymerase-related protein [Sulfolobus islandicus
           M.16.27]
          Length = 216

 Score =  169 bits (428), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 48/190 (25%), Positives = 86/190 (45%), Gaps = 4/190 (2%)

Query: 75  CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
            +L  +   +R    C L     + +        ++M IG  P ++++I GKPF G  G 
Sbjct: 2   DTLDLIAEEVRKCQKCRLWKYRKNAVPGEGNNKAEIMFIGEAPGENEDIEGKPFVGAAGK 61

Query: 135 MLDKML-QSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFI 193
           +L +++ + + + R  + I+ +    PP NR+    E+  C P + RQIELI P+I++ +
Sbjct: 62  LLTRLINEVLGLSRDDVFITNLVKCRPPNNRDPEEDEIIACSPYLHRQIELIRPRIIITL 121

Query: 194 GNKTKNFFFNNDAQKT---YQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHA 250
           G  + ++ F     K     +  GK+         I    T HP   +  P I+K     
Sbjct: 122 GRHSTSYLFQIMNIKMESIGKVRGKFYTWNEYGYKILVFPTYHPAAALYNPPIRKILEED 181

Query: 251 LITLKKALKN 260
              +K+AL +
Sbjct: 182 FRKVKEALSS 191


>gi|227829105|ref|YP_002830884.1| phage SPO1 DNA polymerase-related protein [Sulfolobus islandicus
           L.S.2.15]
 gi|229577905|ref|YP_002836303.1| phage SPO1 DNA polymerase-related protein [Sulfolobus islandicus
           Y.G.57.14]
 gi|229580806|ref|YP_002839205.1| phage SPO1 DNA polymerase-related protein [Sulfolobus islandicus
           Y.N.15.51]
 gi|238618564|ref|YP_002913389.1| phage SPO1 DNA polymerase-related protein [Sulfolobus islandicus
           M.16.4]
 gi|284996491|ref|YP_003418258.1| phage SPO1 DNA polymerase-related protein [Sulfolobus islandicus
           L.D.8.5]
 gi|227455552|gb|ACP34239.1| phage SPO1 DNA polymerase-related protein [Sulfolobus islandicus
           L.S.2.15]
 gi|228008619|gb|ACP44381.1| phage SPO1 DNA polymerase-related protein [Sulfolobus islandicus
           Y.G.57.14]
 gi|228011522|gb|ACP47283.1| phage SPO1 DNA polymerase-related protein [Sulfolobus islandicus
           Y.N.15.51]
 gi|238379633|gb|ACR40721.1| phage SPO1 DNA polymerase-related protein [Sulfolobus islandicus
           M.16.4]
 gi|284444386|gb|ADB85888.1| phage SPO1 DNA polymerase-related protein [Sulfolobus islandicus
           L.D.8.5]
 gi|323473573|gb|ADX84179.1| phage SPO1 DNA polymerase-related protein [Sulfolobus islandicus
           REY15A]
 gi|323476220|gb|ADX81458.1| phage SPO1 DNA polymerase-related protein [Sulfolobus islandicus
           HVE10/4]
          Length = 216

 Score =  169 bits (428), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 48/190 (25%), Positives = 86/190 (45%), Gaps = 4/190 (2%)

Query: 75  CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
            +L  +   +R    C L     + +        ++M IG  P ++++I GKPF G  G 
Sbjct: 2   DTLDLIAEEVRKCQKCRLWKYRKNAVPGEGNNKAEIMFIGEAPGENEDIEGKPFVGAAGK 61

Query: 135 MLDKML-QSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFI 193
           +L +++ + + + R  + I+ +    PP NR+    E+  C P + RQIELI P+I++ +
Sbjct: 62  LLTRLINEVLGLSRDDVFITNLVKCRPPNNRDPEEDEIIACSPYLHRQIELIRPRIIITL 121

Query: 194 GNKTKNFFFNNDAQKT---YQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHA 250
           G  + ++ F     K     +  GK+         I    T HP   +  P I+K     
Sbjct: 122 GRHSTSYLFQIMNIKMESIGKVRGKFYTWNEYGYKILVFPTYHPAAALYNPPIRKILEED 181

Query: 251 LITLKKALKN 260
              +K+AL +
Sbjct: 182 FRKVKEALSS 191


>gi|254495599|ref|ZP_05108521.1| bacteriophage related DNA polymerase [Legionella drancourtii
           LLAP12]
 gi|254355169|gb|EET13782.1| bacteriophage related DNA polymerase [Legionella drancourtii
           LLAP12]
          Length = 198

 Score =  169 bits (427), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 54/184 (29%), Positives = 83/184 (45%), Gaps = 5/184 (2%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L  L   + +   C L  T   T+    +    LMIIG  P   ++  G PF GK G +L
Sbjct: 16  LSALAKEVAACTRCPLHQTRKQTVFFRGSPQAKLMIIGEAPGFYEDQQGLPFVGKAGGLL 75

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
           ++MLQS+E+     +I+ +    PP NR+    E+  C   + RQIEL+ P ++L +G  
Sbjct: 76  NQMLQSVELFEQDFYIANVLKCRPPNNRDPQAAEIRQCSAYLSRQIELLQPSLILALGRF 135

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
              F  N       Q               P + + HP  L++ P  KK T+  L+ +KK
Sbjct: 136 AGQFLLN-KPLALKQLRNNVHYY----KNTPFIVSYHPAYLLRKPADKKKTYLDLLAVKK 190

Query: 257 ALKN 260
            L+ 
Sbjct: 191 FLQQ 194


>gi|74317741|ref|YP_315481.1| putative phage DNA polymerase [Thiobacillus denitrificans ATCC
           25259]
 gi|74057236|gb|AAZ97676.1| putative phage DNA polymerase [Thiobacillus denitrificans ATCC
           25259]
          Length = 213

 Score =  169 bits (427), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 53/205 (25%), Positives = 86/205 (41%), Gaps = 6/205 (2%)

Query: 58  HIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTP 117
                L   A       C   +L   +     C L +T    +        D +++G  P
Sbjct: 14  APAWRLRDTASEARAPVCGWEQLSDAVAHCTRCRLAATRTQGVLGVGDREADWLVVGEAP 73

Query: 118 SDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRP 176
              ++  G+PF GK G +LD ML SI I R   ++I+ +    PPGNR+    E+  C P
Sbjct: 74  GADEDRLGEPFVGKAGKLLDAMLASIGIARGDNVYITNVLKSRPPGNRDPEADEVAACMP 133

Query: 177 IIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQE 236
            ++ QI+L+ PK++L +G          DA       G+  +       IP + T HP  
Sbjct: 134 YLLAQIDLVKPKLILALGRFAAQSLLATDAALGS-LRGRVHSFQN----IPLVVTYHPAY 188

Query: 237 LIQYPLIKKNTWHALITLKKALKNL 261
           L++    K   W  L   ++ ++ L
Sbjct: 189 LLRNLPDKARAWEDLCLARRTIQRL 213


>gi|315426239|dbj|BAJ47882.1| DNA polymerase bacteriophage-type [Candidatus Caldiarchaeum
           subterraneum]
 gi|315427880|dbj|BAJ49472.1| DNA polymerase bacteriophage-type [Candidatus Caldiarchaeum
           subterraneum]
          Length = 196

 Score =  169 bits (427), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 40/186 (21%), Positives = 80/186 (43%), Gaps = 7/186 (3%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L  +   +R+   C L     + +        +LM IG  P + +++ G+PF G++G +L
Sbjct: 5   LDAIAEEVRACRLCPLWRGRRNAVPGEGNPRAELMFIGEGPGEEEDLQGRPFVGRSGRLL 64

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRP-IIMRQIELISPKILLFIGN 195
            + L+   I R  + I+ +    PP NR  +  E + C    + RQIE ++P++++ +G+
Sbjct: 65  TEALEKAGIRREDVFITNVVKCRPPENREPTPEERQTCTNKYLFRQIETVNPRLIVLLGS 124

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
                     +       GK               T HP   +  P  ++N +  +   +
Sbjct: 125 VAVQTLLGISSV--TAVRGKAFE----KMGRRFFCTYHPAAALYNPGNRENFFSDIKKAR 178

Query: 256 KALKNL 261
           + L++L
Sbjct: 179 ELLESL 184


>gi|146297378|ref|YP_001181149.1| phage SPO1 DNA polymerase-related protein [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|145410954|gb|ABP67958.1| phage SPO1 DNA polymerase-related protein [Caldicellulosiruptor
           saccharolyticus DSM 8903]
          Length = 187

 Score =  169 bits (427), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 50/187 (26%), Positives = 88/187 (47%), Gaps = 6/187 (3%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +  EL+    S   C +     + +     +   LM IG  P + ++  GKPF G+ G +
Sbjct: 3   TWEELERSCLSCTKCPISKDRTNVVIGDGNKNAKLMFIGEAPGEEEDKQGKPFVGRAGKL 62

Query: 136 LDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           LD  L ++E+ R    +I  I    PP NR  +  E + C P +  Q++L+ PKI++ +G
Sbjct: 63  LDLALDALELSRENDFYICNILKCRPPNNRVPTEYEAQNCLPYLRAQVKLVQPKIIVCLG 122

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITL 254
                +    +  K  Q+ GKW            +AT HP  L++ P  +++ +  L ++
Sbjct: 123 ATAMKYILGRNL-KITQDRGKWF----QKGEFHIMATYHPAALLRDPSKREDFYRDLKSV 177

Query: 255 KKALKNL 261
           K+ LK +
Sbjct: 178 KEKLKEM 184


>gi|332709104|ref|ZP_08429072.1| uracil-DNA glycosylase, family 4 [Lyngbya majuscula 3L]
 gi|332352110|gb|EGJ31682.1| uracil-DNA glycosylase, family 4 [Lyngbya majuscula 3L]
          Length = 231

 Score =  168 bits (426), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 52/219 (23%), Positives = 90/219 (41%), Gaps = 10/219 (4%)

Query: 49  AIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQ 108
                 N++    P   +    A    ++  L    +S   C L +T    +        
Sbjct: 16  TPSKPNNVQRDLIPTDAKIPIPAGTYDTMESLTEHCQSCQRCELGATRTKAVIGRGNPKA 75

Query: 109 DLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIM-RTQIHISMISPWHPPGNRNLS 167
            +MIIG  P   ++ +G PF G+ G +L+K+L S++I     ++I  +    PPGNR  +
Sbjct: 76  LIMIIGEGPGKQEDETGMPFVGRAGKLLEKILASVKIDTEQDVYICNMVKCRPPGNRTPT 135

Query: 168 NIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIP 227
             E+E C+P ++ QI L+ P+I+LF G         N  Q   +  G W           
Sbjct: 136 PNEIEACKPYLLEQIRLVEPQIILFTGATAVKGLTGNK-QGITKIRGTWMEWEGHK---W 191

Query: 228 TLATVHPQELIQYP-----LIKKNTWHALITLKKALKNL 261
            +  +HP  L++ P       K   W  +  ++  L  +
Sbjct: 192 CMPILHPAYLLRNPKRDPGSPKWMMWQDIQKVRAKLDEI 230


>gi|312880146|ref|ZP_07739946.1| phage SPO1 DNA polymerase-related protein [Aminomonas paucivorans
           DSM 12260]
 gi|310783437|gb|EFQ23835.1| phage SPO1 DNA polymerase-related protein [Aminomonas paucivorans
           DSM 12260]
          Length = 228

 Score =  168 bits (426), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 46/190 (24%), Positives = 80/190 (42%), Gaps = 10/190 (5%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L E +  +     C L  T   ++         L+ +G  P   ++  G PF G+ G +L
Sbjct: 30  LEEARHRVERCLRCPLGKTRNKSVFGEGNLWGKLLFVGEGPGADEDEQGMPFVGRAGQLL 89

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
            ++LQ+  I R  ++I+ +    PPGNR  +  EM  C   +  QI L  P +L+ +GN 
Sbjct: 90  TQILQAAGIRREDVYITNVVKCRPPGNRVPTFEEMMACDEYLQTQIALGRPSLLVLLGNT 149

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLI-----KKNTWHAL 251
              +      +   +  G+W +       +  L   HP  L++YP       K  TW  +
Sbjct: 150 PTKWILK-TTEGISKLRGRWFSW----KGMSVLPMFHPSYLLRYPSSTEGSPKHLTWLDI 204

Query: 252 ITLKKALKNL 261
             +K+    +
Sbjct: 205 QEVKRKWDEV 214


>gi|187777334|ref|ZP_02993807.1| hypothetical protein CLOSPO_00886 [Clostridium sporogenes ATCC
           15579]
 gi|187774262|gb|EDU38064.1| hypothetical protein CLOSPO_00886 [Clostridium sporogenes ATCC
           15579]
          Length = 193

 Score =  168 bits (426), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 45/186 (24%), Positives = 76/186 (40%), Gaps = 6/186 (3%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
             +L +   + + C L     + +         ++ IG  P   ++ +GKPF GK G +L
Sbjct: 7   WSQLYNECINCNKCPLVKDRTNMVFGEGYINAPIIFIGEAPGADEDRTGKPFVGKAGQLL 66

Query: 137 DKMLQSIEIMRT-QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
            K L ++E  R    +I  +    P  NR     E   C P +  Q+ L+ PKI++ +G 
Sbjct: 67  TKALLALEFKRDEHYYICNVCKCRPENNRTPKEEEARECLPFLRNQVALVKPKIIVCLGA 126

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
               +    +  +  ++ GKW            +AT HP  L +    KK  W  L ++K
Sbjct: 127 TPLKYIIG-EQFRITRDRGKWIE----RKGYHIMATFHPAALFRDESKKKLFWQDLKSIK 181

Query: 256 KALKNL 261
                L
Sbjct: 182 VKYDEL 187


>gi|308751050|gb|ADO44533.1| phage SPO1 DNA polymerase-related protein [Hydrogenobacter
           thermophilus TK-6]
          Length = 219

 Score =  168 bits (425), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 48/191 (25%), Positives = 80/191 (41%), Gaps = 2/191 (1%)

Query: 68  DSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKP 127
            S   K   LHEL   L     C L   S   +         ++ +G  P + ++   KP
Sbjct: 27  KSKPDKRRMLHELYETLSKEKKCILYEGSSGYVFGDGNPDSAVVFVGEAPGEEEDKQKKP 86

Query: 128 FSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISP 187
           F GK G  L+  LQ + + R  ++I+ +    PPGNR  +  EM  C P + ++IE+I P
Sbjct: 87  FVGKAGKYLNAKLQEVGMRREDVYITNVVKSRPPGNRKPTKEEMLSCLPYLRKEIEIIKP 146

Query: 188 KILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNT 247
           K+++ +G+          A    +  G+          I  L T HP  +++ P   +  
Sbjct: 147 KLIVCLGSTALEGLLG-KALPITKYRGQVFEYPYS-RNIKVLLTYHPAYVLRNPSADREF 204

Query: 248 WHALITLKKAL 258
              +  +K  L
Sbjct: 205 MEDMKKVKALL 215


>gi|158337182|ref|YP_001518357.1| DNA polymerase bacteriophage-type [Acaryochloris marina MBIC11017]
 gi|158307423|gb|ABW29040.1| DNA polymerase bacteriophage-type, putative [Acaryochloris marina
           MBIC11017]
          Length = 232

 Score =  168 bits (425), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 52/221 (23%), Positives = 94/221 (42%), Gaps = 14/221 (6%)

Query: 47  DSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTE 106
           ++  + +T+     SP V           +L EL +  +    C L  +    + +    
Sbjct: 16  ETVSEAVTHEEISASPQVPIPKGFY---QNLQELTTHCQQCQRCDLAPSRTHVVVSRGNP 72

Query: 107 GQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIM-RTQIHISMISPWHPPGNRN 165
              ++IIG  P   ++ +G PF G+ G +LDK+L S+++  +  ++I  I    PPGNR 
Sbjct: 73  EAPILIIGEGPGQHEDETGLPFVGRAGQLLDKILASVKLDSQNDVYICNIVKCRPPGNRT 132

Query: 166 LSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSI 225
            +  E   C+P ++ QI L++PKI+L  G          D +   +  G+W         
Sbjct: 133 PTPDESAACKPYLLEQIRLVNPKIILLTGATAVRGLTG-DKRGITKIRGQWLAWQN---- 187

Query: 226 IPTLATVHPQELIQYPL-----IKKNTWHALITLKKALKNL 261
              +  +HP  L++ P       K   W  +  ++  L  L
Sbjct: 188 YLCMPILHPAYLLRNPSPEPGKPKWLMWQDIQAVRAKLDEL 228


>gi|318041681|ref|ZP_07973637.1| hypothetical protein SCB01_08212 [Synechococcus sp. CB0101]
          Length = 214

 Score =  168 bits (425), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 51/207 (24%), Positives = 86/207 (41%), Gaps = 8/207 (3%)

Query: 62  PLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSD 121
           P      S A+    L ++ +       C L  +    + +       LM+IG  P   +
Sbjct: 5   PPQASRLSAAELEQELDQVAAACDGCRRCGLGHSRTQVVVSRGNPRAPLMVIGEGPGAQE 64

Query: 122 NISGKPFSGKTGNMLDKMLQSIEIM-RTQIHISMISPWHPPGNRNLSNIEMEICRPIIMR 180
           +  GKPF G++G +LD+ML+S+ I      ++  I    PP NR  + +EM  CRP + +
Sbjct: 65  DEQGKPFVGRSGQLLDRMLESVGIDSNRDAYVCNIVKCRPPENRKPTGLEMAACRPWLDQ 124

Query: 181 QIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPH-SIIPTLATVHPQELIQ 239
           QI+L+ P ++L  G                +  G+W             +  +HP  L++
Sbjct: 125 QIQLVDPPVILLAGATAVEGLLGIKG-GITKLRGQWRKGEGGSLEGRWLMPILHPSYLLR 183

Query: 240 YPLI-----KKNTWHALITLKKALKNL 261
                    K  TWH L  +++ L  L
Sbjct: 184 NASKERGSPKWLTWHDLQDVQRRLAQL 210


>gi|319943628|ref|ZP_08017909.1| arginine biosynthesis ArgJ [Lautropia mirabilis ATCC 51599]
 gi|319742861|gb|EFV95267.1| arginine biosynthesis ArgJ [Lautropia mirabilis ATCC 51599]
          Length = 409

 Score =  168 bits (425), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 45/213 (21%), Positives = 79/213 (37%), Gaps = 4/213 (1%)

Query: 50  IQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQ- 108
            +P+                +   A     L+  +     C L  T  +T+       Q 
Sbjct: 191 PEPMLPAEPEPESAPLSHPDL-PPAQRWIRLREDVDGCRRCRLAETRTNTVFGRGRPQQA 249

Query: 109 DLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRT-QIHISMISPWHPPGNRNLS 167
             M+IG  P   ++  G+ F G+ G +LD ML +  I  +  + I+ +    PP NRN  
Sbjct: 250 RWMLIGEGPGAEEDKQGEAFVGQAGKLLDAMLDAAGIDPSADVFIANVLKCRPPNNRNPE 309

Query: 168 NIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIP 227
             E+  C   +  QI L+ P  +L +G         +   +  +   K  ++      +P
Sbjct: 310 PDEVAACEGYLYEQIRLVQPDCILLLGRFAAQSVL-HSELQIGRLRNKLHHITLDGRQVP 368

Query: 228 TLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
            + T HP  L++    K   W  L     A++ 
Sbjct: 369 VVVTYHPAYLLRNQRDKLKGWEDLCLALSAMEA 401


>gi|315426164|dbj|BAJ47808.1| DNA polymerase bacteriophage-type [Candidatus Caldiarchaeum
           subterraneum]
          Length = 200

 Score =  168 bits (425), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 39/186 (20%), Positives = 79/186 (42%), Gaps = 7/186 (3%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L  +   +R+   C L     + +        +LM IG  P + +++ G+PF G++G +L
Sbjct: 9   LDAIAEEVRACRLCPLWRGRRNAVPGEGNPRAELMFIGEGPGEEEDLQGRPFVGRSGRLL 68

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRP-IIMRQIELISPKILLFIGN 195
            + L+   I R  + I+ +    PP NR  +  E + C    + RQIE ++P++++ +G+
Sbjct: 69  TEALEKAGIRREDVFITNVVKCRPPENREPTPEERQTCTNKYLFRQIEAVNPRLIVLLGS 128

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
                     +       GK               T HP   +  P  ++  +  +   +
Sbjct: 129 VAVQTLLGISSV--TAVRGKAFE----KMGRRFFCTYHPAAALYNPGNRETFFSDIKKAR 182

Query: 256 KALKNL 261
           + L++L
Sbjct: 183 ELLESL 188


>gi|119356182|ref|YP_910826.1| phage SPO1 DNA polymerase-related protein [Chlorobium
           phaeobacteroides DSM 266]
 gi|119353531|gb|ABL64402.1| phage SPO1 DNA polymerase-related protein [Chlorobium
           phaeobacteroides DSM 266]
          Length = 223

 Score =  168 bits (424), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 50/205 (24%), Positives = 89/205 (43%), Gaps = 5/205 (2%)

Query: 57  RHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYT 116
                 L             L  L   ++S   C L ++  + +         L++IG  
Sbjct: 7   SDHDDTLPSVQSEAGAPFRDLIGLSLAVKSCTKCRLSASRKNVVFGEGDPRAALVVIGEA 66

Query: 117 PSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRP 176
           P   ++  G+PF G++G +LDK+LQ+++  R ++ I  I    PP NRN    E+E C P
Sbjct: 67  PGADEDSQGRPFVGRSGQLLDKILQAVQFKREEVFICNILKCRPPQNRNPLADEIECCMP 126

Query: 177 IIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQE 236
            ++ Q+EL++PK++L +G    N     ++       G+             + T HP  
Sbjct: 127 WLLLQLELLNPKLILLLGKVAANTILQ-NSLSMGAMRGRI----VKWKAYDCMVTYHPAA 181

Query: 237 LIQYPLIKKNTWHALITLKKALKNL 261
           L++ P  KK  W  +  +++    L
Sbjct: 182 LLRNPGWKKACWEDVQMMRQHYDKL 206


>gi|154499968|ref|ZP_02038006.1| hypothetical protein BACCAP_03625 [Bacteroides capillosus ATCC
           29799]
 gi|150271566|gb|EDM98823.1| hypothetical protein BACCAP_03625 [Bacteroides capillosus ATCC
           29799]
          Length = 188

 Score =  168 bits (424), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 48/187 (25%), Positives = 90/187 (48%), Gaps = 5/187 (2%)

Query: 75  CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
            +   L++       C L  T  + +  T     ++M IG  P + +++ G+PF G+ G 
Sbjct: 2   KNWEALQAECMDCRKCALAETRHNVVFGTGNPNAEVMFIGEGPGEQEDLKGEPFVGRAGK 61

Query: 135 MLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           +LD ML+ I++ R++I+I+ +    PP NR+  N+E E C   +  Q+ +I PKI++ +G
Sbjct: 62  LLDDMLEIIDLDRSKIYITNMVKCRPPQNRDPLNVEQEACIGYLRNQVAIIRPKIIVCLG 121

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITL 254
                     D  K  +  G+W       + +   A  HP  L++ P  +   +  L +L
Sbjct: 122 RIAAMKLIKED-FKITKEHGQWVE----KAGVQMTAMYHPAALLRNPGWRPAAFEDLKSL 176

Query: 255 KKALKNL 261
           +  +K +
Sbjct: 177 QAKIKEI 183


>gi|327400521|ref|YP_004341360.1| phage SPO1 DNA polymerase-like protein [Archaeoglobus veneficus
           SNP6]
 gi|327316029|gb|AEA46645.1| phage SPO1 DNA polymerase-related protein [Archaeoglobus veneficus
           SNP6]
          Length = 202

 Score =  168 bits (424), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 41/189 (21%), Positives = 89/189 (47%), Gaps = 3/189 (1%)

Query: 75  CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
            SL ++++ +RS   C+L  T  + +        +++ +G  P   ++  G+PF G  G 
Sbjct: 2   ESLEDIEAEIRSCKKCNLWKTKTNYVPGEGNPKAEVVFVGEAPGREEDRQGRPFVGNAGK 61

Query: 135 MLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           +L +M++ + + R  + I  I    PP NR+    E+E C P ++RQ+++I P I++ +G
Sbjct: 62  ILTEMIEKLGLRREDVFIGNILKCRPPNNRDPLPEEIEACSPYLIRQLDVIKPSIIVCLG 121

Query: 195 NKTKNFF---FNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
             + +F    F  + +   +  G+   +      +  +A  HP  ++  P +++      
Sbjct: 122 RHSASFLFNFFGIEFRGISKERGRVKEVERWGKKVRLIAIYHPAAILYRPQLREMFEEDF 181

Query: 252 ITLKKALKN 260
             +   L+ 
Sbjct: 182 AVIAGLLRE 190


>gi|300853380|ref|YP_003778364.1| putative phage related DNA polymerase [Clostridium ljungdahlii DSM
           13528]
 gi|300433495|gb|ADK13262.1| predicted phage related DNA polymerase [Clostridium ljungdahlii DSM
           13528]
          Length = 192

 Score =  168 bits (424), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 43/186 (23%), Positives = 75/186 (40%), Gaps = 6/186 (3%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
             EL     S   C L     + +         +M IG  P   ++ +G PF G+ G +L
Sbjct: 4   WKELYEECLSCSKCSLGDNRTNMVFGDGNPKAHIMFIGEAPGADEDRTGIPFVGRAGQLL 63

Query: 137 DKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
            K L ++++ R    +I  I    P  NR     E + C P +  Q+ L+ PKI++ +G 
Sbjct: 64  TKALLALDLHRERDYYICNICKCRPKNNRTPYEEEEKACIPYLRNQVALVRPKIIVCLGA 123

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
                    +  +  ++ GKW             AT HP  +++    K   W  L ++K
Sbjct: 124 TAMGCILGKEW-RITRDRGKWIE----RKGFYMTATFHPSAVLRDANKKAAFWEDLKSIK 178

Query: 256 KALKNL 261
           +  + +
Sbjct: 179 EKNEEI 184


>gi|261367056|ref|ZP_05979939.1| uracil-DNA glycosylase [Subdoligranulum variabile DSM 15176]
 gi|282571175|gb|EFB76710.1| uracil-DNA glycosylase [Subdoligranulum variabile DSM 15176]
          Length = 188

 Score =  168 bits (424), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 42/187 (22%), Positives = 87/187 (46%), Gaps = 6/187 (3%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
            L  L+    +   C LC +    +        +++ +G  P  +++  G+PF G++G +
Sbjct: 2   DLQTLQQECLACRRCGLCESRTHVVFGQGVPNAEVLFVGEGPGANEDAQGQPFVGRSGQL 61

Query: 136 LDKMLQSIEIMRTQI-HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           LD  L+++++ R +  +I+ I    PP NR+    E   C P + +Q +L+ PKI++ +G
Sbjct: 62  LDHYLEAVDLNREKNVYIANIVKCRPPQNRDPLPEESAACLPWLRQQFQLLRPKIIVCLG 121

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITL 254
                           ++ GK+ +          +AT HP  L++YP+ K   +   + L
Sbjct: 122 RIAAQQLI-EPGFSVTRDHGKFFD----KHGTLFMATYHPAALLRYPVNKPAVFGDFVAL 176

Query: 255 KKALKNL 261
           ++ +  +
Sbjct: 177 REKIAQV 183


>gi|195953859|ref|YP_002122149.1| phage SPO1 DNA polymerase-related protein [Hydrogenobaculum sp.
           Y04AAS1]
 gi|195933471|gb|ACG58171.1| phage SPO1 DNA polymerase-related protein [Hydrogenobaculum sp.
           Y04AAS1]
          Length = 245

 Score =  168 bits (424), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 42/192 (21%), Positives = 76/192 (39%), Gaps = 5/192 (2%)

Query: 75  CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
             L       +    C L       +         +M +G  P   +++ GKPF GK G 
Sbjct: 53  RQLKAFYETCKDCKKCKLSEQRTQVVFGDGNPDTGIMFVGEGPGADEDVEGKPFVGKAGK 112

Query: 135 MLDKMLQSIEIMRTQ-IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFI 193
           +L + L+ + ++R +  +I+ +    PPGNR     EM  C  I+  +++LI PK+++ +
Sbjct: 113 LLTQELERVGLLRQRDYYITNVVKCRPPGNRTPEEQEMITCSYILKEEMKLIKPKLVIAL 172

Query: 194 GNKTKNFFFNNDAQKTYQNLGKWSNLCTP----HSIIPTLATVHPQELIQYPLIKKNTWH 249
           G                +  G + +                T HP  L++ P   KN   
Sbjct: 173 GRTAAVGLSGIKQISPTKVRGSFISANLKSPVLAPGTKIFVTYHPSYLLRNPNELKNFRE 232

Query: 250 ALITLKKALKNL 261
            +I +K  + +L
Sbjct: 233 DIIKIKSLVDSL 244


>gi|257094232|ref|YP_003167873.1| phage SPO1 DNA polymerase-like protein [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257046756|gb|ACV35944.1| phage SPO1 DNA polymerase-related protein [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
          Length = 287

 Score =  168 bits (424), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 49/238 (20%), Positives = 87/238 (36%), Gaps = 5/238 (2%)

Query: 26  WVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLR 85
            + D        ++  + + +                  +   +         EL   + 
Sbjct: 41  VLADATRAGLHQQAVEQARPLPGGASADVPSAARTERTERTERAEQIARLGWDELAESVA 100

Query: 86  SFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEI 145
           +   C LC      +      G D + IG  P   ++  G+PF G  G +LD ML +I++
Sbjct: 101 ACRACGLCEQRRQAVLGVGDHGADWLFIGEGPGAEEDARGEPFVGPAGKLLDAMLAAIDL 160

Query: 146 MR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNN 204
            R   ++I+      PP NR    +EM  C P + RQIELI P++++ +G    +    +
Sbjct: 161 RRGADVYIANAVKCRPPSNRTPEAVEMVACAPYLRRQIELIQPRLIVLLGRAAAHALLGD 220

Query: 205 DAQKTYQNLGKWSNLCTPHSI---IPTLATVHPQELIQYPLIKKNTWHALITLKKALK 259
                    G+             IP + T HP  L++    K   W  L   +  ++
Sbjct: 221 VGSLAS-LRGRPLEYREGAGGRVAIPVVVTYHPAYLLRTLPDKAKAWEDLCRARTVMR 277


>gi|57642078|ref|YP_184556.1| Uracil-DNA glycosylase [Thermococcus kodakarensis KOD1]
 gi|57160402|dbj|BAD86332.1| Uracil-DNA glycosylase [Thermococcus kodakarensis KOD1]
          Length = 196

 Score =  168 bits (424), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 45/188 (23%), Positives = 90/188 (47%), Gaps = 3/188 (1%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           + +L+  +R+   C L +   + +    +    +M +G  P   ++  G PF G+ G +L
Sbjct: 9   MKKLEEKIRNCQKCPLGTLRTNAVPGAGSYDAKVMFVGEAPGYWEDQKGLPFVGRAGKLL 68

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
           D++L  I + R +++I+ I    PP NR+ +  E++ C P + RQI++I PK+++ +G  
Sbjct: 69  DELLAEIGLSRDEVYITNIVKCRPPENRDPTEEEIKACSPYLDRQIDIIRPKVIIPLGRY 128

Query: 197 TKNFFF---NNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALIT 253
           + N+       + +   +  GK     T    I  +   HP   +  P +++        
Sbjct: 129 SMNYLLRKFGFEPEPISRIHGKTFEAHTLFGKIIIMPMYHPAAALYKPPLREELRKDFQK 188

Query: 254 LKKALKNL 261
           LK  L+N+
Sbjct: 189 LKSLLENI 196


>gi|153956358|ref|YP_001397123.1| Phage-related DNA polymerase [Clostridium kluyveri DSM 555]
 gi|146349216|gb|EDK35752.1| Phage-related DNA polymerase [Clostridium kluyveri DSM 555]
          Length = 192

 Score =  167 bits (423), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 46/186 (24%), Positives = 78/186 (41%), Gaps = 6/186 (3%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
             EL     + + C L  + ++ +        DL+ IG  P   ++  G PF GK G +L
Sbjct: 4   WRELYEQCINCNKCGLGDSRINMVFGDGNPKADLVFIGEAPGADEDRIGLPFVGKAGKLL 63

Query: 137 DKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
            K L+S+++ R    +I  I    P  NR     E + C P +  Q+ LI PKI++ +G 
Sbjct: 64  TKALESLDLYRKKDYYICNICKCRPKNNRTPYEDEEKACLPYLRNQVALIKPKIIVCLGA 123

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
                    D  +  ++ GKW             AT HP  +++    K   W  L  ++
Sbjct: 124 TAMGCILGKDW-RITRDRGKWVE----RKGFYITATFHPSAILRDENKKPLFWQDLKNIR 178

Query: 256 KALKNL 261
           +  + +
Sbjct: 179 RKYEEI 184


>gi|156937095|ref|YP_001434891.1| phage SPO1 DNA polymerase-related protein [Ignicoccus hospitalis
           KIN4/I]
 gi|156566079|gb|ABU81484.1| phage SPO1 DNA polymerase-related protein [Ignicoccus hospitalis
           KIN4/I]
          Length = 191

 Score =  167 bits (423), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 39/177 (22%), Positives = 76/177 (42%), Gaps = 3/177 (1%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L E+   ++    C LC    + +     EG +++ +G  P   ++  G+PF G+ G +L
Sbjct: 3   LREVAEKVKGCCKCDLCKVRKNPVPGEGDEGAEVVFVGEAPGKEEDEEGRPFVGRAGRLL 62

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
              +  I     + +I+ +    PPGNR  +  E+E C+P ++ ++  I PK+++ +G  
Sbjct: 63  RSTISQIGFK--KYYITNVVKCRPPGNRTPTEEEVEACKPYLIEELNCIRPKLVVALGRT 120

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALIT 253
                            GK        + +  L T HP  +++ P +K+     L  
Sbjct: 121 AAEALLGLKGPLKG-VRGKVLVASAGGARVKVLVTYHPAAVLRNPKLKEQFVSDLKK 176


>gi|188997005|ref|YP_001931256.1| phage SPO1 DNA polymerase-related protein [Sulfurihydrogenibium sp.
           YO3AOP1]
 gi|188932072|gb|ACD66702.1| phage SPO1 DNA polymerase-related protein [Sulfurihydrogenibium sp.
           YO3AOP1]
          Length = 217

 Score =  167 bits (423), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 44/195 (22%), Positives = 86/195 (44%), Gaps = 5/195 (2%)

Query: 60  HSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSD 119
              L Q++ +   K   L+++   ++    C L  +  + +         +M IG  P +
Sbjct: 22  KPILNQKSSNQIDKIEELNKIYEEIKVCTKCDLHKSRTNPVLGEGNINAKIMFIGEAPGE 81

Query: 120 SDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIM 179
            ++  G+PF G+ G +L K +++   +R +++I+ I+   PP NR  +  E E C P ++
Sbjct: 82  EEDKQGRPFVGRAGKLLTKCIENAGHIREEVYIANINKCRPPNNRTPTIEEQEACIPFLL 141

Query: 180 RQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ 239
           RQIE+I+PK+L  +G       F     K  +  G                T HP  +++
Sbjct: 142 RQIEIINPKVLCLLGATAYRGIFK-KEAKITKERGSILEFMGK----KVYITYHPAYVLR 196

Query: 240 YPLIKKNTWHALITL 254
            P  ++     +  +
Sbjct: 197 NPKEEETFCQDIKNV 211


>gi|219856673|ref|YP_002473795.1| hypothetical protein CKR_3330 [Clostridium kluyveri NBRC 12016]
 gi|219570397|dbj|BAH08381.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 196

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 46/186 (24%), Positives = 78/186 (41%), Gaps = 6/186 (3%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
             EL     + + C L  + ++ +        DL+ IG  P   ++  G PF GK G +L
Sbjct: 8   WRELYEQCINCNKCGLGDSRINMVFGDGNPKADLVFIGEAPGADEDRIGLPFVGKAGKLL 67

Query: 137 DKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
            K L+S+++ R    +I  I    P  NR     E + C P +  Q+ LI PKI++ +G 
Sbjct: 68  TKALESLDLYRKKDYYICNICKCRPKNNRTPYEDEEKACLPYLRNQVALIKPKIIVCLGA 127

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
                    D  +  ++ GKW             AT HP  +++    K   W  L  ++
Sbjct: 128 TAMGCILGKDW-RITRDRGKWVE----RKGFYITATFHPSAILRDENKKPLFWQDLKNIR 182

Query: 256 KALKNL 261
           +  + +
Sbjct: 183 RKYEEI 188


>gi|225849400|ref|YP_002729564.1| uracil-DNA glycosylase [Sulfurihydrogenibium azorense Az-Fu1]
 gi|225644302|gb|ACN99352.1| uracil-DNA glycosylase family 4 protein [Sulfurihydrogenibium
           azorense Az-Fu1]
          Length = 211

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 41/185 (22%), Positives = 80/185 (43%), Gaps = 5/185 (2%)

Query: 72  QKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGK 131
           +K   L+++   +++   C L       +         +M IG  P + ++  G+PF G+
Sbjct: 28  EKIKLLNQINQEIQNCTKCDLHKNRKQAVLGEGNPNSPIMFIGEAPGEEEDKQGRPFVGR 87

Query: 132 TGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILL 191
            G +L K +++    R+ ++I+ I+   PP NR  +  E E C P + RQIE+I+P +L 
Sbjct: 88  AGQLLTKAIETAGYKRSDVYIANINKCRPPNNRTPTIEEQEACFPYLKRQIEIINPSVLC 147

Query: 192 FIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
            +G       F  +  K  +  G   +            T HP  +++ P  +   +  +
Sbjct: 148 LLGATAYRGIFKRET-KITKERGSILDYEGK----KVYITYHPAFVLRNPREEPTFFEDI 202

Query: 252 ITLKK 256
               +
Sbjct: 203 KKALE 207


>gi|18977757|ref|NP_579114.1| DNA polymerase [Pyrococcus furiosus DSM 3638]
 gi|18893498|gb|AAL81509.1| DNA polymerase, bacteriophage-type [Pyrococcus furiosus DSM 3638]
          Length = 196

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 46/188 (24%), Positives = 85/188 (45%), Gaps = 3/188 (1%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           + +L+  + +   C L     + +         +M IG  P   ++  G PF GK G +L
Sbjct: 7   MKKLEEKILTCKKCPLWRLRTNPVPGYGNYDAKIMFIGEAPGYWEDQKGLPFVGKAGKVL 66

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
           D++L  I + R  ++I+ +    PP NR+ +  E++ C P + +QI++I PK+++ +G  
Sbjct: 67  DELLDGIGLTREDVYITNVVKCRPPNNRDPTEEEIKACSPYLDQQIDIIKPKVIVTLGRH 126

Query: 197 TKNFFF---NNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALIT 253
           + N+       D +   +  GK     T    +    T HP   +  P +K+        
Sbjct: 127 STNYILKKFGFDLEPISKIHGKVFKAKTLFGTLYIFPTYHPAVALYRPQLKEELKQDFDI 186

Query: 254 LKKALKNL 261
           LK  L+ L
Sbjct: 187 LKSLLEKL 194


>gi|317133620|ref|YP_004092934.1| phage SPO1 DNA polymerase-related protein [Ethanoligenens
           harbinense YUAN-3]
 gi|315471599|gb|ADU28203.1| phage SPO1 DNA polymerase-related protein [Ethanoligenens
           harbinense YUAN-3]
          Length = 192

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 49/188 (26%), Positives = 92/188 (48%), Gaps = 5/188 (2%)

Query: 74  ACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTG 133
             S  EL++  ++   C L       +  T +   +++ IG  P   +++ G+PF G+ G
Sbjct: 2   PESWDELEAACKACTACGLAEKRTQVVFGTGSREAEVLFIGEGPGQQEDLKGEPFVGRAG 61

Query: 134 NMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFI 193
            +LDKML ++ + R++I+I+ I    PP NR+    E + C P +  Q +L++PKI++ +
Sbjct: 62  QLLDKMLVAVGLDRSKIYIANIVKCRPPQNRDPLPEEQDACLPWLRAQTKLLAPKIIICV 121

Query: 194 GNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALIT 253
           G          D  K  +  G+W         +  +AT+HP  L++ P  K   +   + 
Sbjct: 122 GRIAGMKLMKPDL-KITREHGQWF----QRGHVLMMATLHPAALLRNPNQKPEAFKDFLA 176

Query: 254 LKKALKNL 261
           L+  +K +
Sbjct: 177 LRDKIKEI 184


>gi|288817443|ref|YP_003431790.1| phage SPO1 DNA polymerase-related protein [Hydrogenobacter
           thermophilus TK-6]
 gi|288786842|dbj|BAI68589.1| phage SPO1 DNA polymerase-related protein [Hydrogenobacter
           thermophilus TK-6]
          Length = 185

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 46/182 (25%), Positives = 78/182 (42%), Gaps = 2/182 (1%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           LHEL   L     C L   S   +         ++ +G  P + ++   KPF GK G  L
Sbjct: 2   LHELYETLSKEKKCILYEGSSGYVFGDGNPDSAVVFVGEAPGEEEDKQKKPFVGKAGKYL 61

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
           +  LQ + + R  ++I+ +    PPGNR  +  EM  C P + ++IE+I PK+++ +G+ 
Sbjct: 62  NAKLQEVGMRREDVYITNVVKSRPPGNRKPTKEEMLSCLPYLRKEIEIIKPKLIVCLGST 121

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
                    A    +  G+          I  L T HP  +++ P   +     +  +K 
Sbjct: 122 ALEGLLG-KALPITKYRGQVFEYPYS-RNIKVLLTYHPAYVLRNPSADREFMEDMKKVKA 179

Query: 257 AL 258
            L
Sbjct: 180 LL 181


>gi|229816615|ref|ZP_04446913.1| hypothetical protein COLINT_03672 [Collinsella intestinalis DSM
           13280]
 gi|229807821|gb|EEP43625.1| hypothetical protein COLINT_03672 [Collinsella intestinalis DSM
           13280]
          Length = 226

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 42/185 (22%), Positives = 79/185 (42%), Gaps = 5/185 (2%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           SL E++S++     C L  T  + +         +M +G  P  ++++ G+PF G+ G  
Sbjct: 18  SLDEIRSVMGDCRACQLYQTRTNIVFGVGNPRARVMFVGEAPGKNEDLQGEPFVGRAGEN 77

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           L+++L    + R  I+I+ +    PP NRN    E+  C P +  QI  I P +++ +GN
Sbjct: 78  LNRILSLAGLEREDIYIANVLKCRPPQNRNPQADEVLACSPYLREQIRSIWPDVIVTLGN 137

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
              +F    +     +  G++  +         + T HP   ++ P  +         L 
Sbjct: 138 PASHFVLKTE-VGITKLRGRFHQM----GHFTVMPTFHPAAALRNPAWQALLEEDFRMLG 192

Query: 256 KALKN 260
             L  
Sbjct: 193 AYLAE 197


>gi|262276833|ref|ZP_06054626.1| uracil DNA glycosylase superfamily [alpha proteobacterium HIMB114]
 gi|262223936|gb|EEY74395.1| uracil DNA glycosylase superfamily [alpha proteobacterium HIMB114]
          Length = 217

 Score =  166 bits (421), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 59/193 (30%), Positives = 103/193 (53%), Gaps = 2/193 (1%)

Query: 68  DSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKP 127
             I+    +L++LK  + +  D +        + +       +MIIG  P  SD I+GKP
Sbjct: 23  KKISNSCLTLNDLKKKINNLKDFYNKKQ-DQIVFSDGNSKSKIMIIGDAPGVSDEINGKP 81

Query: 128 FSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISP 187
           FSG++G +LDKML +I + R +++++ I  +    N+ L  +E++  R II   I++I+P
Sbjct: 82  FSGESGELLDKMLMAINLDRNKVYLTNIINFRLQDNKKLGPVEIKNYRSIIFDHIKIINP 141

Query: 188 KILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNT 247
           KI+  +G+ T NFFF N      ++ G W+ +   ++    L + HP  L++ P  KK +
Sbjct: 142 KIIFILGSVTFNFFFKNTQSL-TKSRGHWNKIKISNNEYDCLPSYHPAFLLRQPSQKKAS 200

Query: 248 WHALITLKKALKN 260
           W  L  LK+ +  
Sbjct: 201 WEDLKNLKQKIIE 213


>gi|167769246|ref|ZP_02441299.1| hypothetical protein ANACOL_00569 [Anaerotruncus colihominis DSM
           17241]
 gi|167668886|gb|EDS13016.1| hypothetical protein ANACOL_00569 [Anaerotruncus colihominis DSM
           17241]
          Length = 188

 Score =  166 bits (420), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 50/188 (26%), Positives = 90/188 (47%), Gaps = 6/188 (3%)

Query: 75  CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
            S   L+S   +   C LC T  S +    ++   +M IG  P +++++ G+PF G+ G 
Sbjct: 3   ESFQALQSAALACQGCKLCQTRHSVVFGAGSQHAKIMFIGEGPGENEDLQGEPFVGRAGQ 62

Query: 135 MLDKMLQSIEIMRTQI-HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFI 193
           +LDK+L  + + R    +I+ +    PP NR+    E+E C P +  QIE I PKI++ +
Sbjct: 63  LLDKILTHVGLSRQNDVYITNMVKCRPPKNRDPERDEVEACMPYLRAQIEFIRPKIIVCL 122

Query: 194 GNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALIT 253
           G        + + +   +  G++ +       +  + T HP  L++ P+ K       I 
Sbjct: 123 GRVAACALIDPNFKV-TRQHGEFFD----KDGLMMMGTFHPAALLRNPVNKPGALDDFIN 177

Query: 254 LKKALKNL 261
           L+  L +L
Sbjct: 178 LRARLDSL 185


>gi|212224669|ref|YP_002307905.1| Uracil-DNA glycosylase [Thermococcus onnurineus NA1]
 gi|212009626|gb|ACJ17008.1| Uracil-DNA glycosylase [Thermococcus onnurineus NA1]
          Length = 195

 Score =  166 bits (420), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 42/183 (22%), Positives = 87/183 (47%), Gaps = 3/183 (1%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           +++L+  ++S   C L     + +  + +    +M +G  P   ++  G PF G+ G +L
Sbjct: 7   MNKLEEKIKSCRKCPLGELRTNAVPGSGSYNAKVMFVGEAPGYWEDQKGLPFVGRAGKVL 66

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
           D++L  I + R +++I+ I    PP NR+ +  E++ C P + RQI++I PK+++ +G  
Sbjct: 67  DELLAEIGLDRDEVYITNIVKCRPPDNRDPTEDEIKACSPYLDRQIDIIRPKVIVPLGRH 126

Query: 197 TKNFFF---NNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALIT 253
           +  +       + +   +  GK     T    I  +   HP   +  P +K+        
Sbjct: 127 SMRYILEKFGFEVEPISKIHGKAFEAHTLFGKIVIMPMYHPAVALYRPALKEELRKDFQK 186

Query: 254 LKK 256
           L++
Sbjct: 187 LRE 189


>gi|15899042|ref|NP_343647.1| DNA polymerase phage SPO1 N-terminal domain-containing protein
           [Sulfolobus solfataricus P2]
 gi|284175291|ref|ZP_06389260.1| DNA polymerase phage SPO1 N-terminal domain-containing protein
           [Sulfolobus solfataricus 98/2]
 gi|13815575|gb|AAK42437.1| DNA polymerase phage SPO1 N-terminal domain homolog [Sulfolobus
           solfataricus P2]
 gi|261600789|gb|ACX90392.1| phage SPO1 DNA polymerase-related protein [Sulfolobus solfataricus
           98/2]
          Length = 216

 Score =  166 bits (420), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 47/190 (24%), Positives = 84/190 (44%), Gaps = 4/190 (2%)

Query: 75  CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
            +L  +   +R    C L     + +        ++M IG  P ++++I GKPF G  G 
Sbjct: 2   DNLDLIADEVRKCQKCKLWKFRKNAVPGEGNSKAEIMFIGEAPGENEDIEGKPFVGVAGK 61

Query: 135 MLDKML-QSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFI 193
           +L +++ + + + R  + I+ +    PP NR+    E+  C P + RQIE I P I++ +
Sbjct: 62  LLTRLINEILGLSREDVFITNLVKCRPPNNRDPEEDEILACSPYLTRQIESIRPHIIITL 121

Query: 194 GNKTKNFFFNNDAQKT---YQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHA 250
           G  + ++ F     K     +  GK+         I    T HP   +  P I+K     
Sbjct: 122 GRHSTSYLFKKMNMKMESIGKVRGKFYTWNIYGYKILVFPTYHPAAALYNPPIRKVLEED 181

Query: 251 LITLKKALKN 260
              +K+AL +
Sbjct: 182 FRKVKEALSS 191


>gi|126460679|ref|YP_001056957.1| phage SPO1 DNA polymerase-related protein [Pyrobaculum calidifontis
           JCM 11548]
 gi|126250400|gb|ABO09491.1| phage SPO1 DNA polymerase-related protein [Pyrobaculum calidifontis
           JCM 11548]
          Length = 194

 Score =  166 bits (420), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 41/182 (22%), Positives = 83/182 (45%), Gaps = 3/182 (1%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L +L   ++    C L  T  + +    +    +MI+G  P  S++  G+PF G  G++
Sbjct: 3   TLEQLHEEIKRCTRCPLHKTRRNAVPGEGSGRLGIMIVGEAPGSSEDEQGRPFVGAAGSL 62

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           L+K L ++ + R  ++I+ +    PPGNR  +  E+  C P ++RQIE++ P+ ++ +G 
Sbjct: 63  LNKTLSTLGVERGDLYITNVVKCRPPGNRTPTREEVAACLPYLLRQIEILRPRRIIALGA 122

Query: 196 KTKNFFFNNDAQKTYQ---NLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALI 252
            +         ++  +     GK          +    T HP  +++ P ++      L 
Sbjct: 123 VSAGALLGLIGRQVERVGDVRGKCFRGKVAGVDVEICVTYHPAAVLRNPRLRGTFAEDLA 182

Query: 253 TL 254
             
Sbjct: 183 AF 184


>gi|15606784|ref|NP_214164.1| N-terminus of phage SPO1 DNA polymerase [Aquifex aeolicus VF5]
 gi|2984015|gb|AAC07559.1| N-terminus of phage SPO1 DNA polymerase [Aquifex aeolicus VF5]
          Length = 195

 Score =  166 bits (419), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 40/183 (21%), Positives = 78/183 (42%), Gaps = 3/183 (1%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L  L    +    C L  +    +         L+ +G  P + ++  GKPF G+ G +L
Sbjct: 12  LKNLYEEWKDCTRCDLHKSRTRVVPGDGNPYSLLVFVGEAPGEEEDRQGKPFVGRAGQLL 71

Query: 137 DKMLQSI-EIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           +++++ +  + R  ++I+ +    PP NR  + IEM  C P + ++IE+I PK++  +G 
Sbjct: 72  NRLIEEVLGMKREDVYITNVCKCRPPQNRKPTPIEMRACFPYLKKEIEIIQPKVICCLGA 131

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
                     + +  +  G+          I    T HP  +++ P  +         LK
Sbjct: 132 TAGEGILG-KSLRITKVRGQVFPYPYNPR-IKVFLTYHPAYVLRNPKEETTIIKDFEKLK 189

Query: 256 KAL 258
           + L
Sbjct: 190 ELL 192


>gi|300311462|ref|YP_003775554.1| uracil-DNA glycosylase [Herbaspirillum seropedicae SmR1]
 gi|300074247|gb|ADJ63646.1| uracil-DNA glycosylase protein [Herbaspirillum seropedicae SmR1]
          Length = 340

 Score =  166 bits (419), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 52/222 (23%), Positives = 85/222 (38%), Gaps = 12/222 (5%)

Query: 47  DSAIQPITNIRHIHSPLVQQADSIAQKAC--SLHELKSLLRSFHDCHLCSTSLSTICATQ 104
            ++++P+          +   D +  +       +LK  +     C LC     T+    
Sbjct: 120 AASLEPVLIPEGEDDEPMPAVDPVIARIKQMDWPQLKEQVADCRRCGLCQGRKKTVFGVG 179

Query: 105 TEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPG- 162
            E    + IG  P  +++I G+PF G  G +LD ML S+ + R    +I+ I    P   
Sbjct: 180 DEKAKWLFIGEGPGRNEDIQGEPFVGPAGKLLDNMLVSMGVKRGDNAYIANIVKCRPTDE 239

Query: 163 ---NRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKT-YQNLGKWSN 218
              +R  S  E+  C P + RQIELI P +L+ +G          D      +  G    
Sbjct: 240 NGRDRPPSPQEVASCLPYLQRQIELIQPTVLVALGKTAAISLLGLDPTTPVARLRGTVHR 299

Query: 219 LCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
                  +P + T HP  L++    K  TW  L       + 
Sbjct: 300 YQ----ELPLVVTYHPAYLLRSLQDKSKTWADLCLAMSTYQA 337


>gi|332527846|ref|ZP_08403884.1| putative DNA polymerase-like protein [Rubrivivax benzoatilyticus
           JA2]
 gi|332112241|gb|EGJ12217.1| putative DNA polymerase-like protein [Rubrivivax benzoatilyticus
           JA2]
          Length = 227

 Score =  166 bits (419), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 45/188 (23%), Positives = 81/188 (43%), Gaps = 12/188 (6%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
               L+  +     C L  +   T+          MI+G  P + +++ G+PF G  G +
Sbjct: 37  DWQPLREAVAGCTACALAQSRTQTVFGVGHPQAHWMIVGEAPGEQEDLRGEPFVGAAGQL 96

Query: 136 LDKMLQSIEIMR-------TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPK 188
           LD ML+++ + R        +++I+      PP NRN +  E++ C P ++RQIEL+ P+
Sbjct: 97  LDAMLRALALSRAADGDPAQRVYIANTLKCRPPRNRNPAPDELQRCEPFLVRQIELVKPR 156

Query: 189 ILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTW 248
           I+L +G           ++   +  G+          +P + T HP  L++    K   W
Sbjct: 157 IILAMGRFAVQALL-RSSEPIGKLRGRVHRYQ----GVPLVVTYHPAYLLRNLPDKARAW 211

Query: 249 HALITLKK 256
             L     
Sbjct: 212 DDLCLAAA 219


>gi|218883592|ref|YP_002427974.1| predicted Uracil-DNA glycosylase [Desulfurococcus kamchatkensis
           1221n]
 gi|218765208|gb|ACL10607.1| predicted Uracil-DNA glycosylase [Desulfurococcus kamchatkensis
           1221n]
          Length = 216

 Score =  166 bits (419), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 42/186 (22%), Positives = 78/186 (41%), Gaps = 3/186 (1%)

Query: 75  CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
                L + + +   C L     + +         +M IG  P + ++ +G+PF G  G 
Sbjct: 2   SEWDSLVNSILNCKRCRLSQYRRNPVPGEGNVNAGVMFIGEAPGEKEDETGRPFVGAAGK 61

Query: 135 MLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           +L ++++S    R  ++I+ I    PPGNR+  + E+E C P +++QIELI P++++ +G
Sbjct: 62  LLIELIESTGFKRGDVYITNIVKCRPPGNRDPEDDEIEACLPYLLKQIELIKPRLIVALG 121

Query: 195 NKTKNFFF---NNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
                  F              G+  N       +  + T HP   +  P +K       
Sbjct: 122 RHAARTLFRLGGLKWVNMSMMHGRPYNAVINGLQVVIIPTFHPAAALYNPGLKDELRRDF 181

Query: 252 ITLKKA 257
             + K 
Sbjct: 182 EEVIKK 187


>gi|320535746|ref|ZP_08035831.1| uracil-DNA glycosylase, family 4 [Treponema phagedenis F0421]
 gi|320147402|gb|EFW38933.1| uracil-DNA glycosylase, family 4 [Treponema phagedenis F0421]
          Length = 265

 Score =  165 bits (418), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 61/268 (22%), Positives = 107/268 (39%), Gaps = 21/268 (7%)

Query: 7   LSQEQILTIALFYADS-----GVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHS 61
           ++  + L +  F+  S     G Y + +E       E    E +   A          H 
Sbjct: 1   MTATEKLILYRFFKTSADYLRG-YALSEEEPVFVDTEIAPAEAAQQDAAPAQNPSTEPHV 59

Query: 62  PLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTE-------GQDLMIIG 114
              Q       +  ++ ++   + +   C L +T +  +     E         ++M+IG
Sbjct: 60  LFQQAGQD--SRFSTMADIAQAVHACRGCGLAATRIHAVPGEGPEELSRLQNSVEVMVIG 117

Query: 115 YTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRT-QIHISMISPWHPPGNRNLSNIEMEI 173
             P   ++ +G+PF GK G +LDKML++I++ R    +I+ I    PP NR+ +  E   
Sbjct: 118 EGPGADEDKTGRPFVGKAGQLLDKMLEAIQLSRKTNCYITNIVKCRPPQNRDPAPAECAA 177

Query: 174 CRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVH 233
           C   +  QI L  P  +L  G         N  +   +  G++ +       IP LAT H
Sbjct: 178 CAQFLEAQIRLQKPLAILVFGRCAAQ-LLLNTTEGIGKLRGRFFDYN----GIPLLATYH 232

Query: 234 PQELIQYPLIKKNTWHALITLKKALKNL 261
           P  L++   +K+  W  L   +  L  L
Sbjct: 233 PSALLRDESLKRPAWEDLKKFRTQLLQL 260


>gi|86609842|ref|YP_478604.1| uracil-DNA glycosylase [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86558384|gb|ABD03341.1| uracil-DNA glycosylase, family 4 [Synechococcus sp.
           JA-2-3B'a(2-13)]
          Length = 206

 Score =  165 bits (417), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 48/193 (24%), Positives = 80/193 (41%), Gaps = 11/193 (5%)

Query: 75  CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
             L +LK        C L ++    +         ++IIG  P +S+++ G PF GK+G 
Sbjct: 9   RDLEQLKQHCLVCQRCDLAASRTHVVVHRGNPKARILIIGEGPGESEDLQGLPFVGKSGQ 68

Query: 135 MLDKMLQSIEI-MRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFI 193
           +LDK+L S+ +      +I  +    PP NR  +  EM+ CRP ++ QI L+ P I+L  
Sbjct: 69  LLDKILASVGLDPEQDTYICNVVKCRPPNNRVPTQEEMDACRPYLLEQIRLVDPWIILLT 128

Query: 194 GNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLI-----KKNTW 248
           G  +             +  G+W            +   HP  L++ P       K   W
Sbjct: 129 GATSVRSLLGEKR-GITKIRGEWIQWQGRW----CMPIFHPAYLLRNPDRTPGSPKWLMW 183

Query: 249 HALITLKKALKNL 261
             +  +K+    L
Sbjct: 184 QDIQAVKQKYLEL 196


>gi|254451188|ref|ZP_05064625.1| uracil-DNA glycosylase, C-terminal domain protein [Octadecabacter
           antarcticus 238]
 gi|198265594|gb|EDY89864.1| uracil-DNA glycosylase, C-terminal domain protein [Octadecabacter
           antarcticus 238]
          Length = 264

 Score =  165 bits (417), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 61/260 (23%), Positives = 114/260 (43%), Gaps = 12/260 (4%)

Query: 12  ILTIALFYADSGVYWVF-DEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSI 70
              +  +  + G      DEP +    +  +       A   + +     +    + D I
Sbjct: 6   AKALLDWQVEMGCDEAIGDEPVDRYALKDVKPAPKPVQAPSTLASAPPPVATPAPEVDQI 65

Query: 71  AQKACSLHEL------KSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNIS 124
           +    + +        ++ + +F  C L   + + + +    G  +MII   P   D+ +
Sbjct: 66  SAARDAANAAQDLAALRAAMATFEGCALKPVARNLVFSGGIAGAPVMIIADAPDRDDDRA 125

Query: 125 GKPFSGKTGNMLDKMLQSIEIMRT---QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQ 181
           G+ F+G+TG +LDKML +I + R+    I+ + + PW+PP NR+    EM +  P + R 
Sbjct: 126 GEMFAGRTGALLDKMLAAIGLGRSGDAPIYAAPVLPWNPPQNRDPDAEEMAMMLPFLQRH 185

Query: 182 IELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
           I L +PKIL+ +GN               +  G W+++    + +P +    P  L+  P
Sbjct: 186 ITLAAPKILILMGNGPCQALLGRSG--MTRLHGSWADVQIGSASLPAIPMFAPSYLLTTP 243

Query: 242 LIKKNTWHALITLKKALKNL 261
             K+  W  L++LK  LK+L
Sbjct: 244 SAKREAWGDLLSLKARLKDL 263


>gi|119719708|ref|YP_920203.1| phage SPO1 DNA polymerase-related protein [Thermofilum pendens Hrk
           5]
 gi|119524828|gb|ABL78200.1| phage SPO1 DNA polymerase-related protein [Thermofilum pendens Hrk
           5]
          Length = 217

 Score =  164 bits (416), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 36/188 (19%), Positives = 75/188 (39%), Gaps = 3/188 (1%)

Query: 75  CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
            +L E+   +     C L  +   T+         ++ IG  P  ++++ G+PF G  G 
Sbjct: 18  RALEEIAGEIAKCEKCPLSRSRTHTVPGEGNPCSGVVFIGEAPGRNEDLQGRPFVGAAGA 77

Query: 135 MLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           +L +++    + R ++ I+ +    PP NR     E+  C P ++ Q+  I P++++ +G
Sbjct: 78  LLTELISLAGLSREEVFITNVVKCRPPNNREPREEEIAACLPYLLAQLRAIKPRLIVTLG 137

Query: 195 NKTKNFFF---NNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
             +                   GK   +      +    T+HP   +  P ++K      
Sbjct: 138 KHSTKTILRMRGMSVDSIMSVRGKAYTVNAEWGQVTVFPTLHPAAALYNPAMRKVLEEDF 197

Query: 252 ITLKKALK 259
             L+  L+
Sbjct: 198 RFLRGLLE 205


>gi|108803352|ref|YP_643289.1| phage SPO1 DNA polymerase-like protein [Rubrobacter xylanophilus
           DSM 9941]
 gi|108764595|gb|ABG03477.1| phage SPO1 DNA polymerase-related protein [Rubrobacter xylanophilus
           DSM 9941]
          Length = 216

 Score =  164 bits (416), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 45/195 (23%), Positives = 85/195 (43%), Gaps = 17/195 (8%)

Query: 72  QKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGK 131
            +   L EL   +     C L  +  +T+  T      LM++G  P ++++ +G PF G+
Sbjct: 13  NREERLAELARQVSVCTRCDLSRSRTNTVFGTGDPYSPLMLVGEGPGENEDATGLPFVGR 72

Query: 132 TGNMLDKMLQSIEIMRTQIHISMISPWH-------PPGNRNLSNIEMEICRPIIMRQIEL 184
            G +LD +L ++ + R Q++I+ I              NR     E+  C P +  QIE 
Sbjct: 73  AGKLLDNILAAVNLSREQVYITNIVKCRAAVEENGRLRNRQPRAAEINACNPYLQAQIEA 132

Query: 185 ISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP--- 241
           + P+I+L +G        + D  +  ++ G+W  +      I  +AT HP  +++     
Sbjct: 133 VRPEIILCLGGPAAKTIIDRD-FRITRDRGRWYEV----GGIRAMATFHPAYILRQSGEE 187

Query: 242 --LIKKNTWHALITL 254
               K+  W  +  +
Sbjct: 188 LARTKRLVWKDIQNV 202


>gi|206901596|ref|YP_002251107.1| DNA polymerase, bacteriophage-type [Dictyoglomus thermophilum
           H-6-12]
 gi|206740699|gb|ACI19757.1| DNA polymerase, bacteriophage-type [Dictyoglomus thermophilum
           H-6-12]
          Length = 210

 Score =  164 bits (416), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 43/187 (22%), Positives = 80/187 (42%), Gaps = 5/187 (2%)

Query: 73  KACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKT 132
           K   L  L+    +  +C L     + +         +M IG  P   ++  G+PF G  
Sbjct: 6   KIDELEILRREAENCKNCSLWQQRTNLVFGEGNPNSSIMFIGEAPGFHEDQQGRPFVGAA 65

Query: 133 GNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLF 192
           G +L ++++S+ + R  I+I+ +    PP NR     E++ C P + RQIE+I+PK++  
Sbjct: 66  GRLLTELIESMGLKREDIYIANVLKCRPPNNREPLPEEIKACFPFLRRQIEIINPKVICT 125

Query: 193 IGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALI 252
           +G         + +     + GK  +       I    T HP   + +  + +N      
Sbjct: 126 LGRYAAYAILGH-SVNISNSHGK--DYVVDGKRI--FVTYHPAAALYHGKLLENIRKDFE 180

Query: 253 TLKKALK 259
            LK+  +
Sbjct: 181 KLKELYE 187


>gi|189345810|ref|YP_001942339.1| phage SPO1 DNA polymerase-related protein [Chlorobium limicola DSM
           245]
 gi|189339957|gb|ACD89360.1| phage SPO1 DNA polymerase-related protein [Chlorobium limicola DSM
           245]
          Length = 211

 Score =  164 bits (416), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 54/202 (26%), Positives = 91/202 (45%), Gaps = 5/202 (2%)

Query: 60  HSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSD 119
            + L  +A    +   +LH L    R+   C L ST  + +         L++IG  P  
Sbjct: 8   ENELQSEAAGGEKTLTALHSLYERSRTCTKCRLASTRTNFVFGEGNPHARLVVIGEAPGA 67

Query: 120 SDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIM 179
            ++  G+PF G++G +LDK+LQ+++  R ++ I  I    PP NRN    E+  C P ++
Sbjct: 68  DEDALGRPFVGRSGQLLDKILQAVQFRREEVFICNIIKCRPPQNRNPLQDEIASCMPWLL 127

Query: 180 RQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ 239
            Q++L+ P +LL +G    N    N         GK             +AT HP  L++
Sbjct: 128 DQLDLLKPSMLLLLGRVAANTILQNTLSL-GAMRGKI----IRWKQFDCVATYHPAALLR 182

Query: 240 YPLIKKNTWHALITLKKALKNL 261
            P  K+  W  +  ++   + L
Sbjct: 183 NPNWKRGCWEDVQMMRHHYEML 204


>gi|313114128|ref|ZP_07799680.1| uracil-DNA glycosylase, family 4 [Faecalibacterium cf. prausnitzii
           KLE1255]
 gi|310623537|gb|EFQ06940.1| uracil-DNA glycosylase, family 4 [Faecalibacterium cf. prausnitzii
           KLE1255]
          Length = 191

 Score =  164 bits (416), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 45/185 (24%), Positives = 79/185 (42%), Gaps = 6/185 (3%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
               L+S   +   C LC T  + +     E  +++ +G  P  +++  G PF G++G +
Sbjct: 2   DWETLRSSCLACTRCELCKTRTNVVFGQGVEDAEVLFVGEGPGQNEDEQGLPFVGRSGQL 61

Query: 136 LDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           LDK L +I++ R    +I+ I    PP NR+    E E C P +  Q  L+ PKI++ +G
Sbjct: 62  LDKYLFAIDLDRTKNCYIANIVKCRPPQNRDPQPAESEACMPWLREQFRLLKPKIVVCLG 121

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITL 254
                           +  G+          I  + T HP  L++ P  K   +     L
Sbjct: 122 RIAAQRMI-RKDFSVTKEHGQLYE----KGGILFMGTFHPAALLRSPQNKPAAFADFTAL 176

Query: 255 KKALK 259
           +  ++
Sbjct: 177 RDNIE 181


>gi|296125284|ref|YP_003632536.1| phage SPO1 DNA polymerase-related protein [Brachyspira murdochii
           DSM 12563]
 gi|296017100|gb|ADG70337.1| phage SPO1 DNA polymerase-related protein [Brachyspira murdochii
           DSM 12563]
          Length = 252

 Score =  164 bits (415), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 44/221 (19%), Positives = 91/221 (41%), Gaps = 4/221 (1%)

Query: 43  EKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCH-LCSTSLSTIC 101
                +        ++I +  ++    I  K   L ++ + +     C  LC++ L+ + 
Sbjct: 31  RNPKKAQQAVKKEEKNITNKGIELMKEI--KNEDLKKIYNEVEKCMKCEALCNSRLNVVF 88

Query: 102 ATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPP 161
               E  D++ +G  P   ++  G PF G+ G +LDK ++ + I + + +I       PP
Sbjct: 89  GRGDEEPDIVFVGEAPGADEDKQGLPFVGRGGKLLDKWIEKMNINKEKYYIMNALKCRPP 148

Query: 162 GNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNND-AQKTYQNLGKWSNLC 220
            NR+    E   CR   +RQ+++++PKI+  +G        + D      +   K     
Sbjct: 149 ENRDPLPEEKANCRDFFVRQLQILNPKIICALGRHGFGNLIDFDLKTPFGKARNKVHYYS 208

Query: 221 TPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
                +P +AT HP  +++    +      L  +   L+ +
Sbjct: 209 NNGKDVPVIATYHPAYILRNQKEEDKVISDLEFMLSELEKI 249


>gi|222099134|ref|YP_002533702.1| Phage SPO1 DNA polymerase-related protein [Thermotoga neapolitana
           DSM 4359]
 gi|221571524|gb|ACM22336.1| Phage SPO1 DNA polymerase-related protein [Thermotoga neapolitana
           DSM 4359]
          Length = 192

 Score =  164 bits (415), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 40/186 (21%), Positives = 80/186 (43%), Gaps = 5/186 (2%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           +  +K  +     C L  T  + +         ++ +G  P + ++ +G+PF G+ G +L
Sbjct: 9   METVKERVERCTACPLHLTRTNVVVGEGNLDTKIVFVGEGPGEEEDKTGRPFVGRAGMLL 68

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
            ++L  + I R  ++I  +    PP NR  +  EM  C   ++ QIE+I+P +++ +G  
Sbjct: 69  TELLNEVGIKREDVYICNVVKCRPPNNRTPTTEEMFACGHFLLAQIEIINPSVVVALGAT 128

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPL--IKKNTWHALITL 254
             +FF +       +  G   +          + T HP  L++     ++K     L   
Sbjct: 129 ALSFFMDGKKVSITKVRGNPMDWL---GGKKIVPTFHPSYLLRNRSKELRKIVLEDLEKA 185

Query: 255 KKALKN 260
           K  +K 
Sbjct: 186 KSFIKE 191


>gi|284162809|ref|YP_003401432.1| phage SPO1 DNA polymerase-related protein [Archaeoglobus profundus
           DSM 5631]
 gi|284012806|gb|ADB58759.1| phage SPO1 DNA polymerase-related protein [Archaeoglobus profundus
           DSM 5631]
          Length = 199

 Score =  164 bits (415), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 39/187 (20%), Positives = 87/187 (46%), Gaps = 3/187 (1%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L +++  +R    C L     + +         ++ IG  P   +++ G+PF GK G  L
Sbjct: 3   LEDVEGEIRKCRKCKLWKYKTNYVPGEGNPNAKIVFIGEAPGKEEDLQGRPFVGKAGKYL 62

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
            ++L+ + + R+ ++I+ +    PP NR+    E+E C+P ++RQ+E+I P +++ +G  
Sbjct: 63  TEVLKKLGVERSDVYITNVLKCRPPNNRDPKPEEIEACKPHLLRQLEIIKPDVIVCLGRF 122

Query: 197 TKNFFF---NNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALIT 253
           + +          +   ++ GK  ++     ++  + T HP  +++   +       L  
Sbjct: 123 SSDVILNEFGIGFRGISRDRGKVFDVEKWGKVVKIIPTYHPAAVLRNKSLADYFESDLKK 182

Query: 254 LKKALKN 260
             + LK 
Sbjct: 183 AVEVLKK 189


>gi|254168341|ref|ZP_04875186.1| uracil-DNA glycosylase, family 4 [Aciduliprofundum boonei T469]
 gi|289595797|ref|YP_003482493.1| phage SPO1 DNA polymerase-related protein [Aciduliprofundum boonei
           T469]
 gi|197622622|gb|EDY35192.1| uracil-DNA glycosylase, family 4 [Aciduliprofundum boonei T469]
 gi|289533584|gb|ADD07931.1| phage SPO1 DNA polymerase-related protein [Aciduliprofundum boonei
           T469]
          Length = 191

 Score =  164 bits (415), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 46/187 (24%), Positives = 86/187 (45%), Gaps = 8/187 (4%)

Query: 75  CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
            SL +++  ++    C L  T  + +       + +M +G  P   ++  G+PF G  G 
Sbjct: 10  DSLEKIEKEIKECKKCPLYKTRKNAVPGEGGFQRRIMFVGEAPGRREDELGRPFVGAAGK 69

Query: 135 MLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
            LD++L SI + R  ++I+ I    PPGNR+ ++ E+++C P + RQI ++ P+I+  +G
Sbjct: 70  FLDELLASIGLSRKDVYITNIVKCRPPGNRDPTDEEIKLCSPYLDRQIAIMKPRIICPLG 129

Query: 195 NKTKNFFF---NNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
             +  +       +  K  +  GK          I  L   HP   + +  +K   + + 
Sbjct: 130 RFSAKYILEKFGFEMGKISKIQGKVFE-----GNILILPMYHPAAALYHQNLKSELYKSF 184

Query: 252 ITLKKAL 258
             LK  L
Sbjct: 185 EVLKSLL 191


>gi|118445103|ref|YP_879168.1| phage SPO1 DNA polymerase-related protein [Clostridium novyi NT]
 gi|118135559|gb|ABK62603.1| phage SPO1 DNA polymerase-related protein [Clostridium novyi NT]
          Length = 190

 Score =  164 bits (415), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 46/186 (24%), Positives = 79/186 (42%), Gaps = 6/186 (3%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
             EL       H+C L       +        +LM IG  P   ++ +GKPF GK G +L
Sbjct: 9   WRELYKECIECHNCELGDKRTHMVFGEGNPKANLMFIGEAPGADEDRTGKPFVGKAGQLL 68

Query: 137 DKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
            K L ++++ R    +I+ I    P  NRN  + E   C   +  Q+ LI PKI++ +G 
Sbjct: 69  TKGLMALDLYRDRDYYITNICKCRPENNRNPMDHEAYACIQYLRNQVALIKPKIIVCLGA 128

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
            +  +  + D  +  ++ GKW         +  +   HP  +++    K   W  L  +K
Sbjct: 129 VSGKYIIDKDL-RITRDRGKWIE----KKGVYIMPIFHPAAILRDDNKKPLFWGDLKEIK 183

Query: 256 KALKNL 261
           +    +
Sbjct: 184 RKYLEI 189


>gi|320100863|ref|YP_004176455.1| phage SPO1 DNA polymerase-like protein [Desulfurococcus mucosus DSM
           2162]
 gi|319753215|gb|ADV64973.1| phage SPO1 DNA polymerase-related protein [Desulfurococcus mucosus
           DSM 2162]
          Length = 216

 Score =  164 bits (415), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 40/190 (21%), Positives = 81/190 (42%), Gaps = 4/190 (2%)

Query: 75  CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
                L + + S   C L     + +         +M++G  P + ++ +G+PF G  G 
Sbjct: 2   DEWGSLVNSILSCKRCRLSEHRKNPVPGEGDTNSRVMLVGEAPGEREDETGRPFVGAAGK 61

Query: 135 MLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           +L ++++SI   R  ++I+ +    PP NR+  + E++ C P +++QIEL+ P++++ +G
Sbjct: 62  LLTELIESIGFKRESLYITNVVKCRPPNNRDPEDDEIKACLPYLLKQIELLKPRVIVALG 121

Query: 195 NKTKNFFF---NNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
                  F              GK  N          + T HP   +  P +K       
Sbjct: 122 RHAARTLFELGGLKWVNMSSMHGKAFNAVINGVHTVIIPTFHPAAALYNPGLKDELRKDF 181

Query: 252 I-TLKKALKN 260
              ++K ++ 
Sbjct: 182 EGVIRKHIEE 191


>gi|294054594|ref|YP_003548252.1| phage SPO1 DNA polymerase-related protein [Coraliomargarita
           akajimensis DSM 45221]
 gi|293613927|gb|ADE54082.1| phage SPO1 DNA polymerase-related protein [Coraliomargarita
           akajimensis DSM 45221]
          Length = 349

 Score =  164 bits (414), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 53/244 (21%), Positives = 97/244 (39%), Gaps = 16/244 (6%)

Query: 26  WVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACS-LHELKSLL 84
            VF          S+    +  +A+     +     P   + D     A S L  L+  +
Sbjct: 95  AVFQSLIKSTQSSSEIPASAEPTAVLKPQVVHAAQLPPPPKIDLPEGDAKSQLAWLRERV 154

Query: 85  RSFHDCH--LCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQS 142
                C+  L       +    +   D+   G  P   + I+G+PF GK G +L K++ +
Sbjct: 155 EQCETCNSNLNLDGR-IVFGEGSPNADIFFCGEAPGADEEIAGQPFVGKAGQLLTKIISA 213

Query: 143 IEIMRTQIHISMISPWH-----PPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT 197
           + + R  ++I  I  W      P GNR  +  EM  C P +  Q+E+I PK+++ +GN  
Sbjct: 214 MGLSREDVYIGNILKWRPQHDKPYGNRPPTEDEMNFCLPYLKAQLEIIQPKVIVALGNTA 273

Query: 198 KNFFFNNDAQKT-YQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLI--KKNTWHALITL 254
            +     D  +   Q  G W +          + T HP  L++   +  K+  W  ++ +
Sbjct: 274 VSGLLGQDPNRRLGQVRGNWHDFN----GTDLMITFHPSYLLRNDTMKTKRLVWEDMLKV 329

Query: 255 KKAL 258
            + +
Sbjct: 330 MERI 333


>gi|210631731|ref|ZP_03296973.1| hypothetical protein COLSTE_00858 [Collinsella stercoris DSM 13279]
 gi|210159851|gb|EEA90822.1| hypothetical protein COLSTE_00858 [Collinsella stercoris DSM 13279]
          Length = 235

 Score =  164 bits (414), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 46/184 (25%), Positives = 82/184 (44%), Gaps = 5/184 (2%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           SL E++S+L     C LC T  + +         +M +G  P  ++++ G+PF G+ G  
Sbjct: 18  SLEEIRSVLGECRLCELCQTRTNIVFGVGNPHARVMFVGEAPGKNEDLRGEPFVGRAGEN 77

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           L+ +L    + R  I+I+ +    PPGNRN    E+  C P +  QI  I P I++ +GN
Sbjct: 78  LNGILSLAGLKREDIYIANVLKCRPPGNRNPKADEVLACSPFLREQIRSIWPDIIVTLGN 137

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
              +F    +     +  G++  +         + T HP   ++ P  ++        L 
Sbjct: 138 PATHFVLKTE-VGITKLRGRFHEM----GHFVVMPTFHPAAALRNPAWQELLEADFRMLG 192

Query: 256 KALK 259
             L+
Sbjct: 193 DYLE 196


>gi|86606890|ref|YP_475653.1| uracil-DNA glycosylase [Synechococcus sp. JA-3-3Ab]
 gi|86555432|gb|ABD00390.1| uracil-DNA glycosylase, family 4 [Synechococcus sp. JA-3-3Ab]
          Length = 206

 Score =  163 bits (413), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 48/193 (24%), Positives = 81/193 (41%), Gaps = 11/193 (5%)

Query: 75  CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
             L +L+   R    C L +     +         ++IIG  P + +++ G PF GK+G 
Sbjct: 9   RELEQLEQHCRVCQRCELAANRTHVVVHRGNPKARILIIGEGPGEQEDLQGLPFVGKSGQ 68

Query: 135 MLDKMLQSIEIM-RTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFI 193
           +LDK+L S+ +      +I  +    PP NR  +  EM+ CRP ++ QI L+ P I+L  
Sbjct: 69  LLDKILASVGLDSERDTYICNVVKCRPPNNRVPTQEEMDACRPYLLEQIRLVDPWIILLT 128

Query: 194 GNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLI-----KKNTW 248
           G  +       D +   +  G+W            +   HP  L++ P       K   W
Sbjct: 129 GATSVRSLLG-DKRGITKIRGEWIQWQGRW----CMPIFHPAYLLRNPDRTPGSPKWLMW 183

Query: 249 HALITLKKALKNL 261
             +  +K+    L
Sbjct: 184 QDIQAVKQKYLEL 196


>gi|254168263|ref|ZP_04875109.1| uracil-DNA glycosylase, family 4 [Aciduliprofundum boonei T469]
 gi|197622772|gb|EDY35341.1| uracil-DNA glycosylase, family 4 [Aciduliprofundum boonei T469]
          Length = 191

 Score =  163 bits (413), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 46/187 (24%), Positives = 86/187 (45%), Gaps = 8/187 (4%)

Query: 75  CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
            SL +++  ++    C L  T  + +       + +M +G  P   ++  G+PF G  G 
Sbjct: 10  DSLEKIEKEIKECKKCPLYKTRKNAVPGEGGFQRRIMFVGEAPGRREDELGRPFVGSAGK 69

Query: 135 MLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
            LD++L SI + R  ++I+ I    PPGNR+ ++ E+++C P + RQI ++ P+I+  +G
Sbjct: 70  FLDELLASIGLSRKDVYITNIVKCRPPGNRDPTDEEIKLCSPYLDRQIAIMKPRIICPLG 129

Query: 195 NKTKNFFF---NNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
             +  +       +  K  +  GK          I  L   HP   + +  +K   + + 
Sbjct: 130 RFSAKYILEKFGFEIGKISKIQGKVFE-----GNILILPMYHPAAALYHQNLKTELYKSF 184

Query: 252 ITLKKAL 258
             LK  L
Sbjct: 185 EVLKSLL 191


>gi|315231723|ref|YP_004072159.1| uracil-DNA glycosylase [Thermococcus barophilus MP]
 gi|315184751|gb|ADT84936.1| uracil-DNA glycosylase [Thermococcus barophilus MP]
          Length = 194

 Score =  163 bits (412), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 46/187 (24%), Positives = 89/187 (47%), Gaps = 3/187 (1%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           + +L+  +R+   C L +   + +  + +    +M +G  P   ++  G PF G+ G +L
Sbjct: 7   MKKLEERIRNCKKCPLSALRTNAVPGSGSYDAKVMFVGEAPGYWEDQKGLPFVGRAGKVL 66

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
           D++L  I + R  ++I+ I    PP NR+ +  E++ C P + RQI++I PKI++ +G  
Sbjct: 67  DELLSEIGLKREDVYITNIVKCRPPNNRDPNEDEIKACSPYLDRQIDIIRPKIIVPLGRH 126

Query: 197 TKNFFF---NNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALIT 253
           + ++       +A+   +  GK     T    +  +   HP   +  P +K+        
Sbjct: 127 SMSYILRKFGFEAEPISRIHGKTFEARTLFGKVIIMPMYHPAVALYRPQLKEELRKDFKK 186

Query: 254 LKKALKN 260
           LK  L N
Sbjct: 187 LKNVLMN 193


>gi|255070667|ref|XP_002507415.1| predicted protein [Micromonas sp. RCC299]
 gi|226522690|gb|ACO68673.1| predicted protein [Micromonas sp. RCC299]
          Length = 248

 Score =  163 bits (412), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 51/241 (21%), Positives = 94/241 (39%), Gaps = 11/241 (4%)

Query: 28  FDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQ-ADSIAQKACSLHELKSLLRS 86
              P   A+       +S   ++ P    R +    +   AD+ +    SL EL   LRS
Sbjct: 5   LALPRALASALPLGNHRSSPRSVPPRAPPRWVRPRALASDADARSPSFSSLDELAHHLRS 64

Query: 87  FHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIE-I 145
                L S     +         +MIIG  P   ++  G PF G+ G +LD++  S+   
Sbjct: 65  LTGDPLESDGGRIVTFRGDTNARVMIIGEAPGAEEDKLGVPFVGRAGKLLDEIFASVTLS 124

Query: 146 MRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNND 205
                +++ +    P  NR+ +  E+E  R  +  +I L+ P I++  G  +       +
Sbjct: 125 TDRHCYVTNVVKRRPLNNRDPTAREIEWYRGYLREEIRLLDPAIIVCTGRHSMRTLLGKN 184

Query: 206 AQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLI-----KKNTWHALITLKKALKN 260
            +   +  G+W ++         +   HP  L++ P       K  TW  +  +K+ +  
Sbjct: 185 CEGITKIRGRWFDV----DGRVVMPMFHPSYLLRNPQKTPGSPKALTWDDIREVKRKVDE 240

Query: 261 L 261
           L
Sbjct: 241 L 241


>gi|294101873|ref|YP_003553731.1| phage SPO1 DNA polymerase-related protein [Aminobacterium
           colombiense DSM 12261]
 gi|293616853|gb|ADE57007.1| phage SPO1 DNA polymerase-related protein [Aminobacterium
           colombiense DSM 12261]
          Length = 212

 Score =  163 bits (412), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 57/208 (27%), Positives = 91/208 (43%), Gaps = 15/208 (7%)

Query: 59  IHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPS 118
                +++A  +A       EL   + S   C L  T +ST+         LM++G  P 
Sbjct: 9   PTGEDIKEAQKLA-----WKELIQQISSCGKCGLHKTRVSTVPGEGNTKTHLMLVGEGPG 63

Query: 119 DSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPII 178
           + ++  GKPF GK G +L K+L++  I R  ++I+ +    PP NR  +  EM  C   +
Sbjct: 64  EEEDEQGKPFVGKAGQLLTKILKAAGISRKDVYITNVVKCRPPHNRVPAIEEMMTCNMYL 123

Query: 179 MRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELI 238
             QI LI P I+L +GN    +F    ++      G+W         I  +   HP  L+
Sbjct: 124 EAQIALIRPSIILCLGNTPTKWFLK-TSEGISNLRGRWF----KWRGIDLMPIFHPSYLL 178

Query: 239 QYPLIKK-----NTWHALITLKKALKNL 261
           +    KK      TW  +  +K+ L  L
Sbjct: 179 RNESRKKGSPKDLTWQDIRAVKEKLDQL 206


>gi|160945470|ref|ZP_02092696.1| hypothetical protein FAEPRAM212_02996 [Faecalibacterium prausnitzii
           M21/2]
 gi|158443201|gb|EDP20206.1| hypothetical protein FAEPRAM212_02996 [Faecalibacterium prausnitzii
           M21/2]
          Length = 193

 Score =  163 bits (412), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 46/187 (24%), Positives = 81/187 (43%), Gaps = 6/187 (3%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
            +  LK+   +   C LC+T  + +        +++ +G  P  S++  G PF G++G +
Sbjct: 5   DMDTLKAECLACTRCELCATRTNVVFGQGVPDAEVLFVGEGPGQSEDEQGLPFVGRSGQL 64

Query: 136 LDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           LDK L +I++ R    +I+ I    PP NR+    E E C P +  Q  L+ PKI++ +G
Sbjct: 65  LDKYLFAIDLDRKKNCYIANIVKCRPPQNRDPLPAESEACMPWLREQFRLLHPKIVVCLG 124

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITL 254
                     D     +  G+          I  + T HP  L++ P  K   +     L
Sbjct: 125 RVAAQRMIRQDFSV-TREHGQIIE----KGGILFMGTFHPAALLRQPQNKPEAFADFTVL 179

Query: 255 KKALKNL 261
           +  +  +
Sbjct: 180 RDTIAAV 186


>gi|295105370|emb|CBL02914.1| uracil-DNA glycosylase, family 4 [Faecalibacterium prausnitzii
           SL3/3]
          Length = 190

 Score =  162 bits (411), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 46/187 (24%), Positives = 81/187 (43%), Gaps = 6/187 (3%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
            +  LK+   +   C LC+T  + +        +++ +G  P  S++  G PF G++G +
Sbjct: 2   DMDTLKAECLACTRCELCATRTNVVFGQGVPDAEVLFVGEGPGQSEDEQGLPFVGRSGQL 61

Query: 136 LDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           LDK L +I++ R    +I+ I    PP NR+    E E C P +  Q  L+ PKI++ +G
Sbjct: 62  LDKYLFAIDLDRKKNCYIANIVKCRPPQNRDPLPAESEACMPWLREQFRLLHPKIVVCLG 121

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITL 254
                     D     +  G+          I  + T HP  L++ P  K   +     L
Sbjct: 122 RVAAQRMIRQDFSV-TREHGQIIE----KGGILFMGTFHPAALLRQPQNKPEAFADFTVL 176

Query: 255 KKALKNL 261
           +  +  +
Sbjct: 177 RDTIAAV 183


>gi|159042210|ref|YP_001541462.1| phage SPO1 DNA polymerase-related protein [Caldivirga
           maquilingensis IC-167]
 gi|157921045|gb|ABW02472.1| phage SPO1 DNA polymerase-related protein [Caldivirga
           maquilingensis IC-167]
          Length = 209

 Score =  162 bits (411), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 39/182 (21%), Positives = 79/182 (43%), Gaps = 3/182 (1%)

Query: 75  CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
             L E+ S + +   C L  +    +        ++M+IG  P   ++ +G+PF G  G 
Sbjct: 11  DELAEINSEVSNCRKCPLYLSRKKAVPGEGNPRAEVMLIGEAPGRVEDETGRPFVGAAGK 70

Query: 135 MLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           +LD++L  I + R  ++I+ +    PP NR+ +  E+  C+P ++RQI ++ P+ ++ +G
Sbjct: 71  LLDELLHEIGVDRGNLYITNVVKCRPPNNRDPTEEEINACKPYLIRQIAVVRPRKIITLG 130

Query: 195 NKTKNFFFNNDAQKTY---QNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
             +     + +        +  GK   +           T HP   +  P ++      L
Sbjct: 131 RHSTRVILSLNGLGFSELAKVRGKVFKVNIAGVNADVYPTYHPAAALYNPSVRNLIKEDL 190

Query: 252 IT 253
             
Sbjct: 191 AK 192


>gi|295317544|gb|ADF97921.1| uracil-DNA glycosylase [Clostridium botulinum F str. 230613]
          Length = 174

 Score =  162 bits (411), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 40/169 (23%), Positives = 70/169 (41%), Gaps = 6/169 (3%)

Query: 94  STSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRT-QIHI 152
               + +         +M IG  P   ++ +G+PF GK G +L K L +++  R    +I
Sbjct: 5   KNRTNMVFGEGNISAPIMFIGEAPGADEDRTGRPFVGKAGQLLTKALLALDFKRDEHYYI 64

Query: 153 SMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQN 212
             +    P  NR     E   C P +  Q+ L+ PKI++ +G     +    +  +  ++
Sbjct: 65  CNVCKCRPENNRTPKEEEAMTCLPYLRNQVALVKPKIMICLGATALKYIMG-EQFRITRD 123

Query: 213 LGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
            GKW            +AT HP  L +    KK  W  L ++++    L
Sbjct: 124 RGKWIE----RKGYYIMATFHPAALFRDESKKKLLWQDLKSIREKYDEL 168


>gi|297527109|ref|YP_003669133.1| phage SPO1 DNA polymerase-related protein [Staphylothermus
           hellenicus DSM 12710]
 gi|297256025|gb|ADI32234.1| phage SPO1 DNA polymerase-related protein [Staphylothermus
           hellenicus DSM 12710]
          Length = 212

 Score =  162 bits (411), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 44/188 (23%), Positives = 87/188 (46%), Gaps = 3/188 (1%)

Query: 74  ACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTG 133
              L  L   ++    C L  +  + +        D+M +G  P   ++ +G+PF G  G
Sbjct: 6   CNELARLAEEIKKCRKCTLYLSRKNAVPGEGPCNADVMFVGEAPGSKEDETGRPFVGAAG 65

Query: 134 NMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFI 193
            +L ++L+ I + R+ ++I+ +    PP NR+ +  E+E C P ++RQI++I PKI++ +
Sbjct: 66  KLLMQLLELIGLKRSDVYITNVVKCRPPNNRDPTPEEIEACSPYLIRQIKIIKPKIIVAL 125

Query: 194 GNKTKNFFF---NNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHA 250
           G  +  F F           +  GK  +       +  +AT HP   +  P ++ +  + 
Sbjct: 126 GRHSARFLFSRAGLKWSNMRRMHGKVFSARIDGVEVKIMATYHPAAALYSPKLRPDLEND 185

Query: 251 LITLKKAL 258
              L+  +
Sbjct: 186 FRVLESLI 193


>gi|146304819|ref|YP_001192135.1| phage SPO1 DNA polymerase-like protein [Metallosphaera sedula DSM
           5348]
 gi|145703069|gb|ABP96211.1| phage SPO1 DNA polymerase-related protein [Metallosphaera sedula
           DSM 5348]
          Length = 211

 Score =  162 bits (410), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 43/184 (23%), Positives = 82/184 (44%), Gaps = 4/184 (2%)

Query: 75  CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
            SL ++ + + + H C L  T    +        D++ +G  P   ++ +G+PF G  G 
Sbjct: 2   SSLQDISNQVIACHKCSLSRTRTHAVPGEGNPTSDVVFVGEAPGAKEDETGRPFVGSAGQ 61

Query: 135 MLDKMLQSI-EIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFI 193
           +L ++++      R++I+I+ I    PP NR+    E+E C P ++ QI LI PK+++ +
Sbjct: 62  LLTELIRKYLRRDRSEIYITNIVKCRPPNNRDPEKEEIEACSPYLLTQIRLIKPKVIVTL 121

Query: 194 GNKTK---NFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHA 250
           G  +                +  GK  +L   +  +    T HP   +  P +K++    
Sbjct: 122 GRHSTGFFQTLAGLPLTPISRCHGKPFHLDLGYGTVTVFPTYHPAAALYNPPLKRDLEED 181

Query: 251 LITL 254
              L
Sbjct: 182 FQRL 185


>gi|225849981|ref|YP_002730215.1| uracil-DNA glycosylase family 4 protein [Persephonella marina
           EX-H1]
 gi|225645579|gb|ACO03765.1| uracil-DNA glycosylase family 4 protein [Persephonella marina
           EX-H1]
          Length = 216

 Score =  162 bits (410), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 45/185 (24%), Positives = 80/185 (43%), Gaps = 5/185 (2%)

Query: 69  SIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPF 128
            I +K   + ++   +++  +C L  +    +         LM IG  P   ++  G+PF
Sbjct: 29  DIKEKEKLMSQINEQIQNCTNCDLYKSRTQAVLGEGNLNAKLMFIGEAPGGEEDKQGRPF 88

Query: 129 SGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPK 188
            G+ G +L K++++    R   +I+ I    PPGNR  +  EME C P + +QIE+I PK
Sbjct: 89  VGRAGKLLTKLIEAAGYRREDFYIANICKCRPPGNRTPTPWEMERCFPYLKKQIEIIDPK 148

Query: 189 ILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTW 248
           +L  +G      F N +     +  G   N            T HP  +++ P  +   +
Sbjct: 149 VLCLLGATAGRAFLNRN-VAITKERGSIINWE----GRILYLTFHPAYVLRNPDAEITLF 203

Query: 249 HALIT 253
             +  
Sbjct: 204 EDIKK 208


>gi|240103871|ref|YP_002960180.1| Uracil-DNA glycosylase [Thermococcus gammatolerans EJ3]
 gi|239911425|gb|ACS34316.1| Uracil-DNA glycosylase [Thermococcus gammatolerans EJ3]
          Length = 196

 Score =  162 bits (410), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 43/188 (22%), Positives = 86/188 (45%), Gaps = 3/188 (1%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           + +L+  +R+   C L     + +  + +    +M +G  P   ++  G PF G+ G +L
Sbjct: 9   MRKLEEKIRNCRKCPLGQLRTNAVPGSGSYDAKVMFVGEAPGYWEDQKGLPFVGRAGKVL 68

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
           D++L+ I + R  ++I+ I    PP NR+ +  E+  C P +  QI++I PK+++ +G  
Sbjct: 69  DELLEGIGLSRDDVYITNIVKCRPPENRDPTEEEIRACSPYLDMQIDIIRPKVIVPLGRH 128

Query: 197 TKNFFF---NNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALIT 253
           +  +       + +   +  GK     T    I  +   HP   +  P +++        
Sbjct: 129 SMGYLLRKFGFEPEPISKIHGKVFRANTLFGRIIIMPMYHPAAALYKPPLREELRKDFEK 188

Query: 254 LKKALKNL 261
           L+K L  L
Sbjct: 189 LRKILNEL 196


>gi|48425936|pdb|1VK2|A Chain A, Crystal Structure Of Uracil-Dna Glycosylase (Tm0511) From
           Thermotoga Maritima At 1.90 A Resolution
          Length = 204

 Score =  162 bits (409), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 35/181 (19%), Positives = 75/181 (41%), Gaps = 5/181 (2%)

Query: 82  SLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQ 141
             ++    C L     + +         ++ +G  P + ++ +G+PF G+ G +L ++L+
Sbjct: 25  ERVKKCTACPLHLNRTNVVVGEGNLDTRIVFVGEGPGEEEDKTGRPFVGRAGXLLTELLR 84

Query: 142 SIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFF 201
              I R  ++I  +    PP NR  +  E   C   ++ QIE+I+P +++ +G    +FF
Sbjct: 85  ESGIRREDVYICNVVKCRPPNNRTPTPEEQAACGHFLLAQIEIINPDVIVALGATALSFF 144

Query: 202 FNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLI--KKNTWHALITLKKALK 259
            +       +  G   +          + T HP  L++      ++     +   K  +K
Sbjct: 145 VDGKKVSITKVRGNPIDWL---GGKKVIPTFHPSYLLRNRSNELRRIVLEDIEKAKSFIK 201

Query: 260 N 260
            
Sbjct: 202 K 202


>gi|242398863|ref|YP_002994287.1| Uracil-DNA glycosylase [Thermococcus sibiricus MM 739]
 gi|242265256|gb|ACS89938.1| Uracil-DNA glycosylase [Thermococcus sibiricus MM 739]
          Length = 194

 Score =  162 bits (409), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 48/191 (25%), Positives = 88/191 (46%), Gaps = 3/191 (1%)

Query: 73  KACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKT 132
           K+ S+  L+  +     C L     + +  + +    +M +G  P   ++  G PF G+ 
Sbjct: 4   KSESMKRLEERIIKCRKCPLGELRTNAVPGSGSYESKVMFVGEGPGYWEDQEGLPFVGRA 63

Query: 133 GNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLF 192
           G +LD++L+SI + R +++I+ I    PP NR+ +  E++ C P +  QI+LI PKI++ 
Sbjct: 64  GKVLDELLESIGLTRDKVYITNIVKCRPPNNRDPTEEEVKACSPYLDMQIDLIRPKIIVP 123

Query: 193 IGNKTKNFFF---NNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWH 249
           +G  +  +       D +   +  GK     T    I  +   HP   +  P +K+    
Sbjct: 124 LGRHSMAYILRKFGFDPEPISKIHGKTFEARTLFGKIVIMPVYHPAVALYRPQLKEELQQ 183

Query: 250 ALITLKKALKN 260
               LK   +N
Sbjct: 184 DFKKLKDFYRN 194


>gi|15643277|ref|NP_228321.1| hypothetical protein TM0511 [Thermotoga maritima MSB8]
 gi|31615491|pdb|1L9G|A Chain A, Crystal Structure Of Uracil-Dna Glycosylase From T.
           Maritima
 gi|4981023|gb|AAD35596.1|AE001727_8 conserved hypothetical protein [Thermotoga maritima MSB8]
          Length = 192

 Score =  162 bits (409), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 35/181 (19%), Positives = 75/181 (41%), Gaps = 5/181 (2%)

Query: 82  SLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQ 141
             ++    C L     + +         ++ +G  P + ++ +G+PF G+ G +L ++L+
Sbjct: 13  ERVKKCTACPLHLNRTNVVVGEGNLDTRIVFVGEGPGEEEDKTGRPFVGRAGMLLTELLR 72

Query: 142 SIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFF 201
              I R  ++I  +    PP NR  +  E   C   ++ QIE+I+P +++ +G    +FF
Sbjct: 73  ESGIRREDVYICNVVKCRPPNNRTPTPEEQAACGHFLLAQIEIINPDVIVALGATALSFF 132

Query: 202 FNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLI--KKNTWHALITLKKALK 259
            +       +  G   +          + T HP  L++      ++     +   K  +K
Sbjct: 133 VDGKKVSITKVRGNPIDWL---GGKKVIPTFHPSYLLRNRSNELRRIVLEDIEKAKSFIK 189

Query: 260 N 260
            
Sbjct: 190 K 190


>gi|148269551|ref|YP_001244011.1| phage SPO1 DNA polymerase-related protein [Thermotoga petrophila
           RKU-1]
 gi|170288227|ref|YP_001738465.1| phage SPO1 DNA polymerase-related protein [Thermotoga sp. RQ2]
 gi|281411730|ref|YP_003345809.1| phage SPO1 DNA polymerase-related protein [Thermotoga naphthophila
           RKU-10]
 gi|147735095|gb|ABQ46435.1| phage SPO1 DNA polymerase-related protein [Thermotoga petrophila
           RKU-1]
 gi|170175730|gb|ACB08782.1| phage SPO1 DNA polymerase-related protein [Thermotoga sp. RQ2]
 gi|281372833|gb|ADA66395.1| phage SPO1 DNA polymerase-related protein [Thermotoga naphthophila
           RKU-10]
          Length = 193

 Score =  162 bits (409), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 35/181 (19%), Positives = 74/181 (40%), Gaps = 5/181 (2%)

Query: 82  SLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQ 141
             ++    C L     + +         ++ +G  P + ++ +G+PF G+ G +L ++L+
Sbjct: 13  ERVKKCTACPLHLNRTNVVVGEGNLDTRIVFVGEGPGEEEDKTGRPFVGRAGMLLTELLR 72

Query: 142 SIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFF 201
              I R  ++I  +    PP NR  +  E   C   ++ QIE+I+P +++ +G    +F 
Sbjct: 73  ESGIRREDVYICNVVKCRPPNNRTPTPEEQAACGHFLLAQIEIINPDVIVALGATALSFL 132

Query: 202 FNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLI--KKNTWHALITLKKALK 259
            +       +  G   +          + T HP  L++      +K     +   K  +K
Sbjct: 133 MDGKKVSITKIRGNPIDWLAGK---KVIPTFHPSYLLRNRSNELRKIVLEDIEKAKSFIK 189

Query: 260 N 260
            
Sbjct: 190 K 190


>gi|11499858|ref|NP_071102.1| DNA polymerase [Archaeoglobus fulgidus DSM 4304]
 gi|2648243|gb|AAB88977.1| DNA polymerase, bacteriophage-type [Archaeoglobus fulgidus DSM
           4304]
          Length = 199

 Score =  161 bits (408), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 42/183 (22%), Positives = 84/183 (45%), Gaps = 3/183 (1%)

Query: 75  CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
            SL ++   + S   C L  T  + +     E  +++ +G  P   +++ G+PF G  G 
Sbjct: 2   ESLDDIVREIMSCRKCDLHKTKTNYVPGVGNEKAEIVFVGEAPGRDEDLKGEPFVGAAGK 61

Query: 135 MLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           +L +ML SI + R  ++I+ +    PP NR+ +  E+E C   ++RQ+E I P +++ +G
Sbjct: 62  LLTEMLASIGLRREDVYITNVLKCRPPNNRDPTPEEVEKCGDYLVRQLEAIRPNVIVCLG 121

Query: 195 NKTKNF---FFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
                F    F+ +     +  GK   +      +  +A  HP  ++  P +++      
Sbjct: 122 RFAAQFIFNLFDLEFTTISRVKGKVYEVERWGKKVKVIAIYHPAAVLYRPQLREEYESDF 181

Query: 252 ITL 254
             +
Sbjct: 182 KKI 184


>gi|218516704|ref|ZP_03513544.1| probable DNA-directed DNA polymerase protein (uracil-DNA
           glycosylase) [Rhizobium etli 8C-3]
          Length = 183

 Score =  161 bits (408), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 66/179 (36%), Positives = 105/179 (58%), Gaps = 1/179 (0%)

Query: 83  LLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQS 142
            + +F+ C+L  ++ STI A+      +M+IG  PS  D+  G PFSGK+G + DKML +
Sbjct: 1   AIEAFNGCNLKHSARSTIFASGDAESGIMVIGSAPSAEDDREGLPFSGKSGQLFDKMLAA 60

Query: 143 IEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFF 202
           I + R+ + ++ + PW PPGNR  S  E++ICRP I RQI L  P+ +L +GN    FF 
Sbjct: 61  IGLNRSSVLLTQVIPWRPPGNRAASAAEIDICRPFIERQIALAEPQAILLLGNFAARFFL 120

Query: 203 NNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
             +        G+W ++      IP +A++HPQ+L+  P+ K+  W+ L+  +  LK+L
Sbjct: 121 GENDTIHG-LRGRWKDIVIADRAIPAIASLHPQDLLTAPVNKRLAWNDLLAFQAKLKSL 178


>gi|303242850|ref|ZP_07329314.1| phage SPO1 DNA polymerase-related protein [Acetivibrio
           cellulolyticus CD2]
 gi|302589596|gb|EFL59380.1| phage SPO1 DNA polymerase-related protein [Acetivibrio
           cellulolyticus CD2]
          Length = 189

 Score =  161 bits (408), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 47/186 (25%), Positives = 85/186 (45%), Gaps = 5/186 (2%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +  EL +     ++C L     + +         L++IG  P + +++ G PF G  G +
Sbjct: 3   NWEELINSCTGCYNCQLGRKRNNIVIGRGNRNASLLMIGEGPGEQEDLQGLPFVGAAGKL 62

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           LD +L++  I   Q +I+ +    PPGNR  ++ E E C P +  Q+ LI PKI++ +G 
Sbjct: 63  LDLLLKAQMIKEDQYYIANVVKCRPPGNRVPTDEEAEKCLPYLRNQVYLIKPKIIVCLGA 122

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
               +  + +A +  Q  G+W            + T HP  L++    K   W  +  +K
Sbjct: 123 TAMKYVVDKNA-RITQIRGQWIE----RKGYWIMPTFHPAALLRDESKKILMWEDIKKVK 177

Query: 256 KALKNL 261
           + +  L
Sbjct: 178 QRMDCL 183


>gi|126466206|ref|YP_001041315.1| phage SPO1 DNA polymerase-related protein [Staphylothermus marinus
           F1]
 gi|126015029|gb|ABN70407.1| phage SPO1 DNA polymerase-related protein [Staphylothermus marinus
           F1]
          Length = 212

 Score =  161 bits (408), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 43/195 (22%), Positives = 89/195 (45%), Gaps = 3/195 (1%)

Query: 70  IAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFS 129
            +     L +L   ++    C L  +  + +        ++M +G  P   ++  G+PF 
Sbjct: 2   ASNDCAELTKLAEEIKKCQKCPLHLSRKNAVPGEGPCNAEIMFVGEAPGSKEDEIGRPFV 61

Query: 130 GKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKI 189
           G  G +L ++L+ I + R  ++I+ +    PP NR+ +  E+E C P ++RQI++I PKI
Sbjct: 62  GAAGKLLTQLLELIGLKRPDVYITNVVKCRPPNNRDPTPEEIEACSPYLIRQIKIIKPKI 121

Query: 190 LLFIGNKTKNFFF---NNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKN 246
           ++ +G  +  F F              GK  +       +  +AT HP   +  P ++  
Sbjct: 122 IVALGRHSARFLFSRAGLKWSNMKAMHGKVFSARIDGVEVKIMATYHPAAALYSPKLRPE 181

Query: 247 TWHALITLKKALKNL 261
             +    L++ ++++
Sbjct: 182 LENDFHVLERLIQDI 196


>gi|332295615|ref|YP_004437538.1| phage SPO1 DNA polymerase-related protein [Thermodesulfobium
           narugense DSM 14796]
 gi|332178718|gb|AEE14407.1| phage SPO1 DNA polymerase-related protein [Thermodesulfobium
           narugense DSM 14796]
          Length = 209

 Score =  161 bits (408), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 46/189 (24%), Positives = 89/189 (47%), Gaps = 10/189 (5%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L ++    ++   C L  T ++ +        D+M+IG  P ++++I G PF GK G +L
Sbjct: 25  LSDILIEAKNCKKCKLSETRINVVFGEGPMNPDIMVIGEGPGETEDIQGLPFVGKAGQLL 84

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
            K+ +S+ + R  I+I+ +    PPGNRN    E+E CRP +  QI++++PKI++ +G  
Sbjct: 85  TKIFESVSLNRKDIYITNVVKCRPPGNRNPLPEEIEQCRPFLDAQIKILNPKIIILLGAV 144

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLI-----KKNTWHAL 251
                   +     +  G+       +     +   HP  L++         +  TW  +
Sbjct: 145 ACKTILK-NFSSITKIRGEIILQDNRYY----IPMFHPSYLLRNASRSIGSPRWLTWKDI 199

Query: 252 ITLKKALKN 260
             +K+ ++ 
Sbjct: 200 QKVKQFIEE 208


>gi|168187460|ref|ZP_02622095.1| uracil-DNA glycosylase family 4 protein [Clostridium botulinum C
           str. Eklund]
 gi|169294650|gb|EDS76783.1| uracil-DNA glycosylase family 4 protein [Clostridium botulinum C
           str. Eklund]
          Length = 185

 Score =  161 bits (408), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 44/186 (23%), Positives = 77/186 (41%), Gaps = 6/186 (3%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
             EL       H C+L     + +         LM IG  P   ++ +G+PF G+ GN+L
Sbjct: 4   WRELYKECVECHKCNLVEGRNNMVFGEGNPKAKLMFIGEAPGADEDRTGRPFVGRAGNLL 63

Query: 137 DKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
            K L ++++ R    +I+ I    P  NRN    E   C   +  Q+ LI P+I++ +G 
Sbjct: 64  TKGLMALDLHREKDYYITNICKCRPENNRNPMEHEAYACIQYLRNQVALIKPEIIVCLGA 123

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
               +  + D  +  ++ G W         I  +   HP  +++    K   W  L  +K
Sbjct: 124 VAGKYIIDKDL-RITRDRGMWVE----KKGIYIMPIFHPAAILRDDKKKVMFWKDLKEIK 178

Query: 256 KALKNL 261
           +    +
Sbjct: 179 RKYLEI 184


>gi|119872232|ref|YP_930239.1| phage SPO1 DNA polymerase-related protein [Pyrobaculum islandicum
           DSM 4184]
 gi|119673640|gb|ABL87896.1| phage SPO1 DNA polymerase-related protein [Pyrobaculum islandicum
           DSM 4184]
          Length = 193

 Score =  161 bits (407), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 42/179 (23%), Positives = 79/179 (44%), Gaps = 3/179 (1%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
            L +L   ++    C L     + +    +    +MI+G  P  S++  G+PF G  G +
Sbjct: 2   DLEDLNEKIKRCTRCPLHLYRKNAVPGEGSLKLGIMIVGEAPGASEDEEGRPFVGVAGQL 61

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           L K L  + I R  ++I+ +    PPGNR  +  E+E C P +++QI ++ PK ++ +G 
Sbjct: 62  LTKTLAKLGISRDDVYITNVVKCRPPGNRTPTREEIEACLPYLLQQIVILKPKRIVALGL 121

Query: 196 KTKNFFF---NNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
            +          +  K     GK          +    T HP  +++ P +++   + L
Sbjct: 122 ISGKTLLKLVGREVDKIGNVRGKCFRGQVAGVNLEICLTYHPAAVLRNPHLREVFENDL 180


>gi|268679863|ref|YP_003304294.1| phage SPO1 DNA polymerase-related protein [Sulfurospirillum
           deleyianum DSM 6946]
 gi|268617894|gb|ACZ12259.1| phage SPO1 DNA polymerase-related protein [Sulfurospirillum
           deleyianum DSM 6946]
          Length = 220

 Score =  161 bits (407), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 51/189 (26%), Positives = 94/189 (49%), Gaps = 5/189 (2%)

Query: 71  AQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSG 130
           +  +C+L ELK+ +   H C L  +  + I         +M IG  PS S++ +G  FSG
Sbjct: 36  SALSCNLEELKATVAQCHLCALSKSRKNIIFGAGNLKAKVMFIGDNPSVSEDETGMLFSG 95

Query: 131 KTGNMLDKMLQSI-EIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKI 189
           K+G +L KM++++  I + +++++ I     P NR  +  E+  C+P +M+QI+LI PKI
Sbjct: 96  KSGELLAKMIENVLLIPKEEVYVTHILKCKTPENRVPTPEEVACCKPYMMQQIQLIQPKI 155

Query: 190 LLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWH 249
           ++ +G+ + +              G   +          + T HP  L++ P  KK  + 
Sbjct: 156 IVTLGSTSFHHLTGEYETPMDTIRGSVLHF----GEAKLIPTFHPNFLLRNPSAKKEVYA 211

Query: 250 ALITLKKAL 258
            L+ ++  L
Sbjct: 212 DLLKVRSML 220


>gi|206896457|ref|YP_002247082.1| DNA polymerase, bacteriophage-type [Coprothermobacter proteolyticus
           DSM 5265]
 gi|206739074|gb|ACI18152.1| DNA polymerase, bacteriophage-type [Coprothermobacter proteolyticus
           DSM 5265]
          Length = 186

 Score =  161 bits (406), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 37/183 (20%), Positives = 74/183 (40%), Gaps = 4/183 (2%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
             EL+    +   C LC T  + +  +      L ++G  P  +++  G PF G+ G +L
Sbjct: 6   WKELEQFALNCKACELCKTRRNVVFGSGDPNSRLWLVGEAPGSNEDEQGLPFVGQAGAIL 65

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
           D  L+     R  + I+ +    PP N + +  +   C PI+  Q+ +  PK +L +G  
Sbjct: 66  DTFLEKNGFKRHSLFITNVIKCRPPNNADPTEDQKSNCFPILAAQLAIGKPKYILALGRH 125

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
               F     +   +  G+             + T HP  +++ P + +   H +  + +
Sbjct: 126 AAEAFVPKPFRSIKEIRGQV----VLSGETKVVVTYHPAAVLRNPRLGEIVEHDIQMMSR 181

Query: 257 ALK 259
            + 
Sbjct: 182 LIA 184


>gi|139439476|ref|ZP_01772908.1| Hypothetical protein COLAER_01933 [Collinsella aerofaciens ATCC
           25986]
 gi|133775029|gb|EBA38849.1| Hypothetical protein COLAER_01933 [Collinsella aerofaciens ATCC
           25986]
          Length = 206

 Score =  161 bits (406), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 44/189 (23%), Positives = 83/189 (43%), Gaps = 5/189 (2%)

Query: 71  AQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSG 130
           A +  +L E++++L   H C L  +  + +         +M IG  P  ++++ G+PF G
Sbjct: 13  APREVALEEIEAVLGDCHLCQLYQSRHNIVFGVGNPRARVMFIGEAPGRNEDLQGEPFVG 72

Query: 131 KTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKIL 190
             G  L+ +L    + R  ++I+ +    PPGNRN    E+  C P +  QI  I P I+
Sbjct: 73  AAGEDLNGILSLAGLKREDVYIANVLKCRPPGNRNPRPEEVLACSPFLREQIRSIWPDII 132

Query: 191 LFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHA 250
           + +GN   +F    +     +  G++  +         + T HP   ++ P  ++     
Sbjct: 133 VTLGNPATHFVLKTE-IGITKLRGRFHQM----GHFVVMPTFHPAAALRNPAWQELLEED 187

Query: 251 LITLKKALK 259
              L   L+
Sbjct: 188 FKMLGDYLE 196


>gi|225619055|ref|YP_002720281.1| uracil-DNA glycosylase [Brachyspira hyodysenteriae WA1]
 gi|225213874|gb|ACN82608.1| uracil-DNA glycosylase [Brachyspira hyodysenteriae WA1]
          Length = 249

 Score =  160 bits (405), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 42/191 (21%), Positives = 81/191 (42%), Gaps = 2/191 (1%)

Query: 73  KACSLHELKSLLRSFHDCH-LCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGK 131
           K   L ++ S +     C  LC++ L+ +     E  D++ +G  P   ++  G PF G+
Sbjct: 56  KNEELKKIYSEVEKCMKCEALCNSRLNVVFGRGDEEPDIVFVGEAPGADEDKQGLPFVGR 115

Query: 132 TGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILL 191
            G +LDK ++ + I   + +I       PP NR+    E   CR   + Q+++++PKI+ 
Sbjct: 116 GGKLLDKWIERMNINNKKYYIMNALKCRPPENRDPLPEEKSNCRDYFVNQLKILNPKIIC 175

Query: 192 FIGNKTKNFFFNND-AQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHA 250
            +G        + D      +   K          +P +AT HP  +++    +      
Sbjct: 176 ALGRHGFGNLIDFDLKTPFGKARNKVHYYNNNGKDVPVIATYHPAYILRNQKEEDKVIAD 235

Query: 251 LITLKKALKNL 261
           L  +   L+ +
Sbjct: 236 LEFMLNELEKI 246


>gi|269986729|gb|EEZ93009.1| phage SPO1 DNA polymerase-related protein [Candidatus Parvarchaeum
           acidiphilum ARMAN-4]
          Length = 189

 Score =  160 bits (405), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 48/187 (25%), Positives = 85/187 (45%), Gaps = 1/187 (0%)

Query: 75  CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
            SL+++   +     C LC    + +     E  D+++IG  P  ++++ G+PF G +G 
Sbjct: 2   ESLNDISKEIVKCTLCELCLKRTNAVPGEGNEKADIVVIGEAPGKNEDLQGRPFIGMSGK 61

Query: 135 MLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
            L K L+S+ I R  + I+      PP NR     E++ CR  ++RQ+  I+PK++L +G
Sbjct: 62  FLTKNLESLNIKRDSVFITNAVKCRPPNNRKPKKEELDKCRSYLVRQLSSINPKLILALG 121

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITL 254
                     + +   +  GK  ++         L T HP   +++P  +K     L   
Sbjct: 122 TSAATS-LGIEFKHLSEIKGKVIDISLNGKKFKCLVTFHPSFPMRFPSARKAFLSDLSMA 180

Query: 255 KKALKNL 261
               KNL
Sbjct: 181 FNLYKNL 187


>gi|15896249|ref|NP_349598.1| Uracil-DNA glycosylase [Clostridium acetobutylicum ATCC 824]
 gi|15026053|gb|AAK80938.1|AE007796_8 Uracil-DNA glycosylase [Clostridium acetobutylicum ATCC 824]
 gi|325510404|gb|ADZ22040.1| Uracil-DNA glycosylase [Clostridium acetobutylicum EA 2018]
          Length = 206

 Score =  160 bits (405), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 49/207 (23%), Positives = 76/207 (36%), Gaps = 26/207 (12%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
             EL +       C L     + +         LM +G  P   ++  G+PF G+ G +L
Sbjct: 4   WRELYNECIECQKCRLGENRTNMVFGEGNPEAKLMFVGEAPGADEDRLGRPFVGRAGQLL 63

Query: 137 DKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
            K L ++ + R    +I+ +    P  NR     E E C P +  Q  LI PKIL+ +G+
Sbjct: 64  TKGLTALNLSRDRDYYIANVCKCRPEKNRTPYEDEAEACMPYLRNQFALIKPKILVCLGS 123

Query: 196 KTKNFFF---------------------NNDAQKTYQNLGKWSNLCTPHSIIPTLATVHP 234
               F                        N   +  ++ GKW  +      I  +AT HP
Sbjct: 124 TAMKFIMEPALNKILQQNNTIEEENLIWKNGQMRITRDRGKWLKV----KGIYMMATFHP 179

Query: 235 QELIQYPLIKKNTWHALITLKKALKNL 261
             L +    K   W  L  +K    +L
Sbjct: 180 AALFRDENKKTAFWEDLKLIKAKYVDL 206


>gi|289548718|ref|YP_003473706.1| phage SPO1 DNA polymerase-related protein [Thermocrinis albus DSM
           14484]
 gi|289182335|gb|ADC89579.1| phage SPO1 DNA polymerase-related protein [Thermocrinis albus DSM
           14484]
          Length = 217

 Score =  160 bits (405), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 40/190 (21%), Positives = 81/190 (42%), Gaps = 2/190 (1%)

Query: 71  AQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSG 130
           ++K  +L EL   + +   C     S   +         ++ +G  P + ++   +PF G
Sbjct: 29  SEKKMALAELYRTMEAEGRCVRYEGSNGYVLGEGNPCSPVIFVGEAPGEEEDRQRRPFVG 88

Query: 131 KTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKIL 190
           + G  L+  L+ + + R  ++I+ +    PPGNR  +  E+  C   + ++IE+I PK++
Sbjct: 89  RAGQYLNAKLEEVGLRRQDVYITNVVKSRPPGNRTPTAQEIASCVSYLRKEIEIIKPKVI 148

Query: 191 LFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHA 250
           + +G+               +  G+        S I  L T HP  +++ P   +     
Sbjct: 149 VCLGSTALEGVMGRK-MPVTKARGQIFTYPF-DSGIKVLLTYHPAYVLRNPSADREFTQD 206

Query: 251 LITLKKALKN 260
           L  L + L +
Sbjct: 207 LKKLLEILSS 216


>gi|302348684|ref|YP_003816322.1| Uracil-DNA glycosylase [Acidilobus saccharovorans 345-15]
 gi|302329096|gb|ADL19291.1| Uracil-DNA glycosylase [Acidilobus saccharovorans 345-15]
          Length = 213

 Score =  160 bits (404), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 36/190 (18%), Positives = 76/190 (40%), Gaps = 3/190 (1%)

Query: 66  QADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISG 125
              S+  K  S  ++   +R+   C L     + +         +M++G  P  +++  G
Sbjct: 2   SPVSLDNKKASYDDIAERVRNCKACPLHRLRTNAVPGEGNLSAKIMLVGEAPGKNEDEQG 61

Query: 126 KPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELI 185
           +PF G  G +L  +L+   + R  ++I+ +    PP NR  +  E+  C   +  +I L+
Sbjct: 62  RPFVGAAGQLLSSLLEQAGLRRQDVYITNVVKCRPPNNRTPTEDEVAACIGFLKEEISLV 121

Query: 186 SPKILLFIGNKTKNFFF---NNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPL 242
            PK+++ +GN   +          +      G+   +      +  + T HP   +  P 
Sbjct: 122 RPKVIVALGNTAGSALMSLAGKQWRGVTAERGRKVKVSIGGVELTVIPTYHPAAALYKPD 181

Query: 243 IKKNTWHALI 252
           +K      + 
Sbjct: 182 LKDYLAKDIK 191


>gi|332654096|ref|ZP_08419840.1| arginine biosynthesis bifunctional protein ArgJ [Ruminococcaceae
           bacterium D16]
 gi|332517182|gb|EGJ46787.1| arginine biosynthesis bifunctional protein ArgJ [Ruminococcaceae
           bacterium D16]
          Length = 188

 Score =  160 bits (404), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 49/187 (26%), Positives = 89/187 (47%), Gaps = 6/187 (3%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
              EL+    S   C L  T  + +  T     ++M+IG  P +++++ G PF G+ G +
Sbjct: 2   DWKELEQECLSCQKCALSQTRHNVVFGTGPRDAEVMLIGEGPGENEDLQGLPFVGRGGKL 61

Query: 136 LDKMLQSIEIMRTQI-HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           LD ML+ I++ R +  +I+ +    PP NR+  N E + C   +  Q+ LI PKI++ +G
Sbjct: 62  LDDMLEVIDLSREKNVYIANMVKCRPPQNRDPLNTEQDACIGYLRNQVALIRPKIIVCLG 121

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITL 254
                     D  K  +  G+W       S +  +A  HP  +++ P  +  T+  L  L
Sbjct: 122 RIAAMRLIKPD-FKITKEHGQWFE----KSGVQMMALFHPAAILRDPRRRPETFEDLKRL 176

Query: 255 KKALKNL 261
           +  ++ +
Sbjct: 177 QAKIQEI 183


>gi|294505841|ref|YP_003569899.1| DNA polymerase-related protein,bacteriophage-type [Salinibacter
           ruber M8]
 gi|294342169|emb|CBH22947.1| DNA polymerase-related protein,bacteriophage-type [Salinibacter
           ruber M8]
          Length = 287

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 52/213 (24%), Positives = 93/213 (43%), Gaps = 5/213 (2%)

Query: 49  AIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQ 108
             +  +         +   D+  + A +L E++          +     + +        
Sbjct: 76  PAEDPSLPPPERIEALIPDDAPYKDADTLEEVEQYFADNVLVPIDEDRENPVFGVGDPEA 135

Query: 109 DLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSN 168
           DL+IIG  P  +++  G+PF G+ G +LDK+L +I   R  ++I+ I    PP NRN  +
Sbjct: 136 DLVIIGEAPGRNEDEEGEPFVGRAGQLLDKILDAINFEREDVYITNILKSRPPRNRNPKS 195

Query: 169 IEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPT 228
            E++   P++ +QI L+ PKI+L +G    N   +        +L    +       IP 
Sbjct: 196 EEIDAHLPVLYKQIALLRPKIILTVGKVAGNTLLDR-----SSSLSNLRDQEHDFYGIPL 250

Query: 229 LATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
           +AT HP  L++    K+ TW  +  L+     L
Sbjct: 251 MATYHPAALLRNSQWKRPTWEDVKLLRTRYDQL 283


>gi|126180274|ref|YP_001048239.1| phage SPO1 DNA polymerase-related protein [Methanoculleus
           marisnigri JR1]
 gi|125863068|gb|ABN58257.1| phage SPO1 DNA polymerase-related protein [Methanoculleus
           marisnigri JR1]
          Length = 219

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 43/193 (22%), Positives = 85/193 (44%), Gaps = 3/193 (1%)

Query: 71  AQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSG 130
           A    ++ EL +++     C L   +   +        DLM+IG  P   ++++G+PF G
Sbjct: 19  AGGEAAIEELAAVIGECRKCLLWENTHHAVPGEGNPRADLMLIGEAPGKQEDLTGRPFVG 78

Query: 131 KTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKIL 190
           + G +L+ +L  I + R  + I+ I    PPGNR+    E+  C P +  QI +I PK++
Sbjct: 79  RAGKLLEGLLSGIGLSRDDVFIANIVKHRPPGNRDPGEEEIRACTPYLEEQIRIIGPKVI 138

Query: 191 LFIGNKTKN---FFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNT 247
           + +G  +      F   +  +  +  G           +  + T+HP   +  P  +++ 
Sbjct: 139 VMLGRHSSRYILSFLPVEFDRITEIRGTVYPGLLFGHPVRLIPTLHPAAALYNPRYRESL 198

Query: 248 WHALITLKKALKN 260
               + + + L  
Sbjct: 199 EEDFLIIGRELAE 211


>gi|295100441|emb|CBK97986.1| uracil-DNA glycosylase, family 4 [Faecalibacterium prausnitzii
           L2-6]
          Length = 188

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 47/187 (25%), Positives = 82/187 (43%), Gaps = 6/187 (3%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
               LK+   +   C L +T  + +     E  +++ +G  P  S++  G PF G++G +
Sbjct: 2   DWETLKTDCLACQRCPLHTTRHNVVFGQGVENAEVLFVGEGPGQSEDEQGLPFVGRSGQL 61

Query: 136 LDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           LDK L +I++ R +  +I+ I    PP NR+    E E C P +  Q  L+ PKI++ +G
Sbjct: 62  LDKYLFAIDLDRASNCYIANIVKCRPPQNRDPLPAESEACMPWLREQFRLLRPKIVVCLG 121

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITL 254
                     D   T     K        + I  + T HP  L++ P  K   +   + L
Sbjct: 122 RIAAQRMIRADFSVT-----KEHGTFIEKNGILFMGTFHPAALLRQPQNKPEAFGDFVAL 176

Query: 255 KKALKNL 261
           +  +  +
Sbjct: 177 RDKIHEV 183


>gi|83816180|ref|YP_444183.1| uracil-DNA glycosylase [Salinibacter ruber DSM 13855]
 gi|83757574|gb|ABC45687.1| uracil-DNA glycosylase, family 4 [Salinibacter ruber DSM 13855]
          Length = 287

 Score =  159 bits (403), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 52/213 (24%), Positives = 93/213 (43%), Gaps = 5/213 (2%)

Query: 49  AIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQ 108
             +  +         +   D+  + A +L E++          +     + +        
Sbjct: 76  PAEDPSLPPPERIEALIPDDAPYKDADTLEEVEQYFADNVLVPIDEDRENPVFGVGDPEA 135

Query: 109 DLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSN 168
           DL+IIG  P  +++  G+PF G+ G +LDK+L +I   R  ++I+ I    PP NRN  +
Sbjct: 136 DLVIIGEAPGRNEDEEGEPFVGRAGQLLDKILDAINFEREDVYITNILKSRPPRNRNPKS 195

Query: 169 IEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPT 228
            E++   P++ +QI L+ PKI+L +G    N   +        +L    +       IP 
Sbjct: 196 EEIDAHLPVLYKQIALLRPKIILTVGKVAGNTLLDR-----SSSLSNLRDQEHDFYGIPL 250

Query: 229 LATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
           +AT HP  L++    K+ TW  +  L+     L
Sbjct: 251 MATYHPAALLRNSQWKRPTWEDVKLLRTRYDQL 283


>gi|163782570|ref|ZP_02177567.1| N-terminus of phage SPO1 DNA polymerase [Hydrogenivirga sp.
           128-5-R1-1]
 gi|159882143|gb|EDP75650.1| N-terminus of phage SPO1 DNA polymerase [Hydrogenivirga sp.
           128-5-R1-1]
          Length = 220

 Score =  159 bits (403), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 36/178 (20%), Positives = 73/178 (41%), Gaps = 3/178 (1%)

Query: 82  SLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQ 141
              +    C L       +         ++ +G  P + ++  G+PF G+ G  L+K ++
Sbjct: 43  DSFKDCAKCELHRNRTQVVFGDGNPYSPVVFVGEAPGEDEDRQGRPFVGRAGKYLNKKIE 102

Query: 142 SI-EIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNF 200
            +  + R +++I+ +    PPGNR  +  E+  C P + ++I++I PK++  +G      
Sbjct: 103 EVLGLRREEVYITNVCKCRPPGNRKPTPAEISACFPYLKKEIDIIKPKVICCLGATAGEG 162

Query: 201 FFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
                     +  GK          I  L T HP  +++ P         +  LK+ +
Sbjct: 163 ILG-KKLSITKVRGKNVPYPYDP-SITVLLTYHPAYILRNPRADGEFTEDMERLKELI 218


>gi|300871218|ref|YP_003786091.1| uracil DNA glycosylase [Brachyspira pilosicoli 95/1000]
 gi|300688919|gb|ADK31590.1| uracil DNA glycosylase [Brachyspira pilosicoli 95/1000]
          Length = 236

 Score =  159 bits (403), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 48/190 (25%), Positives = 85/190 (44%), Gaps = 6/190 (3%)

Query: 73  KACSLHELKSLLRSFHDCH-LCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGK 131
           K   L +L   +     C  LCST  + +     E  D++ +G  P   ++  G PF G+
Sbjct: 51  KNEELKKLYQTITKCMKCEALCSTRKNVVFGRGDEKPDIVFVGEAPGADEDKLGFPFVGR 110

Query: 132 TGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILL 191
            G +LDK ++ + I     +I       PP NR+    E + CR    +Q+E+++PKI+ 
Sbjct: 111 AGKLLDKWIEKLNIS--NYYIMNALKCRPPENRDPLLEEKDNCREFFTKQLEILNPKIIC 168

Query: 192 FIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
            +G    +   + D +      GK  N    ++ IP +AT HP  +++    +      L
Sbjct: 169 ALGRHGFSNLVDFDLKT---PFGKVRNNIHYYNNIPVIATYHPAYILRNQKEEIKVIEDL 225

Query: 252 ITLKKALKNL 261
             + + L+ L
Sbjct: 226 EFMMRELEKL 235


>gi|254432687|ref|ZP_05046390.1| bacteriophage-type DNA polymerase N-terminal domain protein
           [Cyanobium sp. PCC 7001]
 gi|197627140|gb|EDY39699.1| bacteriophage-type DNA polymerase N-terminal domain protein
           [Cyanobium sp. PCC 7001]
          Length = 243

 Score =  159 bits (402), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 53/237 (22%), Positives = 88/237 (37%), Gaps = 12/237 (5%)

Query: 31  PNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDC 90
           P    T E+ + +           +        +       +    L  + +   +   C
Sbjct: 2   PPPPTTGETGQPDLFGPLTPSAGPSAGPASGSGLPAV----EPDLDLAGVAAACAACRRC 57

Query: 91  HLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIM-RTQ 149
            L +T    + +       LM+IG  P   ++ SG+PF G+ G +LD+ML S+ I     
Sbjct: 58  GLAATRQHVVVSRGDPAARLMVIGEGPGAQEDASGQPFVGRAGQLLDQMLASVGIDSNRD 117

Query: 150 IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKT 209
            +I  +    PP NR  +  EM  CRP + RQI+L  P ++L  G               
Sbjct: 118 AYICNVVKCRPPENRKPTPAEMAACRPWLDRQIQLNDPAVILLAGATAMEGVLGVKG-GI 176

Query: 210 YQNLGKWSNLCTPHS-IIPTLATVHPQELIQYPLI-----KKNTWHALITLKKALKN 260
            +  G+W     P       +   HP  L++ P       K  TW  L  +++ L  
Sbjct: 177 TRLRGQWRQGSGPVLAGRWLMPIFHPSYLLRNPSRQSGSPKWLTWQDLQDVRRRLDQ 233


>gi|116327183|ref|YP_796903.1| Uracil-DNA glycosylase [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116332165|ref|YP_801883.1| Uracil-DNA glycosylase [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
 gi|116119927|gb|ABJ77970.1| Uracil-DNA glycosylase [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116125854|gb|ABJ77125.1| Uracil-DNA glycosylase [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
          Length = 202

 Score =  159 bits (402), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 45/198 (22%), Positives = 91/198 (45%), Gaps = 16/198 (8%)

Query: 72  QKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGK 131
           +K   L  ++S + +   C L +T   T+         ++ IG  P   ++++G+PF G+
Sbjct: 5   EKLRRLDLIQSEVFACKLCKLHTTRTRTVFGEGNPDSKVVFIGEGPGKQEDLTGRPFVGR 64

Query: 132 TGNMLDKMLQS-IEIMRTQIHISMISPWHP------PGNRNLSNIEMEICRPIIMRQIEL 184
            G +L ++++  +++ R  ++I+ I    P        +R   + E   C P ++RQ+E+
Sbjct: 65  AGELLTRIIEKGMKVPRESVYIANIVKCRPTVDMKFEKDRPPEDEETRACAPYLLRQLEI 124

Query: 185 ISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPL-- 242
           I PK+++ +GN +  F  N   +   +  G W         IP + T HP  +I+     
Sbjct: 125 IQPKVIVTLGNPSTRFILNTK-EGITKLRGTWGTFF----GIPVMPTYHPSFVIRNGGEN 179

Query: 243 --IKKNTWHALITLKKAL 258
             +K+  W  +  +   L
Sbjct: 180 SPLKREVWEDIKKVMDLL 197


>gi|217967775|ref|YP_002353281.1| phage SPO1 DNA polymerase-related protein [Dictyoglomus turgidum
           DSM 6724]
 gi|217336874|gb|ACK42667.1| phage SPO1 DNA polymerase-related protein [Dictyoglomus turgidum
           DSM 6724]
          Length = 210

 Score =  159 bits (402), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 40/190 (21%), Positives = 75/190 (39%), Gaps = 5/190 (2%)

Query: 72  QKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGK 131
            K   L  L+       +C L     + +         +M +G  P   ++  GKPF G 
Sbjct: 5   NKVGKLEILRREAEGCRNCSLWQERTNLVFGEGNPDAFIMFVGEAPGFHEDQQGKPFVGA 64

Query: 132 TGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILL 191
            G +L ++++SI + R  ++I+ +    PP NR     E+ +C P + +QIE+I+PKI+ 
Sbjct: 65  AGKLLTELIESIGLKREDVYIANVLKCRPPNNREPLPEEIRVCFPFLRQQIEIINPKIIC 124

Query: 192 FIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
            +G         +    +                     T HP   + +  + +N     
Sbjct: 125 TLGRYAAYAILGHSVNISTS-----HGKDYYVDGRRVFVTYHPAAALYHGKLLENIKKDF 179

Query: 252 ITLKKALKNL 261
             LK+  + +
Sbjct: 180 EKLKELYEAV 189


>gi|113955244|ref|YP_730877.1| uracil-DNA glycosylase [Synechococcus sp. CC9311]
 gi|113882595|gb|ABI47553.1| Uracil-DNA glycosylase [Synechococcus sp. CC9311]
          Length = 201

 Score =  159 bits (401), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 46/190 (24%), Positives = 78/190 (41%), Gaps = 11/190 (5%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           SL +LK+       C L       + +       LM+IG  P   ++  G+PF G++G +
Sbjct: 4   SLEDLKASCLQCQRCDLAKERKHVVVSRGHPSARLMVIGEAPGADEDAQGRPFVGRSGRL 63

Query: 136 LDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           LD  L  + + +    +I  +    PPGNR  +  E++ CRP + RQI  ++P+IL  +G
Sbjct: 64  LDACLTEVGLDQADDTYICNLIKCRPPGNRRPTPAELKACRPWLDRQILEVNPEILFILG 123

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKK-----NTWH 249
                           +  G W+           + + HP  L++ P  +          
Sbjct: 124 ATATATLLECRT-PISRLRGHWTEWKGRC----VMPSFHPSYLLRNPSREPGKPHSLFMA 178

Query: 250 ALITLKKALK 259
            L  +K AL 
Sbjct: 179 DLTHVKHALN 188


>gi|254172784|ref|ZP_04879458.1| uracil-DNA glycosylase [Thermococcus sp. AM4]
 gi|214032940|gb|EEB73768.1| uracil-DNA glycosylase [Thermococcus sp. AM4]
          Length = 194

 Score =  159 bits (401), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 43/188 (22%), Positives = 84/188 (44%), Gaps = 3/188 (1%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           + +L+  +R+   C L     + +  + +    +M +G  P   ++  G PF G+ G +L
Sbjct: 7   MKKLEERIRNCRKCPLGQLRTNAVPGSGSYDAKVMFVGEAPGYWEDQKGLPFVGRAGKVL 66

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
           D++L  I + R  ++I+ I    PP NRN +  E+  C P +  QI++I P++++ +G  
Sbjct: 67  DELLAGIGLSRDDVYITNIVKCRPPENRNPTEEEIRACSPYLDMQIDIIRPRVIVPLGRH 126

Query: 197 TKNFFF---NNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALIT 253
           +  +       + +   +  GK     T    I  +   HP   +  P +++        
Sbjct: 127 SMGYILRKFGFEPEPISKIHGKVFRANTLFGRILIMPMYHPAAALYKPPLREELRKDFEK 186

Query: 254 LKKALKNL 261
           L K L  L
Sbjct: 187 LGKILNEL 194


>gi|254443722|ref|ZP_05057198.1| uracil-DNA glycosylase, family 4, putative [Verrucomicrobiae
           bacterium DG1235]
 gi|198258030|gb|EDY82338.1| uracil-DNA glycosylase, family 4, putative [Verrucomicrobiae
           bacterium DG1235]
          Length = 305

 Score =  158 bits (400), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 57/276 (20%), Positives = 102/276 (36%), Gaps = 26/276 (9%)

Query: 3   SKRILSQEQILTIALFYADSGVYWVFDEPNNEATYESQRKEKS-------IDSAIQPITN 55
           S+  +S   I  +     D GV     E    +  E  R   +        D++ +    
Sbjct: 21  SRVNVSDSAIQALRKRSVDKGVDTSTREAVLSSIPERVRSADAKDFDKVFTDTSTETKRA 80

Query: 56  IRHIHSPLVQQADSI----AQKACSLHELKSLLRSFHDC--HLCSTSLSTICATQTEGQD 109
                 P + +A  +      K      L+  +     C   L       +  +     D
Sbjct: 81  ASQSGGPKLPRAPLVNLVKGDKQAQWEALREQVMGCVVCKGRLKEG-KKLVFGSGNLDAD 139

Query: 110 LMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHP-----PGNR 164
           +   G  P   D  +G PFSG  G++L KM+ ++ + R  ++I+ I  W P      G R
Sbjct: 140 IFFCGEAPGIEDEDTGVPFSGPAGDLLGKMIGAMGLKRGDVYIADIMNWRPEASTERGKR 199

Query: 165 NLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQ-NLGKWSNLCTPH 223
             +  EM  C P +  Q+E++ PK+++ +G             K  +   G+W+      
Sbjct: 200 PPTVEEMNFCMPYLKGQLEIVQPKLIVALGATAVKGLLGAANVKNLRDVKGQWTEFA--- 256

Query: 224 SIIPTLATVHPQELIQYPLI--KKNTWHALITLKKA 257
             +P L T HP  LI+      K++ W   + + + 
Sbjct: 257 -GVPMLPTYHPSYLIRNDTKRDKRSAWEDWLKVMEK 291


>gi|330837396|ref|YP_004412037.1| phage SPO1 DNA polymerase-related protein [Spirochaeta coccoides
           DSM 17374]
 gi|329749299|gb|AEC02655.1| phage SPO1 DNA polymerase-related protein [Spirochaeta coccoides
           DSM 17374]
          Length = 289

 Score =  158 bits (400), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 52/187 (27%), Positives = 85/187 (45%), Gaps = 8/187 (4%)

Query: 73  KACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQD-LMIIGYTPSDSDNISGKPFSGK 131
            +CSL EL +L+ S  +C LC T   T+     E    +M+IG  P   +++SG+PF GK
Sbjct: 95  SSCSLKELSTLVSSCKNCRLCETRTYTVFGEGQEEHPVVMVIGEGPGRDEDLSGRPFVGK 154

Query: 132 TGNMLDKMLQSIEIMRTQI-HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKIL 190
            G  +D+    I + R    +I+ I    PPGNR+    E++ C P + RQI L+ P+++
Sbjct: 155 GGQYMDRWFAPIGVSRQTNAYIANIVKCRPPGNRDPLPDEVQACIPYLRRQIALVQPRVI 214

Query: 191 LFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPL-IKKNTWH 249
           L  G    +              G        +  IP + T HP  +++    ++   W 
Sbjct: 215 LLAGAVAAHAILETKEGV-----GALRGRTFSYMNIPVIVTYHPAGVLRNLDRLRAPVWE 269

Query: 250 ALITLKK 256
            +  L  
Sbjct: 270 DMKRLAS 276


>gi|329902871|ref|ZP_08273281.1| putative DNA polymerase-like protein, bacteriophage-type protein
           [Oxalobacteraceae bacterium IMCC9480]
 gi|327548581|gb|EGF33241.1| putative DNA polymerase-like protein, bacteriophage-type protein
           [Oxalobacteraceae bacterium IMCC9480]
          Length = 289

 Score =  158 bits (400), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 47/197 (23%), Positives = 80/197 (40%), Gaps = 8/197 (4%)

Query: 69  SIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPF 128
           + A    S  EL+  + S   C LC      +     +    + +G  P   ++  G+PF
Sbjct: 90  AAAIARMSWQELELAVASCTRCALCKNRKQAVLGAGDQKPGWLFVGEGPGHVEDQQGEPF 149

Query: 129 SGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPG----NRNLSNIEMEICRPIIMRQIE 183
            G  G +LD ML ++++ R    +++      P G    +R  S  E   CRP + RQI 
Sbjct: 150 VGPAGKLLDNMLLALDLPRGENNYLANAVKCRPVGADGKDRPPSADESAACRPYLERQIA 209

Query: 184 LISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLI 243
           L+ P +++ +G          D +               +  IP + T HP  L++ PL 
Sbjct: 210 LLQPAVIVALGKVAALSLLGGDPKIAVAA---LREHTHRYGSIPVVVTYHPAYLLRKPLD 266

Query: 244 KKNTWHALITLKKALKN 260
           K  +W  L    +A  +
Sbjct: 267 KAKSWRDLCLAAQAYAS 283


>gi|221195029|ref|ZP_03568085.1| uracil-DNA glycosylase, family 4 [Atopobium rimae ATCC 49626]
 gi|221184932|gb|EEE17323.1| uracil-DNA glycosylase, family 4 [Atopobium rimae ATCC 49626]
          Length = 226

 Score =  158 bits (399), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 48/188 (25%), Positives = 78/188 (41%), Gaps = 5/188 (2%)

Query: 73  KACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKT 132
            + +L E++  +R    C LC    + +         +M IG  P  ++++ G+PF G  
Sbjct: 10  SSVTLEEVREQMRDCRLCRLCEGRNTIVFGDGNPHARVMFIGEGPGKNEDLGGRPFIGAA 69

Query: 133 GNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLF 192
           G  LD  L +  + R  I I+ +    PP NRN    E+E C P +  Q+  I P  ++ 
Sbjct: 70  GKKLDGYLAAAGLSRDDIFITNVVKCRPPSNRNPRPEEIEACAPYLRNQVRAIWPDAIVC 129

Query: 193 IGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALI 252
           +GN    F      +      G+     T H +   L T HP   I +P  +      L 
Sbjct: 130 LGNFASQFIL-RTEKGVTSLRGRL--YQTGHFV--VLPTFHPAATIYHPAWEPLLTDDLR 184

Query: 253 TLKKALKN 260
            L + L+ 
Sbjct: 185 LLGQWLQE 192


>gi|187735611|ref|YP_001877723.1| phage SPO1 DNA polymerase-related protein [Akkermansia muciniphila
           ATCC BAA-835]
 gi|187425663|gb|ACD04942.1| phage SPO1 DNA polymerase-related protein [Akkermansia muciniphila
           ATCC BAA-835]
          Length = 305

 Score =  157 bits (398), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 51/220 (23%), Positives = 92/220 (41%), Gaps = 14/220 (6%)

Query: 49  AIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFH-DCHLCSTSLSTICATQTEG 107
             +P         P              L  L++L +++     L S   + + AT    
Sbjct: 76  KPEPPELFPQNREPASAITLPEGTMEDKLQYLRNLAQNWKPARELNSLRDTMVFATGNPH 135

Query: 108 QDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHP------P 161
             LM+IG  P   + +  +PF G+ G  L+++L+++ + R  ++IS I  + P       
Sbjct: 136 TKLMLIGEAPGYYEEVQQEPFVGRAGEKLNQILRAMGLSRDMVYISNIVKFRPALPNQRT 195

Query: 162 GNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCT 221
            NR  +  E+E C PIIM +I +I PK+++ +G                   G++ +L  
Sbjct: 196 NNRAPTPEEIEACLPIIMHEIRVIQPKMIVALGGTAAVGLLGEQGSV-SSMRGRFHDLN- 253

Query: 222 PHSIIPTLATVHPQELIQ--YPLIKKNTWHALITLKKALK 259
               IP   T HP  L++   P  K+  W  ++ + + L 
Sbjct: 254 ---GIPVRVTYHPSYLLRSDSPREKRKVWEDMLAVMERLD 290


>gi|45656446|ref|YP_000532.1| uracil-DNA glycosylase [Leptospira interrogans serovar Copenhageni
           str. Fiocruz L1-130]
 gi|294828371|ref|NP_713848.2| uracil-DNA glycosylase [Leptospira interrogans serovar Lai str.
           56601]
 gi|45599681|gb|AAS69169.1| uracil-DNA glycosylase [Leptospira interrogans serovar Copenhageni
           str. Fiocruz L1-130]
 gi|293386223|gb|AAN50866.2| uracil-DNA glycosylase [Leptospira interrogans serovar Lai str.
           56601]
          Length = 218

 Score =  157 bits (398), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 47/198 (23%), Positives = 90/198 (45%), Gaps = 16/198 (8%)

Query: 72  QKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGK 131
           +K   L  ++S + +   C L +T   T+        +L+ IG  P   ++++G+PF GK
Sbjct: 20  EKLKRLGLMQSEVSACKLCKLETTRTQTVFGEGNPDAELVFIGEGPGKQEDLTGRPFVGK 79

Query: 132 TGNMLDKMLQS-IEIMRTQIHISMISPWHP------PGNRNLSNIEMEICRPIIMRQIEL 184
            G +L ++++  + + R  ++I+ I    P        +R     E   C P ++RQ+E+
Sbjct: 80  AGELLTRIIEKGMGVPRESVYIANIVKCRPTVDMKFEKDRPPEEEETRACAPYLLRQLEI 139

Query: 185 ISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPL-- 242
           I PK ++ +GN +  F  N   +   +  G W         IP + T HP  +I+     
Sbjct: 140 IQPKAIVTLGNPSTRFILNTK-EGITKLRGTW----GSFFGIPVMPTYHPSFVIRNGGEN 194

Query: 243 --IKKNTWHALITLKKAL 258
             +K++ W  +  +   L
Sbjct: 195 SPLKRDVWEDIKKVMDLL 212


>gi|182415672|ref|YP_001820738.1| phage SPO1 DNA polymerase-related protein [Opitutus terrae PB90-1]
 gi|177842886|gb|ACB77138.1| phage SPO1 DNA polymerase-related protein [Opitutus terrae PB90-1]
          Length = 327

 Score =  157 bits (398), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 47/243 (19%), Positives = 91/243 (37%), Gaps = 23/243 (9%)

Query: 31  PNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRS---F 87
             +  T      +++      P+     I +P          KA     L+  + +    
Sbjct: 76  EPDRGTVTPPVGDRAPAETEAPVARAATIPAPKPFTLPE-GDKAARFAALREHVLADAVC 134

Query: 88  HDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR 147
             C         +    +    +M +G  P   + I G+PF G  G +L KM+ ++ + R
Sbjct: 135 --CAHVRPGKKVVLGVGSLEAKIMFVGEAPGAEEEIQGEPFVGPAGQLLTKMIGAMGLRR 192

Query: 148 TQIHISMISPWHP----------PGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT 197
            +++I  I  W P           GNR  +  EM  C P +  QIE+++P++L+ +G+  
Sbjct: 193 DEVYIGNIMNWRPEMPVSASGVQYGNRPPNGEEMNYCLPYLRAQIEIVNPEVLVALGSTA 252

Query: 198 KNFFFNN-DAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLI--KKNTWHALITL 254
                     +   +  G+W          P + T HP  +++      K+  W  L+ +
Sbjct: 253 AQGLLGIGSFKALGEVRGRWHTFADK----PLMVTYHPSYILRNQSNRSKRMIWEDLLKV 308

Query: 255 KKA 257
            + 
Sbjct: 309 MER 311


>gi|40063236|gb|AAR38063.1| phage SPO1 DNA polymerase-related protein [uncultured marine
           bacterium 577]
          Length = 236

 Score =  157 bits (397), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 52/212 (24%), Positives = 90/212 (42%), Gaps = 8/212 (3%)

Query: 52  PITNIRHIHSPLVQQADSIAQKA--CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQD 109
           P+  +    S  V + +    +       +L+  +     C L      T+     +  D
Sbjct: 25  PVNILAKTPSSSVTKKEDRGSQILRSDWVQLEENVVGCTSCSLFQDRTKTVFGAGDKNAD 84

Query: 110 LMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSN 168
            + IG  PS  ++  G+P  G +G +LD ML+++ + R   I+I+      P G+R+  N
Sbjct: 85  WLFIGDVPSTEEDTQGEPLIGLSGELLDNMLEAVSLKRGGNIYIANTVKCRPSGDRSPDN 144

Query: 169 IEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPT 228
            E + C P ++RQIELI PK+++ +G           A       G+        S IP 
Sbjct: 145 SEEQQCEPFLIRQIELIKPKLIIVLGEIAAQNLLGTSATIDS-LRGRLHEY----SSIPL 199

Query: 229 LATVHPQELIQYPLIKKNTWHALITLKKALKN 260
           + T HP  L+Q    K+  W  L   +  ++ 
Sbjct: 200 IVTYHPAYLLQIQSDKEKVWQDLCFARNIMQK 231


>gi|41615161|ref|NP_963659.1| hypothetical protein NEQ372 [Nanoarchaeum equitans Kin4-M]
 gi|40068885|gb|AAR39220.1| NEQ372 [Nanoarchaeum equitans Kin4-M]
          Length = 198

 Score =  157 bits (397), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 45/188 (23%), Positives = 85/188 (45%), Gaps = 3/188 (1%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
              EL+  + +   C L   + + +     +  D++ IG  P + ++  GKPF G+ G +
Sbjct: 2   DWEELEKQILNCKKCPLYKYARNKVIGDGNKNSDIVFIGEAPGEEEDKQGKPFVGRAGQL 61

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           L+K+L+ I + R QI+I+ +    PP NR+    E+E C+P ++ Q++LI P  ++ +G 
Sbjct: 62  LNKLLEKIGLTRDQIYITNVLKCRPPNNRDPKEEEIEACKPYLVIQLDLIKPTYIVTLGR 121

Query: 196 KTKNF---FFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALI 252
                    F        +  GK   +   + I+    T+HP   + +            
Sbjct: 122 FATKEIFDLFGLKFSSITKVRGKPYYVRRWNKIVTIFPTLHPAAALYHTKYLPIIEQDFE 181

Query: 253 TLKKALKN 260
            LK+ + N
Sbjct: 182 KLKEIISN 189


>gi|28210008|ref|NP_780952.1| DNA polymerase [Clostridium tetani E88]
 gi|28202443|gb|AAO34889.1| DNA polymerase, bacteriophage-type [Clostridium tetani E88]
          Length = 188

 Score =  157 bits (397), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 48/186 (25%), Positives = 84/186 (45%), Gaps = 6/186 (3%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
             EL +   + + C L       +        D+M IG  P   ++ +G+PF G+ G  L
Sbjct: 4   WKELHNNCLACNKCDLSKNRTHMVFGEGNSKADIMFIGEAPGGDEDKTGRPFVGRAGQFL 63

Query: 137 DKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
            KML S++++R    +I  I    P  NRN    E++ C P +  Q  L+ P+I++ +G 
Sbjct: 64  TKMLNSLDLIRERDYYICNICKCRPENNRNPKEDEIKACIPYLRNQFALVQPRIIVCLGA 123

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
              N   ++   +  ++ GKW             AT HP  +++    K+  +  L  +K
Sbjct: 124 IATNQIISDQW-RITRDRGKW----IKRKGCFITATFHPAAVLRDEGKKQYIFRDLQEVK 178

Query: 256 KALKNL 261
           KA ++L
Sbjct: 179 KAYESL 184


>gi|296241955|ref|YP_003649442.1| phage SPO1 DNA polymerase-like protein [Thermosphaera aggregans DSM
           11486]
 gi|296094539|gb|ADG90490.1| phage SPO1 DNA polymerase-related protein [Thermosphaera aggregans
           DSM 11486]
          Length = 202

 Score =  157 bits (397), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 39/183 (21%), Positives = 79/183 (43%), Gaps = 4/183 (2%)

Query: 83  LLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQS 142
            +++   C L    ++T+         +++IG  P   ++  G PF G  G +L+ +L++
Sbjct: 13  EIQNCKKCRLHENRINTVPGEGPLTAKVVLIGEAPGRKEDEVGSPFVGPAGRLLNTLLEN 72

Query: 143 IEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFF 202
             + R ++ I+ I    PPGNR     E+  C   + RQ+ LI P++L+ +GN      +
Sbjct: 73  SGLKREEVFITNIVKCRPPGNRKPRRDEISQCLGYLGRQLRLIKPRVLILLGNTAAETIY 132

Query: 203 ---NNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL-ITLKKAL 258
                +     ++ GK   +        ++ T HP   +  P ++          +K  +
Sbjct: 133 GLSGVEWHGMMRDHGKIFEINVYGVKTISIPTFHPAAALYNPRLRTILLEDFTKVVKPVI 192

Query: 259 KNL 261
           + L
Sbjct: 193 EEL 195


>gi|294102554|ref|YP_003554412.1| phage SPO1 DNA polymerase-related protein [Aminobacterium
           colombiense DSM 12261]
 gi|293617534|gb|ADE57688.1| phage SPO1 DNA polymerase-related protein [Aminobacterium
           colombiense DSM 12261]
          Length = 189

 Score =  157 bits (396), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 43/185 (23%), Positives = 79/185 (42%), Gaps = 6/185 (3%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKM 139
           L+  +     C LC      +         +M++G  P  +++ +G+PF G++GN+L ++
Sbjct: 6   LRQRIEVCEKCELCGMRQQPVIGEGLAECRVMLVGEAPGATEDETGRPFVGRSGNLLCQL 65

Query: 140 LQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKN 199
           ++   + R    I+ +    PP NR  +  E++ CRP +  QI L+SP +++  GN    
Sbjct: 66  IEEAGLSREFFFITNMVKCRPPENRKPTKDELDACRPFLEEQIRLLSPLLIVTAGNTPTQ 125

Query: 200 FFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKK-----NTWHALITL 254
           +F N          G++         I      HP  L++    +K      T   L  +
Sbjct: 126 WFLNTRKGV-TALRGQYYPWDFEGRKIKIRPLFHPSYLLRNRSREKGRPLHQTLCDLREI 184

Query: 255 KKALK 259
              LK
Sbjct: 185 ASFLK 189


>gi|257438681|ref|ZP_05614436.1| uracil-DNA glycosylase [Faecalibacterium prausnitzii A2-165]
 gi|257198865|gb|EEU97149.1| uracil-DNA glycosylase [Faecalibacterium prausnitzii A2-165]
          Length = 188

 Score =  156 bits (395), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 44/187 (23%), Positives = 81/187 (43%), Gaps = 6/187 (3%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
               LK+   +   C LC+     +     +  +++ +G  P  S++  G PF G++G +
Sbjct: 2   DWDTLKAECLACRRCELCTDRTHVVFGQGVQTAEVLFVGEGPGQSEDEQGLPFVGRSGQL 61

Query: 136 LDKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           LDK L +I++ R    +I+ I    PP NR+    E E C P +  Q +L+ PKI++ +G
Sbjct: 62  LDKYLFAIDLDRSKNCYIANIVKCRPPQNRDPLPTESEACMPWLREQFKLLQPKIVVCLG 121

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITL 254
                     D   T     K        + +  + T HP  L++    K   +   + L
Sbjct: 122 RIASQRMIRTDFSVT-----KEHGTFVQKNGVWFMGTFHPAALLRQAQNKPAAFADFVAL 176

Query: 255 KKALKNL 261
           ++ +  +
Sbjct: 177 REKIHEV 183


>gi|269925911|ref|YP_003322534.1| phage SPO1 DNA polymerase-related protein [Thermobaculum terrenum
           ATCC BAA-798]
 gi|269789571|gb|ACZ41712.1| phage SPO1 DNA polymerase-related protein [Thermobaculum terrenum
           ATCC BAA-798]
          Length = 219

 Score =  156 bits (394), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 44/188 (23%), Positives = 84/188 (44%), Gaps = 6/188 (3%)

Query: 73  KACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKT 132
           +  SL  + S +R    C L +T  + +         +M IG  P  +++  G+PF G  
Sbjct: 8   REDSLELIASEVRKCTKCPLSATRTNAVPGEGNPSAQIMFIGEGPGFNEDRQGRPFVGAA 67

Query: 133 GNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLF 192
           G  L+++LQS+ + R  + I+ +    PPGNR+    E++ C   + RQIELI P +++ 
Sbjct: 68  GAFLNELLQSVGLRREDVFITNVVKCRPPGNRDPLPEEIQACSCYLDRQIELIKPAVIVT 127

Query: 193 IGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALI 252
           +G  +   +F N+         +          +  +   HP   +  P +K+ +     
Sbjct: 128 LGRYSMARYFPNERIS------RIHGQPRRIGDLTVVPLFHPAAALHQPALKETSISDFK 181

Query: 253 TLKKALKN 260
            + K ++ 
Sbjct: 182 KIPKIVEE 189


>gi|257792514|ref|YP_003183120.1| phage SPO1 DNA polymerase-like protein [Eggerthella lenta DSM 2243]
 gi|317490382|ref|ZP_07948866.1| uracil-DNA glycosylase, family 4 [Eggerthella sp. 1_3_56FAA]
 gi|325833538|ref|ZP_08165987.1| uracil-DNA glycosylase A [Eggerthella sp. HGA1]
 gi|257476411|gb|ACV56731.1| phage SPO1 DNA polymerase-related protein [Eggerthella lenta DSM
           2243]
 gi|316910517|gb|EFV32142.1| uracil-DNA glycosylase, family 4 [Eggerthella sp. 1_3_56FAA]
 gi|325485462|gb|EGC87931.1| uracil-DNA glycosylase A [Eggerthella sp. HGA1]
          Length = 211

 Score =  156 bits (394), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 42/183 (22%), Positives = 76/183 (41%), Gaps = 5/183 (2%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L E+++ +     C L      T+         +MIIG  P  ++++ G+PF G  G  L
Sbjct: 8   LDEIRAQVEGCRKCPLADGRTQTVFGVGNPEARVMIIGEAPGKNEDLQGEPFVGAAGKYL 67

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
           +++L    ++R  + I+ +    PPGNR+    E+E+C P +  Q   I P+ L+ +GN 
Sbjct: 68  NELLAVAGLVREDVFIANVLKCRPPGNRDPRPEEIELCTPYLREQTRTIDPEFLVTLGNF 127

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
           +  F    D   T     +                 HP   +     ++   +   TL +
Sbjct: 128 STKFILKTDIGIT-----RLHGTVQRAGKFKVFPIFHPAAALYDGSKREALENDFATLGE 182

Query: 257 ALK 259
            L+
Sbjct: 183 LLR 185


>gi|171186390|ref|YP_001795309.1| phage SPO1 DNA polymerase-related protein [Thermoproteus
           neutrophilus V24Sta]
 gi|170935602|gb|ACB40863.1| phage SPO1 DNA polymerase-related protein [Thermoproteus
           neutrophilus V24Sta]
          Length = 190

 Score =  156 bits (394), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 38/178 (21%), Positives = 77/178 (43%), Gaps = 3/178 (1%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           +  L   +R    C L     + +         +M++G  P  +++  G+PF G  G++L
Sbjct: 1   MEALHDAIRRCTKCPLHLHRRNAVPGEGRARLGVMVVGEAPGAAEDAEGRPFVGAAGSLL 60

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
            K L  + + R  ++I+ +    PP NR  +  E+E C P +++QIEL+ P+ +L +G  
Sbjct: 61  TKTLAKLGVSRDDLYITNVVKCRPPNNRTPTREEVEACLPYLLKQIELVKPRRVLALGLV 120

Query: 197 TKNFFFNNDAQKTYQ---NLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
           +         ++  +     G+          +    T HP  +++ P ++      L
Sbjct: 121 SAKALLGLIGREVEKVGEVRGRCFPGRISGVELEVCVTYHPAAVLRNPNLRGRFEGDL 178


>gi|221632240|ref|YP_002521461.1| phage DNA polymerase-like protein [Thermomicrobium roseum DSM 5159]
 gi|221155463|gb|ACM04590.1| phage DNA polymerase-related protein [Thermomicrobium roseum DSM
           5159]
          Length = 230

 Score =  155 bits (392), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 39/184 (21%), Positives = 75/184 (40%), Gaps = 6/184 (3%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L  +   +R    C L  T    +        ++M IG  P   ++  G+PF G  G  L
Sbjct: 29  LESIAERVRHCTRCDLWRTRTQAVPGEGDPHAEVMFIGEAPGYHEDRQGRPFVGAAGQFL 88

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
           +++L    + R Q++I+ +    PPGNR+    E+  C P +  QI +I P +++ +G  
Sbjct: 89  NELLGRAGLRREQVYITNVVKCRPPGNRDPLPDEIAACAPYLDEQIAVIRPSVIVTLGRY 148

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
           +   +F N+         +          +  +   HP   +  P +K+        L++
Sbjct: 149 SMARWFPNEKIS------RIHGKPRRFGDVVVVPMYHPAAALHQPALKELVEKDFDALRE 202

Query: 257 ALKN 260
            +  
Sbjct: 203 IIAQ 206


>gi|325283880|ref|YP_004256421.1| phage SPO1 DNA polymerase-related protein [Deinococcus
           proteolyticus MRP]
 gi|324315689|gb|ADY26804.1| phage SPO1 DNA polymerase-related protein [Deinococcus
           proteolyticus MRP]
          Length = 224

 Score =  155 bits (391), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 51/204 (25%), Positives = 93/204 (45%), Gaps = 9/204 (4%)

Query: 64  VQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNI 123
           + + D  A    +L EL+   +    C L +  L  + A  T   DL+IIG  P   ++ 
Sbjct: 3   IPERDLWAPDLRALDELERENKGCTACPLRAGCLQVVVADGTPAADLLIIGEGPGGDEDR 62

Query: 124 SGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRP-IIMRQI 182
           +G+PF G+ G +LD++L ++++ R   +I+ I    PP NR  +  E++ C    + RQ+
Sbjct: 63  TGRPFVGRAGQLLDRILAAVDLRREDTYITNIVKCRPPANRAPTPPEIQTCTELWLNRQL 122

Query: 183 ELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHS--IIPTLATVHPQELIQY 240
            L+ P++++ +GN           Q   +  G+W     P S      +   HP  L++ 
Sbjct: 123 ALLRPRVIVTMGNTPTRHLLG-TQQGITRLRGQWHPYRLPGSDATAALMPMFHPAYLLRN 181

Query: 241 PLI-----KKNTWHALITLKKALK 259
                   K  TW  ++ +   L+
Sbjct: 182 DTRVKGGPKSLTWGDILEVAGVLR 205


>gi|320334828|ref|YP_004171539.1| phage SPO1 DNA polymerase-like protein [Deinococcus maricopensis
           DSM 21211]
 gi|319756117|gb|ADV67874.1| phage SPO1 DNA polymerase-related protein [Deinococcus maricopensis
           DSM 21211]
          Length = 216

 Score =  155 bits (391), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 48/193 (24%), Positives = 84/193 (43%), Gaps = 9/193 (4%)

Query: 75  CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
            ++ +L++  R    C L +T    + A       L+I+G  P   ++  G+PF G+ G 
Sbjct: 5   RAIADLEATARGCTACRLRATCTQVVVADGNPDAPLLILGEGPGGDEDRLGRPFVGRAGQ 64

Query: 135 MLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRP-IIMRQIELISPKILLFI 193
           +LDK+L ++ + R   +IS I    PP NR     E+E+C    +  Q+ L+ P++++ +
Sbjct: 65  LLDKILGAVGLTRDDAYISNIVKCRPPANRTPEPDEIEVCTRLWLSGQLALLRPRVIVTL 124

Query: 194 GNKTKNFFFNNDAQKTYQNLGKWSNLCTPHS--IIPTLATVHPQELIQYPLI-----KKN 246
           GN    +          +  G+W            P L   HP  L++         K  
Sbjct: 125 GNVPTQYMLG-TRTGITRTRGQWYTYAQAERLWTAPLLPMFHPAYLLRNDTRAPGGPKSL 183

Query: 247 TWHALITLKKALK 259
           TW  +  +K AL 
Sbjct: 184 TWRDIQAVKAALD 196


>gi|148239810|ref|YP_001225197.1| Uracil-DNA glycosylase [Synechococcus sp. WH 7803]
 gi|147848349|emb|CAK23900.1| Uracil-DNA glycosylase [Synechococcus sp. WH 7803]
          Length = 191

 Score =  155 bits (391), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 47/193 (24%), Positives = 80/193 (41%), Gaps = 11/193 (5%)

Query: 75  CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
            +L  LKS   +   C L       +      G DLM+IG  P   ++  G PF G++G 
Sbjct: 2   NALDALKSQCAACQCCDLAYHRNQVVVGRGNPGADLMLIGEAPGADEDSQGLPFVGRSGR 61

Query: 135 MLDKMLQSIEIMRTQI-HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFI 193
           +L ++L++ E+   Q  HI  +    PP NR  ++ E++ CRP +  QI L++P ++L  
Sbjct: 62  LLSELLEAAELDEEQDLHICNVIKCRPPNNRKPTSNEIKQCRPWLEEQIALVNPSLVLLA 121

Query: 194 GNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLI-----KKNTW 248
           G           +    +  G+W            +   HP  L+++        +  T 
Sbjct: 122 GATALQALLGIKS-GISKLRGQWHEQEGKA----FMPVFHPSYLLRFGSREEGSPRALTL 176

Query: 249 HALITLKKALKNL 261
                 K+ L  L
Sbjct: 177 QDFQEAKRRLSAL 189


>gi|18312072|ref|NP_558739.1| uracil DNA glycosylase (PA-UDGa) [Pyrobaculum aerophilum str. IM2]
 gi|18159500|gb|AAL62921.1| uracil DNA glycosylase (Pa-UDGa) [Pyrobaculum aerophilum str. IM2]
          Length = 196

 Score =  155 bits (391), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 40/182 (21%), Positives = 78/182 (42%), Gaps = 3/182 (1%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
            L +L  L+++   C L     + +         +MI+G  P  S++ +G+PF G  G +
Sbjct: 2   DLQKLHELIKNCDKCPLHKYRKNAVPGEGEMKLGVMIVGEAPGASEDEAGRPFVGAAGQL 61

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           L + L  + + R  + I+ +    PP NR  +  E+E C P +++QI ++ P+ ++ +G 
Sbjct: 62  LTEALSRLGVRRGDVFITNVVKCRPPNNRTPNREEVEACLPYLIQQIGILKPRRIIALGL 121

Query: 196 KTKNF---FFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALI 252
            +           A+K     GK          +    T HP  +++ P ++      L 
Sbjct: 122 ISAKALMELMGRRAEKLGDVKGKCYQGRIAGVQVELCITYHPAAVLRKPALRGEFQKDLA 181

Query: 253 TL 254
             
Sbjct: 182 MF 183


>gi|288573334|ref|ZP_06391691.1| phage SPO1 DNA polymerase-related protein [Dethiosulfovibrio
           peptidovorans DSM 11002]
 gi|288569075|gb|EFC90632.1| phage SPO1 DNA polymerase-related protein [Dethiosulfovibrio
           peptidovorans DSM 11002]
          Length = 192

 Score =  154 bits (390), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 39/190 (20%), Positives = 81/190 (42%), Gaps = 6/190 (3%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           S  +L+  + +   C L  T  + +     E   ++++G  P   ++ +G+PF G++G  
Sbjct: 2   SWSKLREAVGTCRGCSLWETRNNAVFGEGPEDSPVLLVGEAPGAEEDSTGRPFVGRSGRF 61

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           L  ++    + R  + IS I    PPGNRN    E+  C   +   + L+ P++++ +GN
Sbjct: 62  LSDLMAEAGLRREDLFISNIVHCRPPGNRNPKKGEIRACLQWLEDIVGLLRPQVVVTVGN 121

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKK-----NTWHA 250
                  +   +      G++ +       +      HP  L++    ++     +T   
Sbjct: 122 VPSQTIIDTK-EGISTLRGRFHHGRLGGMDLTIRPIFHPAYLLRNRSREEGSPVSSTLED 180

Query: 251 LITLKKALKN 260
           L TL   ++N
Sbjct: 181 LRTLVDFVRN 190


>gi|302036861|ref|YP_003797183.1| uracil-DNA glycosylase [Candidatus Nitrospira defluvii]
 gi|190343276|gb|ACE75664.1| uracil-DNA glycosylase family 4 [Candidatus Nitrospira defluvii]
 gi|300604925|emb|CBK41258.1| Uracil-DNA glycosylase [Candidatus Nitrospira defluvii]
          Length = 223

 Score =  154 bits (390), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 42/191 (21%), Positives = 77/191 (40%), Gaps = 6/191 (3%)

Query: 70  IAQKACSLHELKSLLRSFHDCHLCS-TSLSTICATQTEGQDLMIIGYTPSDSDNISGKPF 128
           ++    +L EL   L +   C L        +         +M +G  P   ++  G+PF
Sbjct: 1   MSSSPTTLQELAESLHNCQRCPLAKLGRHQVVFGVGNPHASVMFVGEAPGFHEDQKGEPF 60

Query: 129 SGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPK 188
            G  G +L+ +L+S  + R  I+I+ +    PP NR+    E+E C+P +++QI +I PK
Sbjct: 61  VGAAGQLLNDLLESAGLSRADIYIANVIKCRPPNNRDPEPQEVETCKPFLLQQIAMIRPK 120

Query: 189 ILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTW 248
           ++  +GN               +  G+   L            +HP   +    + +   
Sbjct: 121 LVCSLGNWATQTLL-ERKVGITRVRGQAFYL----KEFVLFPLLHPAAALHQGTMLQPLR 175

Query: 249 HALITLKKALK 259
                LK+ L 
Sbjct: 176 EDFQKLKEFLD 186


>gi|71483038|gb|AAZ32472.1| uracyl DNA glycosylase [uncultured euryarchaeote Alv-FOS1]
          Length = 196

 Score =  154 bits (390), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 44/187 (23%), Positives = 79/187 (42%), Gaps = 8/187 (4%)

Query: 78  HELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLD 137
            ++   +R    C L  T  + +       + +M +G  P   ++I G+PF G  G  LD
Sbjct: 13  KDIDEQIRKCQKCELWKTRKNAVPGEGGFRKKVMFVGEAPGKWEDIKGRPFVGAAGKYLD 72

Query: 138 KMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT 197
           ++L SI + R  + I+ I    PP NR+ ++ E+  C P +  QIE ++P+I+  +G  +
Sbjct: 73  ELLSSIGLSRDDVFITNIVKCRPPNNRDPTSEEISACAPYLEWQIETMAPRIICPLGRFS 132

Query: 198 KNFFF---NNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITL 254
             F         +      GK          I  +   HP   + +   K     +   L
Sbjct: 133 AKFILEKFGFTMKSISAAQGKIH-----RGTITIIPMYHPAAALYHGKWKAELEKSFTVL 187

Query: 255 KKALKNL 261
           K+ L+ +
Sbjct: 188 KEELEGI 194


>gi|148254428|ref|YP_001239013.1| putative Uracil-DNA glycosylase [Bradyrhizobium sp. BTAi1]
 gi|146406601|gb|ABQ35107.1| Putative Uracil-DNA glycosylase [Bradyrhizobium sp. BTAi1]
          Length = 496

 Score =  154 bits (390), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 44/242 (18%), Positives = 87/242 (35%), Gaps = 17/242 (7%)

Query: 27  VFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQ-KACSLHELKSLLR 85
           +        +        +     + I        P    A++     A  L  L+    
Sbjct: 244 LIAAAGRRMSAMIAEPGTAPHKPQKRIEEPAMTRKPTAPAAETSPDVAAADLETLREEAA 303

Query: 86  SFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEI 145
           +   C L   +  T+     +   LM++G  P D ++++G PF G  G MLD+ LQ   I
Sbjct: 304 ACRACPLWKDATQTVFGEGPDHAPLMLVGEQPGDKEDLAGHPFVGPAGQMLDRALQEAGI 363

Query: 146 MRTQIHISMISPWHPPG-------NRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTK 198
            R++++++                ++  +  E++ CR    R++  + P +++ +G    
Sbjct: 364 DRSKVYVTNAVKHFKFVPRGKIRLHQKPATPEIKACRQWYERELATVRPALVVALGATAA 423

Query: 199 NFFFNNDAQKTYQNLGKWSNLCTPHSII--PTLATVHPQELIQYPLIKKNTWH------A 250
              F        +N G   +L    ++I    + TVHP  L++ P               
Sbjct: 424 QSVFG-KITPVTKNRGHVVDLPEGPNMIATKAMVTVHPSYLLRLPDADAKAREYELFVKD 482

Query: 251 LI 252
           L 
Sbjct: 483 LK 484


>gi|256826607|ref|YP_003150566.1| uracil-DNA glycosylase, family 4 [Cryptobacterium curtum DSM 15641]
 gi|256582750|gb|ACU93884.1| uracil-DNA glycosylase, family 4 [Cryptobacterium curtum DSM 15641]
          Length = 195

 Score =  154 bits (390), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 41/188 (21%), Positives = 73/188 (38%), Gaps = 5/188 (2%)

Query: 73  KACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKT 132
              SL  L+  + + H C L     + +         ++IIG  P  ++++ G+PF G  
Sbjct: 4   TPQSLESLRRQVEACHACPLWQGRTNVVFGAGNPQARILIIGEAPGKNEDLQGEPFVGAA 63

Query: 133 GNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLF 192
           G  LD +L+  ++ R  + I+ +    PP NRN    E+  C P +  Q   I+P+ ++ 
Sbjct: 64  GKKLDALLEIADLARDDVFIANVLKCRPPSNRNPLPEEITACAPFLREQTRTINPEFIVT 123

Query: 193 IGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALI 252
           +GN +  F        T     +                 HP   I     ++       
Sbjct: 124 LGNFSTKFVLKTQLGIT-----RLHGQLQHAGRFKVFPIYHPAAAIYDRTKQQALEDDFR 178

Query: 253 TLKKALKN 260
           TL + +K 
Sbjct: 179 TLGRLVKE 186


>gi|115523840|ref|YP_780751.1| phage SPO1 DNA polymerase-related protein [Rhodopseudomonas
           palustris BisA53]
 gi|115517787|gb|ABJ05771.1| phage SPO1 DNA polymerase-related protein [Rhodopseudomonas
           palustris BisA53]
          Length = 480

 Score =  154 bits (389), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 43/235 (18%), Positives = 84/235 (35%), Gaps = 17/235 (7%)

Query: 39  SQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLS 98
           +Q +        +   + R       Q     A +  SL  L++       C L   +  
Sbjct: 246 AQAERDKNAMIAEAPRDPRSSQQRREQPMSKSASQRDSLTTLRAEAAECRACPLWKDATQ 305

Query: 99  TICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPW 158
           T+         +M++G  P D ++++G PF G  G MLD+ L    I R +++++     
Sbjct: 306 TVFGEGPSHASVMLVGEQPGDKEDLAGHPFVGPAGQMLDRALAEAGIDRGKVYVTNAVKH 365

Query: 159 HPPG-------NRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQ 211
                      ++  +  E++ CR    R++ L+ P +++ +G                +
Sbjct: 366 FKFVPRGKIRLHQKPTTPEIKTCRQWYERELALVRPTLVVALGATAAQSVLG-RITPINK 424

Query: 212 NLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTW------HALITLKKALKN 260
           + G+             L TVHP  L++ P  +            L  +   LK 
Sbjct: 425 SRGRLIEKEGEAQ---VLVTVHPSYLLRLPDEEAKAREYERFVEDLKIVAAHLKK 476


>gi|124026991|ref|YP_001012311.1| Uracil-DNA glycosylase [Hyperthermus butylicus DSM 5456]
 gi|123977685|gb|ABM79966.1| predicted Uracil-DNA glycosylase [Hyperthermus butylicus DSM 5456]
          Length = 221

 Score =  154 bits (389), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 41/189 (21%), Positives = 83/189 (43%), Gaps = 8/189 (4%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKM 139
           L   + +   C L     + +         +M+IG  P  ++++ G+PF G  G +L+K+
Sbjct: 10  LVEEIMNCTKCRLHQYRRNPVPGEGPLNAKVMVIGEAPGRNEDLQGRPFVGAAGQLLNKL 69

Query: 140 LQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKN 199
           L+   + R Q++I+ I    PPGNR+    E++ C P ++ QI L+ PK+++ +G  +  
Sbjct: 70  LELAGLKREQVYITNIVKCRPPGNRDPQEDEVKACLPYLLHQIRLVKPKLIIAVGRHSAR 129

Query: 200 FFF---NNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALI---- 252
                     +   +  GK  +       +    T HP   +  P +++           
Sbjct: 130 TLLELAGLQWRSMSEQHGKTYHGEIGGVKLMITVTYHPAAALYKPPLRQKLEDDFRGPIA 189

Query: 253 -TLKKALKN 260
             +++AL+ 
Sbjct: 190 AAVREALRE 198


>gi|94985656|ref|YP_605020.1| phage SPO1 DNA polymerase-related protein [Deinococcus geothermalis
           DSM 11300]
 gi|94555937|gb|ABF45851.1| uracil-DNA glycosylase [Deinococcus geothermalis DSM 11300]
          Length = 230

 Score =  154 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 46/204 (22%), Positives = 80/204 (39%), Gaps = 12/204 (5%)

Query: 67  ADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGK 126
           A   A    +L  L+   +S   C L       + +       L+IIG  P   ++  G+
Sbjct: 5   AGRQAADVIALEALEQQAKSCAACKLRPGCTQVVVSDGDPAAPLVIIGEGPGGDEDRLGR 64

Query: 127 PFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRP-IIMRQIELI 185
           PF G+ G +LD++L ++ + R   + + I    PPGNR     E  IC    +  Q+ L+
Sbjct: 65  PFVGRAGQLLDRILAAVNLTRQDAYFTNIVKCRPPGNRAPEPDETAICTELWLEPQLALL 124

Query: 186 SPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCT-----PHSIIPTLATVHPQELIQY 240
            P+++L +GN    +      Q   +  G+W                 +   HP  L++ 
Sbjct: 125 RPRVILSLGNTPTQYLLG-TRQGITRTRGQWYPYRHATAQGGSYQALLMPMFHPAYLLRN 183

Query: 241 PLI-----KKNTWHALITLKKALK 259
                   K  TW  +  +   L+
Sbjct: 184 DTRAPGGPKSLTWRDIREVAAVLR 207


>gi|298246517|ref|ZP_06970323.1| phage SPO1 DNA polymerase-related protein [Ktedonobacter racemifer
           DSM 44963]
 gi|297553998|gb|EFH87863.1| phage SPO1 DNA polymerase-related protein [Ktedonobacter racemifer
           DSM 44963]
          Length = 213

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 39/178 (21%), Positives = 74/178 (41%), Gaps = 5/178 (2%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L E+   + +   C+LC      +    +    ++ IG  P   ++  G+PF G  G  L
Sbjct: 7   LREVAVEVSTCSKCNLCKGRTRAVPGEGSTSAKILFIGEGPGYHEDQQGRPFVGPAGQFL 66

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
           D++L SI + R+ + I+ +    PP NR+    E+  C   + RQIE + P++++ +G  
Sbjct: 67  DELLASINLKRSDVFITNVVKCRPPQNRDPQPDEIAACNNYLDRQIEALKPRVIVTLGRF 126

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITL 254
           +   FF N+         +        +    +A  HP   +    +K         +
Sbjct: 127 SMAKFFGNEKISVIHGRAR-----KKDAGYICIAMYHPAAGLHQASLKDVIREDFKKI 179


>gi|328954809|ref|YP_004372142.1| phage SPO1 DNA polymerase-related protein [Coriobacterium glomerans
           PW2]
 gi|328455133|gb|AEB06327.1| phage SPO1 DNA polymerase-related protein [Coriobacterium glomerans
           PW2]
          Length = 222

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 43/184 (23%), Positives = 80/184 (43%), Gaps = 5/184 (2%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
            L E++++L     C L  T    +  T  E   ++ IG  P  ++++ G+PF G  G  
Sbjct: 18  ELREVRAVLGECRRCQLAQTRTKIVFGTGDENARVLFIGEAPGKNEDLQGEPFVGAAGKN 77

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           LD +L    + R +++I+ +    PPGNR+    E+  C P +  QI  I P +++ +GN
Sbjct: 78  LDGILSLAGLRREEVYIANVLKCRPPGNRDPRPEEVLACAPFLREQIRSIWPDVIVTMGN 137

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
              +F    +     +  G++  +         + T HP   ++ P  +         L 
Sbjct: 138 PATHFILKTE-IGITRLRGRFHQM----GRFAVMPTFHPAAALRNPAWQDLIEADFNMLG 192

Query: 256 KALK 259
             L+
Sbjct: 193 DYLR 196


>gi|295106610|emb|CBL04153.1| uracil-DNA glycosylase, family 4 [Gordonibacter pamelaeae 7-10-1-b]
          Length = 226

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 39/184 (21%), Positives = 77/184 (41%), Gaps = 5/184 (2%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L ++++ + +   C L      T+         ++I+G  P  ++++ G+PF GK G  L
Sbjct: 8   LEDIRAQVEACRKCPLADGRTQTVFGVGNPSARVLIVGEAPGKNEDLQGEPFVGKAGQYL 67

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
           +++L    + R  + I+ +    PPGNR+    E+E+C P +  Q   I P+ ++ +GN 
Sbjct: 68  NELLAIAGLAREHVFIANVLKCRPPGNRDPRPEEIELCTPYLREQTRTIDPEFIVTLGNF 127

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
           +  F    +   T     +                 HP   I     ++   +   TL +
Sbjct: 128 STKFILKTEIGIT-----RLHGTLQRAGKFKVFPIFHPAAAIYDGSKREALENDFATLGE 182

Query: 257 ALKN 260
            L+ 
Sbjct: 183 LLRA 186


>gi|71483068|gb|AAZ32501.1| uracil DNA glycosylase [uncultured euryarchaeote Alv-FOS4]
          Length = 196

 Score =  153 bits (386), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 45/187 (24%), Positives = 77/187 (41%), Gaps = 8/187 (4%)

Query: 78  HELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLD 137
             L   +R    C L  T    +       + +M +G  P   ++I G+PF G  G  LD
Sbjct: 13  DSLDDKIRECKKCGLWKTRTHAVPGEGGFRKKVMFVGEAPGKWEDIKGRPFVGAAGKYLD 72

Query: 138 KMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT 197
           ++L +I + R  ++I+ I    PP NR+ ++ E+  C P +  QIE + P+++  +G  +
Sbjct: 73  ELLATIGLSRDDVYITNIVKCRPPNNRDPTDEEIRACAPYLEWQIEHMRPRVICPLGRFS 132

Query: 198 KNFFF---NNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITL 254
             F         +      GK          I  +   HP   + +   K     A  TL
Sbjct: 133 AKFILEKFGFTMKSITAAQGKIY-----RGDIIIIPMFHPAAALYHGKWKPELEKAFATL 187

Query: 255 KKALKNL 261
           K  L ++
Sbjct: 188 KSVLDDM 194


>gi|260221974|emb|CBA31074.1| hypothetical protein Csp_C26730 [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 286

 Score =  152 bits (385), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 50/233 (21%), Positives = 86/233 (36%), Gaps = 7/233 (3%)

Query: 32  NNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCH 91
              A    QR    +  A +P+             A   A  A   + L     +   C 
Sbjct: 52  VRPAPLTEQRPSAPVPMASRPVPVQVAAVESA-APAQPSALAALDWNGLADTAAACESCG 110

Query: 92  LCSTSLS-TICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR--- 147
           LC+     T+   Q    D M++G  P + ++ + + F    G +LD ML+++   R   
Sbjct: 111 LCAGRKHATLQPAQQAQADWMVVGDPPEEDEDSAAQAFVEAPGLLLDNMLKAVGAGRSGS 170

Query: 148 --TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNND 205
                + + +    PP  RN    ++  C   + R+IEL+ PK++  +G        +  
Sbjct: 171 GPQGAYATNVVKCRPPHGRNPQPADLAQCAAYLQREIELVQPKVIFAVGRFAIQTLLSEH 230

Query: 206 AQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKAL 258
                Q LGK       +  IP + +  P+ L++    K   W  L     AL
Sbjct: 231 GALATQPLGKLRGSVYRYRGIPVVVSYPPKLLLRNSADKAKAWADLCLAMDAL 283


>gi|149921262|ref|ZP_01909718.1| phage SPO1 DNA polymerase-related protein [Plesiocystis pacifica
           SIR-1]
 gi|149817922|gb|EDM77384.1| phage SPO1 DNA polymerase-related protein [Plesiocystis pacifica
           SIR-1]
          Length = 464

 Score =  152 bits (385), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 50/209 (23%), Positives = 87/209 (41%), Gaps = 5/209 (2%)

Query: 34  EATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSL-LRSFHDCHL 92
               E     ++  +  QP  N       L +QA+     A  L  L+   +     C L
Sbjct: 197 RRGPERGAPSQAPGARSQPDANANANKGTLRRQAEQW-PAAKKLAYLRDRSVGDCRRCRL 255

Query: 93  CSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHI 152
             T  + +        D+M +G  P   ++  G+PF G  G  LD  L  + + R++++I
Sbjct: 256 AETRRNLVFGVGNPDADMMFVGEAPGAEEDRRGEPFVGAAGQRLDAWLHELGLQRSEVYI 315

Query: 153 SMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQN 212
           + +    PPGNR+   +E++ C P +  QI  I P++L+ +G         +   K YQ 
Sbjct: 316 ANVLKCRPPGNRDPHPVEIQRCSPFLHAQIRAIQPRVLVALGRFAG-CLLLDRQLKMYQM 374

Query: 213 LGKWSNLCTPHSI--IPTLATVHPQELIQ 239
            G       P +    P + T HP  +++
Sbjct: 375 RGSVHRYREPKTGTEFPLVVTYHPSYVLR 403


>gi|116754774|ref|YP_843892.1| phage SPO1 DNA polymerase-related protein [Methanosaeta thermophila
           PT]
 gi|116666225|gb|ABK15252.1| phage SPO1 DNA polymerase-related protein [Methanosaeta thermophila
           PT]
          Length = 184

 Score =  152 bits (384), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 45/183 (24%), Positives = 79/183 (43%), Gaps = 9/183 (4%)

Query: 74  ACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTG 133
           A  L EL   +     C L  T  + +     E   +M+IG  P  +++++G+PF G+ G
Sbjct: 3   ANDLRELACEIVRCERCGLSKTRRNAVPGEGPEDARIMMIGEAPGAAEDLAGRPFVGRAG 62

Query: 134 NMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFI 193
            +L++ L    + R +I I+ I    PPGNR  S  E+  C P + +QIE++ P  +  +
Sbjct: 63  AILNRALNLAGLDRDEIFITNIVKCRPPGNRQPSADEIRACMPYLRKQIEMVRPSAICLL 122

Query: 194 GNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALIT 253
           GN                  G+  +          L T HP  +++     +     L+ 
Sbjct: 123 GNVPARAILGVQGV--TALRGRVFDDLY-------LITFHPAAVLRNMGRMELFVSDLVR 173

Query: 254 LKK 256
           L++
Sbjct: 174 LRE 176


>gi|297623507|ref|YP_003704941.1| phage SPO1 DNA polymerase-like protein [Truepera radiovictrix DSM
           17093]
 gi|297164687|gb|ADI14398.1| phage SPO1 DNA polymerase-related protein [Truepera radiovictrix
           DSM 17093]
          Length = 219

 Score =  152 bits (384), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 51/194 (26%), Positives = 92/194 (47%), Gaps = 11/194 (5%)

Query: 74  ACSLHELKSLLRS-FHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKT 132
             +L +L+   R+      L   S + +        D++I+G  P + +++ G+PF G+ 
Sbjct: 13  PMTLSDLEQQARNTPKPAALAELSDNLVFGEGNPDADVVIVGEAPGEDEDLLGRPFVGRA 72

Query: 133 GNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLF 192
           G +LD++L+S  I R  ++I+ I  + PPGNRN    E+E   P+++ Q+ LI P+I+  
Sbjct: 73  GQLLDRILESAHIEREDVYITNILKYRPPGNRNPKPEEIEASAPLLLEQLRLIRPQIIAT 132

Query: 193 IGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLI-----KKNT 247
           +GN    +F     +   +  G+W +       +      HP  L++ P       K   
Sbjct: 133 LGNFPTQYFAGTK-EGITKTRGRWFSW----HGVRVFPMFHPAYLLRNPSRERGSPKWLM 187

Query: 248 WHALITLKKALKNL 261
           W  +  LK A+  L
Sbjct: 188 WQDIRALKAAIDEL 201


>gi|302334972|ref|YP_003800179.1| phage SPO1 DNA polymerase-related protein [Olsenella uli DSM 7084]
 gi|301318812|gb|ADK67299.1| phage SPO1 DNA polymerase-related protein [Olsenella uli DSM 7084]
          Length = 203

 Score =  152 bits (384), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 47/185 (25%), Positives = 78/185 (42%), Gaps = 5/185 (2%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           SL E++SL+ +   C L  T  + +         +MIIG  P  ++++ G+PF G  G  
Sbjct: 18  SLEEIRSLMGNCQLCELGQTRSNLVFGVGDPHARVMIIGEGPGKNEDLQGEPFVGAAGKK 77

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           LD +L +  + R +++I+ +    PP NRN    E+E C P +  Q+  I P  ++ +GN
Sbjct: 78  LDALLGNAGLTRDEVYIANVVKCRPPSNRNPRPAEIEACSPFLREQVRSIWPDAIICLGN 137

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
               +    D        G+             L T HP   I +   +      L  L 
Sbjct: 138 FASQWVLKTDRGVMS-LRGRLHQQ----GHFVVLPTFHPAACIYHSEWQPLLEEDLRLLG 192

Query: 256 KALKN 260
             L+ 
Sbjct: 193 AWLRE 197


>gi|218782236|ref|YP_002433554.1| phage SPO1 DNA polymerase-related protein [Desulfatibacillum
           alkenivorans AK-01]
 gi|218763620|gb|ACL06086.1| phage SPO1 DNA polymerase-related protein [Desulfatibacillum
           alkenivorans AK-01]
          Length = 235

 Score =  152 bits (384), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 37/181 (20%), Positives = 75/181 (41%), Gaps = 5/181 (2%)

Query: 78  HELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLD 137
             L++   S  DC L    +  +         LM+ G  P   ++ +G PF G+ G +LD
Sbjct: 55  AGLEAEALSCTDCPLHKERIKGVFGQGDPEAALMLAGIAPGMEESKAGLPFQGEVGGLLD 114

Query: 138 KMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT 197
            +L+++ + R  +++  +     P       + +  C     +Q+E + P+++   G  T
Sbjct: 115 NILKAMGMTRDDVYLCNLVKCPVPDGELPDPMCLRACSRFFRKQVEAVRPQVICAFGQIT 174

Query: 198 KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKA 257
                  D     +  G+          +  + T HP+EL+  P  K+  WH +  + +A
Sbjct: 175 AEAILKQDL-PYSRVRGQLQPY----LGMRVMPTFHPRELLTAPQKKRAVWHDMQAIMRA 229

Query: 258 L 258
           +
Sbjct: 230 I 230


>gi|218460666|ref|ZP_03500757.1| putative uracil DNA glycosylase protein [Rhizobium etli Kim 5]
          Length = 329

 Score =  152 bits (383), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 41/239 (17%), Positives = 95/239 (39%), Gaps = 17/239 (7%)

Query: 35  ATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCS 94
           A+ ES+ +E +   A Q +     +       +      A +L  L++       C L +
Sbjct: 93  ASAESKVREMAAREATQSLPFHDRLQQAARNLSAEPELPAGTLEALRAEAAVCTRCPLHA 152

Query: 95  TSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISM 154
            +  T+        D+M +G  P D ++I+G+PF G  G + D+++    I R+ ++++ 
Sbjct: 153 NATQTVFGEGPRDADVMFVGEQPGDQEDIAGRPFVGPAGRLFDQVIGEAGIDRSTLYVTN 212

Query: 155 ISPWHPPG-------NRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQ 207
                          ++  +  E++ CR  +  ++ L+ PK+++ +G        +   +
Sbjct: 213 AVKHFKYEPRGKRRVHQKPNMGEVKHCRWWLDLELALVKPKLIVAMGATALAALTDVKGR 272

Query: 208 KTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIK------KNTWHALITLKKALKN 260
                 G+   +           TVHP  L++ P  +            ++ +++ +K 
Sbjct: 273 LQ-DVRGRAMAIE---GGRTLFVTVHPSYLLRIPDERLKAEEMARFREDMLEIQRLMKA 327


>gi|257785043|ref|YP_003180260.1| phage SPO1 DNA polymerase-like protein [Atopobium parvulum DSM
           20469]
 gi|257473550|gb|ACV51669.1| phage SPO1 DNA polymerase-related protein [Atopobium parvulum DSM
           20469]
          Length = 221

 Score =  151 bits (382), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 52/217 (23%), Positives = 86/217 (39%), Gaps = 7/217 (3%)

Query: 46  IDSAIQPITNIRHIHSPLVQQADSI--AQKACSLHELKSLLRSFHDCHLCSTSLSTICAT 103
             S   P   +       V+ +      Q   +L E+   +     C L  T  + +   
Sbjct: 2   AASPASPKNALGRKRMSNVEYSKIAYSKQAGQTLDEICEQIADCKKCPLWETRTNIVFGG 61

Query: 104 QTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGN 163
                 +MI+G  P  ++++SG+PF G +G  LD +L+ + +    + IS +    PP N
Sbjct: 62  PNPTARIMIVGEAPGKNEDLSGQPFVGTSGKKLDALLEEVGLSHQDVFISNVVKCRPPSN 121

Query: 164 RNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPH 223
           RN    E+E C P +  QI  I P +++ +GN    F  + D     +  GK+  +    
Sbjct: 122 RNPKVAEVEECSPYLRDQIRAIKPDVIVCLGNFATQFVMHTDKGV-TELRGKFYQI---- 176

Query: 224 SIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
                L T+HP   I      +     L  L   LK 
Sbjct: 177 GAFSVLPTMHPASTIYRKEWAQFLKDDLQLLADWLKK 213


>gi|118431039|ref|NP_147220.2| uracil-DNA glycosylase [Aeropyrum pernix K1]
 gi|116062365|dbj|BAA79385.2| uracil-DNA glycosylase [Aeropyrum pernix K1]
          Length = 227

 Score =  151 bits (382), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 40/178 (22%), Positives = 75/178 (42%), Gaps = 3/178 (1%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L +L+  +R    C L +T    +         +M++G  P   ++  G+PF G  G +L
Sbjct: 6   LRQLEEEVRRCTRCPLHATRTHAVPGEGPGEAGVMVVGEAPGRMEDRLGRPFVGPAGKLL 65

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
           D +L+   + R +++I+ +    PPGNR+    E+E C P ++ QI LI P++++ +G  
Sbjct: 66  DSLLELAGLSRGEVYITNVVKCRPPGNRDPREEEIEACLPYLVEQISLIRPRLVIAVGRH 125

Query: 197 TKNFFF---NNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
                F           +  G+          +    T HP   +  P ++       
Sbjct: 126 AGRTLFRLAGLRWPGLARARGRVWRGRIGGVELLIAVTYHPAAALYNPGLRGELERDF 183


>gi|300087337|ref|YP_003757859.1| phage SPO1 DNA polymerase-like protein [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
 gi|299527070|gb|ADJ25538.1| phage SPO1 DNA polymerase-related protein [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
          Length = 214

 Score =  151 bits (381), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 47/187 (25%), Positives = 86/187 (45%), Gaps = 6/187 (3%)

Query: 75  CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
            SL ++   + S   C L S     +        ++M IG  P  +++ +G+PF G  G 
Sbjct: 7   ASLEDIAREIGSCEACGLASGRNQAVPGEGHAETEIMFIGEAPGFNEDRTGRPFCGAAGQ 66

Query: 135 MLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
            L +M++SI + R Q++I+ I    PPGNR+    E+  CR  + RQ+  I P++++ +G
Sbjct: 67  FLTQMIESIGLNRNQVYITNIVKCRPPGNRDPLPEEITACRHWLDRQLAAIRPRVVVTLG 126

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITL 254
             + + FF    +   +  G+W         +  LA  HP   +    ++      +  L
Sbjct: 127 RYSMSRFF--PGKTISRIHGQW----EKQGDLVCLAMYHPAAALHQGSLRATILADMARL 180

Query: 255 KKALKNL 261
            + +K L
Sbjct: 181 PEIIKEL 187


>gi|15806754|ref|NP_295474.1| DNA polymerase-like protein [Deinococcus radiodurans R1]
 gi|6459521|gb|AAF11304.1|AE002016_6 DNA polymerase-related protein [Deinococcus radiodurans R1]
          Length = 237

 Score =  151 bits (381), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 45/210 (21%), Positives = 87/210 (41%), Gaps = 10/210 (4%)

Query: 58  HIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTP 117
                 + QA      A  L  L+   R    C L  ++   + +       L+I+G  P
Sbjct: 6   PPPRHPLHQAADPPDPAA-LLALEDRNRGCAACPLRVSASQVVVSDGDPRAPLLIVGEGP 64

Query: 118 SDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRP- 176
              ++  G+PF G+ G +LD++L +  + R + +++ ++    P NR    +E   C   
Sbjct: 65  GAEEDRDGRPFVGQAGQLLDRILAAASLAREEAYLTNVTKCRAPNNRTPLPLETATCTGL 124

Query: 177 IIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIP--TLATVHP 234
            +  Q+ L+ P+++L +GN    F      +   +  G+W     P    P   +  +HP
Sbjct: 125 WLEPQLALLRPRVVLSLGNTATQFLLG-TPRGITRLRGQWFTYRHPAWPQPALLMPLLHP 183

Query: 235 QELIQYPLI-----KKNTWHALITLKKALK 259
             L++ P+      K  TW  +  +   L+
Sbjct: 184 AYLLRNPVRTPGGPKSLTWRDIREVAAVLR 213


>gi|84622266|ref|YP_449638.1| DNA polymerase related protein [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|84366206|dbj|BAE67364.1| DNA polymerase related protein [Xanthomonas oryzae pv. oryzae MAFF
           311018]
          Length = 482

 Score =  151 bits (381), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 50/267 (18%), Positives = 90/267 (33%), Gaps = 37/267 (13%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIH 60
           M  K   +  +  ++     ++GV         E   E  R+      A QP T      
Sbjct: 225 MPQKYWKNLPEAASLPELIREAGVRV---REMAERAPEPVRRRVPAAPAPQPDTTTH--- 278

Query: 61  SPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDS 120
                          SL +L+S  R    C L   +  T+     +   +M+IG  P D 
Sbjct: 279 ---------------SLAQLRSAARDCRRCELWQPATQTVFGEGPDDASVMVIGEQPGDE 323

Query: 121 DNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPG-------NRNLSNIEMEI 173
           +++SG+PF G  G +    L  + + R + +++                +RN     ++ 
Sbjct: 324 EDLSGRPFVGPAGRLFTMALGELGVDRQRFYVTNAVKHFRFEQRGKRRLHRNPERAHLQA 383

Query: 174 CRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVH 233
           C   +  +   + P  ++ +G             +  Q  G+W  L       P L TVH
Sbjct: 384 CSGWLQAERTQLRPAQIVCLGATAAQAVLGRSGFRLMQERGQWQRL---DDGTPVLTTVH 440

Query: 234 PQELIQYPLIK------KNTWHALITL 254
           P  +++ P         +     L  L
Sbjct: 441 PSWVLRQPSTDAREEGYRGFVEDLRQL 467


>gi|188578772|ref|YP_001915701.1| uracil DNA glycosylase superfamily protein [Xanthomonas oryzae pv.
           oryzae PXO99A]
 gi|188523224|gb|ACD61169.1| uracil DNA glycosylase superfamily protein [Xanthomonas oryzae pv.
           oryzae PXO99A]
          Length = 477

 Score =  151 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 50/267 (18%), Positives = 90/267 (33%), Gaps = 37/267 (13%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIH 60
           M  K   +  +  ++     ++GV         E   E  R+      A QP T      
Sbjct: 220 MPQKYWKNLPEAASLPELIREAGVRV---REMAERAPEPVRRRVPAAPAPQPDTTTH--- 273

Query: 61  SPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDS 120
                          SL +L+S  R    C L   +  T+     +   +M+IG  P D 
Sbjct: 274 ---------------SLAQLRSAARDCRRCELWQPATQTVFGEGPDDASVMVIGEQPGDE 318

Query: 121 DNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPG-------NRNLSNIEMEI 173
           +++SG+PF G  G +    L  + + R + +++                +RN     ++ 
Sbjct: 319 EDLSGRPFVGPAGRLFTMALGELGVDRQRFYVTNAVKHFRFEQRGKRRLHRNPERAHLQA 378

Query: 174 CRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVH 233
           C   +  +   + P  ++ +G             +  Q  G+W  L       P L TVH
Sbjct: 379 CSGWLQAERTQLRPAQIVCLGATAAQAVLGRSGFRLMQERGQWQRL---DDGTPVLTTVH 435

Query: 234 PQELIQYPLIK------KNTWHALITL 254
           P  +++ P         +     L  L
Sbjct: 436 PSWVLRQPSTDAREEGYRGFVEDLRQL 462


>gi|192290395|ref|YP_001991000.1| phage SPO1 DNA polymerase-related protein [Rhodopseudomonas
           palustris TIE-1]
 gi|192284144|gb|ACF00525.1| phage SPO1 DNA polymerase-related protein [Rhodopseudomonas
           palustris TIE-1]
          Length = 495

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 42/231 (18%), Positives = 88/231 (38%), Gaps = 20/231 (8%)

Query: 37  YESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTS 96
             ++RK  ++ +A            P + +A+    KA +L  L+   +    C L   +
Sbjct: 262 EHAERKAHAMVAAEATAPRKPQRQEPPMTRAE---PKADTLAHLREEAKDCRACDLWKDA 318

Query: 97  LSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMIS 156
             T+     +   +M++G  P D ++++GKPF G  G MLD+ L    + R++ +++   
Sbjct: 319 TQTVFGEGPQHATVMLVGEQPGDKEDLAGKPFVGPAGQMLDRALAEAGVDRSKTYVTNAV 378

Query: 157 PWHPPG-------NRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKT 209
                        ++  +  E++ CR    R++  + P +++ +G               
Sbjct: 379 KHFKFVPRGKIRLHQKPATPEIKACRQWYERELAAVQPLLVVAMGATAAQSVLG-RITPI 437

Query: 210 YQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTW------HALITL 254
            +  G+  +          L TVHP  L++ P               L  +
Sbjct: 438 NKTRGRLID---RDDGPQVLVTVHPSYLLRLPDADAKAREYARFVEDLKLI 485


>gi|167043274|gb|ABZ07980.1| putative Uracil DNA glycosylase superfamily protein [uncultured
           marine crenarchaeote HF4000_ANIW141M12]
          Length = 191

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 41/185 (22%), Positives = 79/185 (42%), Gaps = 6/185 (3%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L  ++  +++   C LC T  + +     +  D++ IG  P  ++++ G+PF G  G  L
Sbjct: 7   LEIIQEKVKTCEKCDLCITRKNAVPGKGNQNADIVFIGEAPGKNEDLRGEPFIGTAGKKL 66

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
           D  L+++ + R  ++I+ I    PP NR  +++E  +C   +  ++ +I+PKI+  +G+ 
Sbjct: 67  DDALKNVGLTRNSVYITNIVKCRPPKNRIPNDLEKIMCSNYLEGELAIINPKIICLLGST 126

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
                             K               T HP   I    + K   + +  L K
Sbjct: 127 AFYSILGGKEIS------KHHGKFVSKDNRMYFVTFHPAAAIYNQKLGKVFKNDIKKLMK 180

Query: 257 ALKNL 261
            L+ L
Sbjct: 181 ELQKL 185


>gi|316935046|ref|YP_004110028.1| phage SPO1 DNA polymerase-like protein [Rhodopseudomonas palustris
           DX-1]
 gi|315602760|gb|ADU45295.1| phage SPO1 DNA polymerase-related protein [Rhodopseudomonas
           palustris DX-1]
          Length = 517

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 40/232 (17%), Positives = 81/232 (34%), Gaps = 17/232 (7%)

Query: 42  KEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTIC 101
            E+   + +              Q       KA +L  L+   +    C L   +  T+ 
Sbjct: 286 AERKAHAMVAAEATAPRKPQRQEQPMTRAKPKADTLAHLREEAKDCRACDLWKDATQTVF 345

Query: 102 ATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPP 161
               +   +M++G  P D ++++GKPF G  G MLD+ L    + R++ +++        
Sbjct: 346 GEGPQHATVMLVGEQPGDKEDLAGKPFVGPAGQMLDRALAEAGVDRSKTYVTNAVKHFKF 405

Query: 162 G-------NRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLG 214
                   ++  +  E++ CR    R++  + P +++ +G                   G
Sbjct: 406 VPRGKIRLHQKPNTPEIKACRQWYERELAAVQPLLVVAMGATAAQSVLGKVTPINAN-RG 464

Query: 215 KWSNLCTPHSIIPTLATVHPQELIQYPLIKKN------TWHALITLKKALKN 260
              +          L TVHP  L++ P  +            L  +   L+ 
Sbjct: 465 HLID---RDDGPQVLVTVHPSYLLRLPDAEAKEREYARFVDDLKIVAAHLRK 513


>gi|88808859|ref|ZP_01124368.1| phage SPO1 DNA polymerase-related protein [Synechococcus sp. WH
           7805]
 gi|88786801|gb|EAR17959.1| phage SPO1 DNA polymerase-related protein [Synechococcus sp. WH
           7805]
          Length = 191

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 45/190 (23%), Positives = 76/190 (40%), Gaps = 11/190 (5%)

Query: 75  CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
            +L  L S   +   C L       +      G DLM+IG  P   ++  G PF G++G 
Sbjct: 2   KALDALNSQCAACRRCDLAHHRQKAVVGRGNPGSDLMLIGEAPGADEDSLGLPFVGRSGR 61

Query: 135 MLDKMLQSIEIMRTQI-HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFI 193
           +L  +L+  E+   Q  +I  +    PP NR  +  E+  CRP +  Q+EL++P ++L  
Sbjct: 62  LLSALLKEAELDEDQDLYICNVIKCRPPNNRKPTLEEIRQCRPWLEEQLELVNPSLVLMA 121

Query: 194 GNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIK-----KNTW 248
           G           +    +  G+W            +   HP  L+++   +       T 
Sbjct: 122 GATALKALLGIKS-GISKLRGQWHEQE----GRAFMPVFHPSYLLRFQSREAGSPQALTL 176

Query: 249 HALITLKKAL 258
             L   K+ L
Sbjct: 177 QDLQEAKRRL 186


>gi|330834083|ref|YP_004408811.1| phage SPO1 DNA polymerase-related protein [Metallosphaera cuprina
           Ar-4]
 gi|329566222|gb|AEB94327.1| phage SPO1 DNA polymerase-related protein [Metallosphaera cuprina
           Ar-4]
          Length = 206

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 39/186 (20%), Positives = 81/186 (43%), Gaps = 4/186 (2%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           + ++++ + +   CHL  T    +        +++++G  P   ++ +G+PF G  G +L
Sbjct: 1   MQDIRNQVINCKKCHLHKTRTYAVPGEGNTNSEIVLVGEAPGAKEDRTGRPFVGAAGQLL 60

Query: 137 DKMLQSI-EIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           D+++Q    I R  + I+ +    PP NR+ S  E+  C P ++ QI LI PKI++ +G 
Sbjct: 61  DELIQRYLRIERDSVFITNLVKCRPPNNRDPSEDEIVTCSPYLLAQINLIKPKIIVTLGR 120

Query: 196 KTK---NFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALI 252
            +          + +   +  GK   +      +    + HP   +    +K        
Sbjct: 121 HSTRFFQNLAKVEEESISKCHGKPFYINLSFGTVRVFPSYHPAAALYNRSLKSELEKDFQ 180

Query: 253 TLKKAL 258
            L + +
Sbjct: 181 LLSRLI 186


>gi|162146549|ref|YP_001601008.1| uracil-DNA glycosylase [Gluconacetobacter diazotrophicus PAl 5]
 gi|161785124|emb|CAP54669.1| putative uracil-DNA glycosylase [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 309

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 69/269 (25%), Positives = 113/269 (42%), Gaps = 20/269 (7%)

Query: 11  QILTIALFYADSGVYWVFD-EPNNEATYESQRKEK---SIDSAIQPITNIRHIHSPLVQQ 66
             L +   YA+ G    FD  P +          +          P    R      V+ 
Sbjct: 37  DALALLQLYAEWGADVAFDDSPTDRLAARPPPPARAGIPPARDDAPSPPARPAGRAAVEP 96

Query: 67  ADSI-------------AQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMII 113
            D +             A  A +L  L + L +F  C L  T+  T+      G  L++I
Sbjct: 97  DDGLTLVERAIRQARDAAAAAENLPALHAALAAFGGCALRDTATHTVVPEGPAGARLLLI 156

Query: 114 GYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEI 173
           G  P  +++ SG  F+G  G +LD+ML SI + RT + ++ + PW PPG R  S  E++I
Sbjct: 157 GEPPDAAEDRSGTAFAGPAGQILDRMLTSIGLARTDMLLAPVIPWRPPGERPPSAAELQI 216

Query: 174 CRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSI--IPTLAT 231
           C P + R I L +P+ ++ +GN         +     +  G+W ++  P     IP L  
Sbjct: 217 CAPFLHRLIVLANPRRIILMGNTPAR-LLTGEQGGIARLRGRWRDVAIPGLGRAIPILPM 275

Query: 232 VHPQELIQYPLIKKNTWHALITLKKALKN 260
            HP +L   P  +++ W  ++ L+  L  
Sbjct: 276 RHPSQLGASPAARRDAWKDIVLLRTTLDQ 304


>gi|209543453|ref|YP_002275682.1| phage SPO1 DNA polymerase-like protein [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209531130|gb|ACI51067.1| phage SPO1 DNA polymerase-related protein [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 274

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 68/269 (25%), Positives = 112/269 (41%), Gaps = 20/269 (7%)

Query: 11  QILTIALFYADSGVYWVFDEPNNEATYESQRKEK----SIDSAIQPITNIRHIHSPLVQQ 66
             L +   YA+ G    FD+   +                     P    R      V+ 
Sbjct: 2   DALALLQLYAEWGADVAFDDSPTDHLAARPPPPARAGIPPARDDAPSPPARPAGRAAVEP 61

Query: 67  ADSI-------------AQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMII 113
            D +             A  A +L  L + L +F  C L  T+  T+      G  L++I
Sbjct: 62  DDGLTLVERAIRQARDAAAAAENLPALHAALAAFGGCALRDTATHTVVPEGPAGARLLLI 121

Query: 114 GYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEI 173
           G  P  +++ SG  F+G  G +LD+ML SI + RT + ++ + PW PPG R  S  E++I
Sbjct: 122 GEPPDAAEDRSGTAFAGPAGQILDRMLTSIGLARTDMLLAPVIPWRPPGERPPSAAELQI 181

Query: 174 CRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSI--IPTLAT 231
           C P + R I L +P+ ++ +GN         +     +  G+W ++  P     IP L  
Sbjct: 182 CAPFLHRLIVLANPRRIILMGNTPAR-LLTGEQGGIARLRGRWRDVAIPGLGRAIPILPM 240

Query: 232 VHPQELIQYPLIKKNTWHALITLKKALKN 260
            HP +L   P  +++ W  ++ L+  L  
Sbjct: 241 RHPSQLGASPAARRDAWKDIVLLRTTLDQ 269


>gi|39934868|ref|NP_947144.1| Uracil-DNA glycosylase:Phage SPO1 DNA polymerase-like protein
           [Rhodopseudomonas palustris CGA009]
 gi|39648718|emb|CAE27240.1| Uracil-DNA glycosylase:Phage SPO1 DNA polymerase-related protein
           [Rhodopseudomonas palustris CGA009]
          Length = 495

 Score =  149 bits (377), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 41/231 (17%), Positives = 87/231 (37%), Gaps = 20/231 (8%)

Query: 37  YESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTS 96
             ++RK  ++ +A            P + +A+    KA +L  L+   +    C L   +
Sbjct: 262 EHAERKAHAMVAAEATAPRKPQRQEPPMTRAE---PKADTLAHLREEAKDCRACDLWKDA 318

Query: 97  LSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMIS 156
             T+     +   +M++G  P D ++++G+PF G  G MLD+ L    + R++ +++   
Sbjct: 319 TQTVFGEGPQHATVMLVGEQPGDKEDLAGQPFVGPAGQMLDRALAEAGVDRSKTYVTNAV 378

Query: 157 PWHPPG-------NRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKT 209
                        ++  +  E++ CR    R++  + P +++ +G               
Sbjct: 379 KHFKFVPRGKIRLHQKPATPEIKACRQWYERELAAVQPLLVVAMGATAAQSVLG-RITPI 437

Query: 210 YQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTW------HALITL 254
            +  G   +          L TVHP  L++ P               L  +
Sbjct: 438 NKTRGHLID---RDDGPQVLVTVHPSYLLRLPDADAKAREYARFVEDLKLI 485


>gi|260654357|ref|ZP_05859847.1| uracil-DNA glycosylase [Jonquetella anthropi E3_33 E1]
 gi|260630990|gb|EEX49184.1| uracil-DNA glycosylase [Jonquetella anthropi E3_33 E1]
          Length = 195

 Score =  149 bits (377), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 36/183 (19%), Positives = 72/183 (39%), Gaps = 6/183 (3%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKM 139
           L   L     C L + + + +  +      ++++G  P  +++ SG PF G +G +L ++
Sbjct: 2   LARELAGCSRCGLRAGAKAPVFGSGPRESRVVLVGEAPGAAEDESGIPFVGASGRLLSQL 61

Query: 140 LQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKN 199
           L+   + R ++ I+      PP NR     E+  C   + RQ+E+I P  ++ +GN    
Sbjct: 62  LEESGLRRDELFITNAVKCRPPDNRTPQKDELSCCLCWLRRQLEMIRPDGIITVGNVPSR 121

Query: 200 FFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKK-----NTWHALITL 254
                  +      G++ +L             HP  L++    +       T   L  +
Sbjct: 122 ALLG-RREGVTALRGRFYSLEIGGRTAWVRPIFHPAYLLRNRTRRPGSPILLTLEDLKDV 180

Query: 255 KKA 257
              
Sbjct: 181 ACR 183


>gi|258646788|ref|ZP_05734257.1| uracil-DNA glycosylase, family 4 [Dialister invisus DSM 15470]
 gi|260404216|gb|EEW97763.1| uracil-DNA glycosylase, family 4 [Dialister invisus DSM 15470]
          Length = 248

 Score =  149 bits (377), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 49/188 (26%), Positives = 81/188 (43%), Gaps = 12/188 (6%)

Query: 80  LKSLLRSFHDCHLC-STSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           L++ +     C LC       + +T      LMI+G  P   ++  G P  G +G +LDK
Sbjct: 33  LENAIHRCRLCPLCNEGGRGPVLSTGPVDAPLMIVGEGPGGVEDEYGGPLVGPSGQLLDK 92

Query: 139 MLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEIC-RPIIMRQIELISPKILLFIGNKT 197
            L S+ I R  ++++ I    P GNR  +  E   C R  +  +I L+ PK+++ +G   
Sbjct: 93  ALLSVGITRDHVYVTNIVKCRPRGNRTPTIAEGNECGRRWLAEEIRLLQPKVIIALGKVA 152

Query: 198 KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP-----LIKKNTWHALI 252
             FF  +DA    ++ G W +       IP + T HP  L++         K   ++ L 
Sbjct: 153 LRFFLGHDA-GIIRSRGHWIDY----KGIPVMPTFHPAYLLRQTGEGLKEAKWQVYYDLK 207

Query: 253 TLKKALKN 260
             K     
Sbjct: 208 AAKDRAAE 215


>gi|325926412|ref|ZP_08187737.1| uracil-DNA glycosylase, family 4 [Xanthomonas perforans 91-118]
 gi|325543201|gb|EGD14639.1| uracil-DNA glycosylase, family 4 [Xanthomonas perforans 91-118]
          Length = 478

 Score =  149 bits (376), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 44/267 (16%), Positives = 93/267 (34%), Gaps = 38/267 (14%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIH 60
           M  K   +  +   +     ++GV          A    +   + + +A  P+ ++    
Sbjct: 225 MPQKYWKNLPEATLLPELIREAGVRV-----REMAERAPEPVRRRVPAAPAPLPDVAT-- 277

Query: 61  SPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDS 120
                          SL +L++  R    C L   +  T+     +   +M+IG  P D 
Sbjct: 278 --------------QSLAQLRTAARDCRRCELWQPATQTVFGEGPDDASVMVIGEQPGDE 323

Query: 121 DNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPG-------NRNLSNIEMEI 173
           +++SG+PF G  G + +  L  + + R + +++                +RN     ++ 
Sbjct: 324 EDLSGRPFVGPAGRLFNMALGELGVDREKFYVTNAVKHFRFEQRGKRRLHRNPERTHVQA 383

Query: 174 CRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVH 233
           C   +  +   + P  ++ +G         +  +   +  G+W  L       P L TVH
Sbjct: 384 CSGWLQAERAQLRPAQIVCLGATAAQAILGSSFRLM-RERGQWHRL---DDGTPVLTTVH 439

Query: 234 PQELIQYPLIK------KNTWHALITL 254
           P  +++ P         +     L  L
Sbjct: 440 PSWVLRQPSTDAREEGYRGFVEDLRRL 466


>gi|320162563|ref|YP_004175788.1| uracil-DNA glycosylase [Anaerolinea thermophila UNI-1]
 gi|319996417|dbj|BAJ65188.1| uracil-DNA glycosylase [Anaerolinea thermophila UNI-1]
          Length = 217

 Score =  149 bits (376), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 45/184 (24%), Positives = 75/184 (40%), Gaps = 6/184 (3%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L E+   +     C L  +    +        ++M+IG  P   +N  G+PF G  G  L
Sbjct: 7   LKEIAQQVSECKRCQLHYSRKKAVPGEGPAQAEIMMIGEGPGFYENEQGRPFVGAAGKFL 66

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
           D++L+   I R  + I+ +    PPGNR+    E+E C   + RQIE ISPK+++ +G  
Sbjct: 67  DELLEKCGIARKDVFITNVVKCRPPGNRDPQPEELEACNAYLERQIEAISPKVIVTLGRF 126

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
           +   F              W N          +   HP   +  P +K +       L +
Sbjct: 127 SMAKFLPGVKISEVHGQSFWRN------GRLIVPMFHPAAALHQPSLKASVERDFARLSE 180

Query: 257 ALKN 260
            ++ 
Sbjct: 181 YVQA 184


>gi|289524505|ref|ZP_06441359.1| uracil-DNA glycosylase [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
 gi|289502255|gb|EFD23419.1| uracil-DNA glycosylase [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
          Length = 146

 Score =  149 bits (376), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 38/150 (25%), Positives = 67/150 (44%), Gaps = 4/150 (2%)

Query: 88  HDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR 147
             C L      ++    ++  +LM +G  P   +++ G PF GK G +L+++  +  I R
Sbjct: 1   RKCPLSENRTQSVFGEGSKKTELMFVGEGPGADEDLQGLPFVGKAGQLLNQIFAAAGIDR 60

Query: 148 TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQ 207
           ++++I+ +    PP NR  +  E   C   +  QI L+ PKIL+ +GN    +      +
Sbjct: 61  SEVYITNVVKCRPPQNRVPTVEECSACNDYLFAQISLVQPKILVTLGNTPTKWLLKTTHE 120

Query: 208 KTYQNLGKWSNLCTPHSIIPTLATVHPQEL 237
              Q  GK  +       I  +   HP  L
Sbjct: 121 GITQLRGKCFDWY----GIKLMPMFHPSYL 146


>gi|260436026|ref|ZP_05789996.1| uracil-DNA glycosylase [Synechococcus sp. WH 8109]
 gi|260413900|gb|EEX07196.1| uracil-DNA glycosylase [Synechococcus sp. WH 8109]
          Length = 187

 Score =  149 bits (375), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 41/189 (21%), Positives = 75/189 (39%), Gaps = 12/189 (6%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L  L     +   C L +T  + + +      DLM+IG  P   ++  G PF G++G  
Sbjct: 2   TLSSL-EACSACTACDLATTRHTVVMSRGNPKADLMLIGEAPGAQEDSQGVPFVGRSGRA 60

Query: 136 LDKMLQSIEI-MRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           LD++L+ +++     ++I       PP NR     E+  CR  +  Q+E + P +++  G
Sbjct: 61  LDQLLRDVDLDPEHDLYICNAIKCRPPNNRRPKKAELAACRAWLDLQLETVDPTVIVLTG 120

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKK-----NTWH 249
                           Q  G+W +          +   HP  L++ P          T  
Sbjct: 121 ATAVEAILGIKG-GMTQLRGQWQSWNERA----VMPIFHPSYLLRNPSKAAGAPLDLTRQ 175

Query: 250 ALITLKKAL 258
            L  +++ L
Sbjct: 176 DLDAVRRRL 184


>gi|209550293|ref|YP_002282210.1| phage SPO1 DNA polymerase-related protein [Rhizobium leguminosarum
           bv. trifolii WSM2304]
 gi|209536049|gb|ACI55984.1| phage SPO1 DNA polymerase-related protein [Rhizobium leguminosarum
           bv. trifolii WSM2304]
          Length = 484

 Score =  148 bits (374), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 41/239 (17%), Positives = 95/239 (39%), Gaps = 17/239 (7%)

Query: 35  ATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCS 94
           A+ ESQ +  +   A Q +     +              A +L  L +   +   C L +
Sbjct: 248 ASAESQVRAMAAREATQSLPFHDRLQEAARNLPIEPEAPAGTLEALSAEAGACTRCPLHA 307

Query: 95  TSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISM 154
            +  T+        ++M +G  P D ++I+G+PF G  G +LD+++  + I R+ ++++ 
Sbjct: 308 KATQTVFGEGPRDAEVMFVGEQPGDQEDIAGRPFVGPAGKLLDQVIADVGIDRSALYVTN 367

Query: 155 ISPWHPPG-------NRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQ 207
                          ++  +  E++ CR  +  ++ L+ PK+++ +G        +   +
Sbjct: 368 AVKHFKYEPRGKRRIHQKPNMGEVKHCRWWLDLELALVKPKLIVAMGATALAALTDVKER 427

Query: 208 KTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWH------ALITLKKALKN 260
                 GK   +           TVHP  L++ P  +            ++ +++ + +
Sbjct: 428 LQ-DVRGKAMAIE---GGRTLFVTVHPSYLLRIPDERLKAEEMVRFRNDMLEIQRLMAS 482


>gi|110635173|ref|YP_675381.1| phage SPO1 DNA polymerase-related protein [Mesorhizobium sp. BNC1]
 gi|110286157|gb|ABG64216.1| phage SPO1 DNA polymerase-related protein [Chelativorans sp. BNC1]
          Length = 206

 Score =  148 bits (374), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 35/200 (17%), Positives = 74/200 (37%), Gaps = 17/200 (8%)

Query: 73  KACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKT 132
           K  +L  ++   +    C L   +  T+         ++ +G  P D +++ G+PF G  
Sbjct: 10  KLKTLDAVREDAQDCTRCDLYKNATQTVFGEGGNQARVVFVGEQPGDKEDVEGRPFVGPA 69

Query: 133 GNMLDKMLQSIEIMRTQIHISMISPWHPPG-------NRNLSNIEMEICRPIIMRQIELI 185
           G M D +L+ + I R + +++                +   +  E+  CR  + +++ LI
Sbjct: 70  GRMFDAILEEVGIDRKKTYVTNAVKHFKFELRGKRRIHSKPNAGEIRACRWWLDQELTLI 129

Query: 186 SPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLI-- 243
            P + + +G                   G  +        +P   TVHP  L++ P    
Sbjct: 130 QPDVAVALGATAARALVGKAVPVMT-LRGTITE---SAEGVPVFITVHPSSLLRVPDEMD 185

Query: 244 KKNTW----HALITLKKALK 259
           ++         +  +K  +K
Sbjct: 186 RRRARELFAEDMRKVKALMK 205


>gi|85716683|ref|ZP_01047652.1| phage SPO1 DNA polymerase-related protein [Nitrobacter sp. Nb-311A]
 gi|85696523|gb|EAQ34412.1| phage SPO1 DNA polymerase-related protein [Nitrobacter sp. Nb-311A]
          Length = 236

 Score =  148 bits (373), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 39/201 (19%), Positives = 76/201 (37%), Gaps = 17/201 (8%)

Query: 72  QKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGK 131
               SL  L++       C L   +   +         +M++G  P D ++++GKPF G 
Sbjct: 35  APPPSLAGLRAQAAGCRACPLWKDATQIVFGEGPAHAQIMLMGEQPGDREDLAGKPFVGP 94

Query: 132 TGNMLDKMLQSIEIMRTQIHISMISPWHPPG-------NRNLSNIEMEICRPIIMRQIEL 184
            G MLD+ L+   I R +++++                ++  +  E+  CR    R++  
Sbjct: 95  AGQMLDRALKEAGIDRKKVYVTNAVKHFKFVPRGKIRLHQKPNTPEIRACRQWYERELAT 154

Query: 185 ISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIK 244
           I+P +++ +G+      F        ++ G   ++         L TVHP  L++ P   
Sbjct: 155 INPALVVAMGSTAAQSVFG-KITPINKSRGHLIDMK---DGRKALVTVHPSYLLRLPDQD 210

Query: 245 KNTWH------ALITLKKALK 259
                       L      L+
Sbjct: 211 SRAREYERFVDDLKIAATQLQ 231


>gi|78212827|ref|YP_381606.1| phage SPO1 DNA polymerase-related protein [Synechococcus sp.
           CC9605]
 gi|78197286|gb|ABB35051.1| phage SPO1 DNA polymerase-related protein [Synechococcus sp.
           CC9605]
          Length = 187

 Score =  148 bits (373), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 39/183 (21%), Positives = 73/183 (39%), Gaps = 11/183 (6%)

Query: 82  SLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQ 141
               +   C L S+  + + +      DLM+IG  P   ++  G PF G++G  LD++L+
Sbjct: 7   EACSACTACDLASSRQTVVISRGNPKADLMLIGEAPGAQEDAQGVPFVGRSGCALDQLLR 66

Query: 142 SIEI-MRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNF 200
            +++     ++I       PP NR     E+  CR  +  Q+E + PK+++  G      
Sbjct: 67  DVDLDPEHDLYICNAIKCRPPNNRRPKKTELAACRAWLDLQLEAVDPKVIVLTGATAVEA 126

Query: 201 FFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKK-----NTWHALITLK 255
                     +  G+W +          +   HP  L++ P          T   L  ++
Sbjct: 127 ILGIKG-GMTRLRGEWQSWN----GREVMPIFHPSYLLRNPSKAAGAPLDLTRQDLSAVR 181

Query: 256 KAL 258
           + L
Sbjct: 182 RRL 184


>gi|33865707|ref|NP_897266.1| Uracil-DNA glycosylase [Synechococcus sp. WH 8102]
 gi|33632877|emb|CAE07688.1| Uracil-DNA glycosylase [Synechococcus sp. WH 8102]
          Length = 187

 Score =  148 bits (373), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 43/186 (23%), Positives = 78/186 (41%), Gaps = 12/186 (6%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           EL+        C L  T    + +       LM+IG  P   ++  G+PF G++G +LD+
Sbjct: 5   ELRD-CEQCTGCDLALTRERVVISRGAATAPLMLIGEAPGAREDALGQPFVGRSGQLLDR 63

Query: 139 MLQSIEI-MRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT 197
           +LQ + +   + ++I       PP NR     E+  CRP +  QI+ ++P++++ +G   
Sbjct: 64  LLQDVGLNPESDLYICNAVKCRPPQNRRPKRAELTACRPWLDHQIDQVNPRVIVLLGATA 123

Query: 198 KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIK-----KNTWHALI 252
                        Q  G+W +          +   HP  L++ P          T   L 
Sbjct: 124 VESLLGIKG-GMTQLRGQWLSWDGRD----VMPIFHPSYLLRNPSKASDAPTALTRSDLS 178

Query: 253 TLKKAL 258
           T+++ L
Sbjct: 179 TVQQRL 184


>gi|94496521|ref|ZP_01303097.1| Uracil-DNA glycosylase superfamily protein [Sphingomonas sp. SKA58]
 gi|94423881|gb|EAT08906.1| Uracil-DNA glycosylase superfamily protein [Sphingomonas sp. SKA58]
          Length = 476

 Score =  148 bits (373), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 40/243 (16%), Positives = 82/243 (33%), Gaps = 20/243 (8%)

Query: 32  NNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCH 91
            +       R+   I SA +         +       +          ++        C 
Sbjct: 240 PDLVAGAQAREAAMIASAPRAPAQPGGGKAGKAGAGGNSGTA---WAAVREEALGCTRCP 296

Query: 92  LCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIH 151
           L   +  T+         LM IG  P D ++ +G+PF G  G +LD+ L    + R + +
Sbjct: 297 LHQGATQTVFGEGPLDAPLMFIGEQPGDQEDQAGRPFVGPAGQLLDQALIEAGVDRARAY 356

Query: 152 ISMISPWHPPG-------NRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNN 204
           ++                ++     E++ CR  + ++++++ P++++ +G          
Sbjct: 357 VTNAVKHFKFEARGKRRIHQTPDAGEVQACRWWLTQELDIVRPRLIVALGATAARAMLG- 415

Query: 205 DAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTW------HALITLKKAL 258
            A    +  G    L           TVHP  L++ P   K           L  + + +
Sbjct: 416 KAVTISRTRGSAITLDNGAEG---WVTVHPSYLLRVPDEAKKAEERARFVEDLRVIGERV 472

Query: 259 KNL 261
           K L
Sbjct: 473 KAL 475


>gi|268323165|emb|CBH36753.1| conserved hypothetical protein, uracil-DNA glycosylase superfamily
           [uncultured archaeon]
          Length = 195

 Score =  148 bits (373), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 46/182 (25%), Positives = 82/182 (45%), Gaps = 3/182 (1%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKM 139
           ++  ++    C L  T  + +         ++ +G  P  ++++ GKPF GK G +LD++
Sbjct: 10  IEKEIKDCKRCELWKTRTNPVVGEGALSARILFVGEAPGYNEDLKGKPFVGKAGKVLDEL 69

Query: 140 LQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKN 199
           L+SI   R  I+I+ +    PPGNRN    E+  C P +  Q+ELI P ++  +GN +  
Sbjct: 70  LESIGWQRANIYITNVLKCRPPGNRNPLTDEIRACTPFLDAQLELIEPAVIATLGNFSLA 129

Query: 200 FF---FNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
           +    F    +K  +  G    + T   I   +   HP  +   P +K+        L  
Sbjct: 130 YIFAKFQLKPEKIGEIHGNVFTVSTIAGIKRIIPLYHPAVVTYNPKMKEVLIDDFKVLAN 189

Query: 257 AL 258
            +
Sbjct: 190 TI 191


>gi|269925234|ref|YP_003321857.1| phage SPO1 DNA polymerase-related protein [Thermobaculum terrenum
           ATCC BAA-798]
 gi|269788894|gb|ACZ41035.1| phage SPO1 DNA polymerase-related protein [Thermobaculum terrenum
           ATCC BAA-798]
          Length = 206

 Score =  148 bits (373), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 41/195 (21%), Positives = 72/195 (36%), Gaps = 19/195 (9%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
            L  ++        C L  T    +      G  +M +G  P + ++ +G PF G+ G +
Sbjct: 11  ELDRVREEALFCQRCTLWQTRTQVVFGAGKAGSKIMFVGEAPGEDEDRTGTPFVGRAGIL 70

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPG-------NRNLSNIEMEICRPIIMRQIELISPK 188
           LD++L+   I R   +I+ I    P         NR     E+  C P +  +I L+ P 
Sbjct: 71  LDQLLEEAGIGRESTYITNIIRCRPTAVTQGKITNRAPRAGEVSACEPWMWLEIHLVKPS 130

Query: 189 ILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ--------Y 240
           +++ +G        + + +      G           I  +AT+HP  L++        Y
Sbjct: 131 VIVCVGAPAAKTLIDKNFRL-SDQRGDVYE---KEDGIRYIATLHPAYLLRLLSTDTEAY 186

Query: 241 PLIKKNTWHALITLK 255
              K      L   K
Sbjct: 187 QRAKGLVLQDLKKAK 201


>gi|146339650|ref|YP_001204698.1| putative Uracil-DNA glycosylase [Bradyrhizobium sp. ORS278]
 gi|146192456|emb|CAL76461.1| Putative Uracil-DNA glycosylase [Bradyrhizobium sp. ORS278]
          Length = 493

 Score =  147 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 45/231 (19%), Positives = 90/231 (38%), Gaps = 19/231 (8%)

Query: 35  ATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCS 94
           A   ++  +         +T     H+P  + +  +  +A  L  L+    +   C L  
Sbjct: 257 ADEGTEPHKPQKRVEETAMTRKPKAHAPAAETSRDV--EAVDLQTLREEAAACRACPLWK 314

Query: 95  TSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISM 154
            +  T+     E   LM++G  P D ++++G PF G  G MLD+ L    I R++++++ 
Sbjct: 315 DATQTVFGEGPEHAPLMLVGEQPGDKEDLAGHPFVGPAGQMLDRALAEAGIDRSKVYVTN 374

Query: 155 ISPWHPPG-------NRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQ 207
                          ++  +  E++ CRP   R++  + P +++ +G       F     
Sbjct: 375 AVKHFKFVPRGKIRLHQKPATPEIKACRPWYERELAAVQPALVVAMGASAAQAVFG-KIT 433

Query: 208 KTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWH------ALI 252
           +  +N G   +L         + TVHP  L++ P  +            L 
Sbjct: 434 QVTKNRGHIVDLPEGAQ---AMITVHPSYLLRLPDAEAKAREYELFVKDLK 481


>gi|27378134|ref|NP_769663.1| hypothetical protein bll3023 [Bradyrhizobium japonicum USDA 110]
 gi|27351281|dbj|BAC48288.1| bll3023 [Bradyrhizobium japonicum USDA 110]
          Length = 469

 Score =  147 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 41/205 (20%), Positives = 79/205 (38%), Gaps = 17/205 (8%)

Query: 61  SPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDS 120
           SP  +        A  L  L+        C L   +  T+     +   +M++G  P D 
Sbjct: 256 SPRPEAIMGHKAAANDLEALREEAAHCRACPLYKDATQTVFGEGPKDATIMLVGEQPGDK 315

Query: 121 DNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPG-------NRNLSNIEMEI 173
           ++++G PF G  G MLD+ L+   + R +++++                ++  +  E++ 
Sbjct: 316 EDLAGHPFVGPAGQMLDRALEEAGVDRKKVYVTNAVKHFKFVPRGKIRLHQKPATPEIKA 375

Query: 174 CRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVH 233
           CRP   R++  I P++++ +G       F        +  G+  +L         L TVH
Sbjct: 376 CRPWYEREVAAIQPELIVAMGATAAQSVFG-KITPIGKTRGRLIDLP---DGRKALVTVH 431

Query: 234 PQELIQYPLIKKNTW------HALI 252
           P  L++ P  +            L 
Sbjct: 432 PSYLLRLPDPEAKVLEYQRFVEDLK 456


>gi|158424630|ref|YP_001525922.1| phage SPO1 DNA polymerase-related protein [Azorhizobium caulinodans
           ORS 571]
 gi|158331519|dbj|BAF89004.1| phage SPO1 DNA polymerase-related protein [Azorhizobium caulinodans
           ORS 571]
          Length = 472

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 41/237 (17%), Positives = 88/237 (37%), Gaps = 18/237 (7%)

Query: 36  TYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCST 95
                  E+     I       +     +++A   A++A  L  L++       C L + 
Sbjct: 240 APLIADAERRAGEMIAHAATPANPRPHRLEKAALDAEQADGLEALRAQALGCRACPLWAP 299

Query: 96  SLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMI 155
           +  T+         +M +G  P D +++ G+PF G  G + D+ LQ   + R + +++  
Sbjct: 300 ATQTVFGEGPTDAPVMFVGEQPGDQEDLDGRPFVGPAGRLFDQALQDAGLERARAYVTNA 359

Query: 156 SPWHPPG-------NRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQK 208
                         +++ + +E+  C   + R+I L+ P++++ +G           A +
Sbjct: 360 VKHFKFEPRGKRRLHQSPNPVEIRACNTWLAREIALVRPRLVVALGASAAQAVSG-RAVR 418

Query: 209 TYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWH------ALITLKKALK 259
             ++ G+   L         L +VHP  L++ P  +            L      L 
Sbjct: 419 VGESRGRIMPLEGRD----ALVSVHPSYLLRLPDAEARAREYDRFVADLRLAAPYLA 471


>gi|297568259|ref|YP_003689603.1| phage SPO1 DNA polymerase-related protein [Desulfurivibrio
           alkaliphilus AHT2]
 gi|296924174|gb|ADH84984.1| phage SPO1 DNA polymerase-related protein [Desulfurivibrio
           alkaliphilus AHT2]
          Length = 277

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 48/262 (18%), Positives = 93/262 (35%), Gaps = 17/262 (6%)

Query: 11  QILTIALFYADSGVYWVFDEP--NNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQAD 68
            +  + L + + GV      P          Q ++    +    +   +    P   ++ 
Sbjct: 20  DLQGLVLLHRELGVDAYPASPGLLRLLQPSCQGRQGRDSAKTGELGAAKSPAPPARPRSS 79

Query: 69  SIAQKAC---SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISG 125
             A+       L  L + L+    C         I    +    L++I   P  ++  +G
Sbjct: 80  KSAEAEREVPDLTVLAAQLQDCRQCPHHQWRQKVIFGQGSAEARLLLIAGYPGAAEEGAG 139

Query: 126 KPFSGKTGNMLDKMLQSIEIMRTQIHISMISPW-------HPPGNRNLSNIEMEICRPII 178
            P  G  G +LD+ML +I++ R QI+++ +                      +  C P +
Sbjct: 140 LPCQGAAGELLDRMLAAIQLSRRQIYLTTLVKCIPEAARQAATSPAPPEPAAISACLPFL 199

Query: 179 MRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELI 238
            +QI  I P ++  +G            +   Q  G++         IP + T+ P  L+
Sbjct: 200 QQQIAAIRPALICTLGPLPAQALL-RTGKHLLQLRGRFHQY----RDIPLMPTLAPDFLL 254

Query: 239 QYPLIKKNTWHALITLKKALKN 260
             P +KK  W  L  ++K L+ 
Sbjct: 255 HNPEMKKYAWQDLQLIQKFLQK 276


>gi|147918737|ref|YP_687540.1| uracil-DNA glycosylase superfamily protein [uncultured methanogenic
           archaeon RC-I]
 gi|110622936|emb|CAJ38214.1| predicted uracil-DNA glycosylase superfamily protein [uncultured
           methanogenic archaeon RC-I]
          Length = 185

 Score =  147 bits (371), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 41/176 (23%), Positives = 75/176 (42%), Gaps = 5/176 (2%)

Query: 82  SLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQ 141
             +     C L  +  + +  +      +M+IG  P  +++  GKPF G  G +L+ +L+
Sbjct: 12  DDVLKCPRCDLSLSRTNVVIGSGPLDARIMLIGEAPGRNEDKQGKPFVGAAGKVLNLVLE 71

Query: 142 SIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFF 201
           S  I R  ++I+ +    PP NR     E+E C   + +Q+E+ISPK+++ +G      +
Sbjct: 72  SAGIRRDDVYIANVVKCRPPENRVPKKDEIEACSVYLKKQLEVISPKVVVLLGKTAAESY 131

Query: 202 FNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKA 257
                       G+       H     + T HP  +I    +K         ++KA
Sbjct: 132 LGRKVVM-----GEEHGKPFKHEDRTVVITYHPAAIIYNRKLKDALESDFKVIRKA 182


>gi|190892718|ref|YP_001979260.1| uracil DNA glycosylase [Rhizobium etli CIAT 652]
 gi|190697997|gb|ACE92082.1| putative uracil DNA glycosylase protein [Rhizobium etli CIAT 652]
          Length = 484

 Score =  147 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 39/237 (16%), Positives = 91/237 (38%), Gaps = 17/237 (7%)

Query: 35  ATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCS 94
           A+ ES+ +E +   A + +     +              A +L  L++       C L +
Sbjct: 248 ASAESKVREMAAREATRSLPFHDRLQQAARNLPTEPEAPAGTLEALRAQASVCTRCPLHA 307

Query: 95  TSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISM 154
            +  T+         +M +G  P D ++I+G+PF G  G + D+++    I R+ ++++ 
Sbjct: 308 NATQTVFGEGPRDAAVMFVGEQPGDQEDIAGRPFVGPAGRLFDQVMAEAGIDRSMVYVTN 367

Query: 155 ISPWHPPG-------NRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQ 207
                          ++  +  E++ CR  +  ++ L+ PK+++ +G        +   +
Sbjct: 368 SVKHFKYEPRGKRRIHQKPTMGEVKHCRWWLDLELALVEPKLIVAMGATALAALTDVKGR 427

Query: 208 KTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIK------KNTWHALITLKKAL 258
                 GK   +           TVHP  L++ P  +            ++ ++  +
Sbjct: 428 LQ-DVRGKAMAIE---GGRTLFVTVHPSYLLRIPDERLKAEEMARFRQDMLEIQGLM 480


>gi|83590984|ref|YP_430993.1| phage SPO1 DNA polymerase-related protein [Moorella thermoacetica
           ATCC 39073]
 gi|83573898|gb|ABC20450.1| phage SPO1 DNA polymerase-related protein [Moorella thermoacetica
           ATCC 39073]
          Length = 191

 Score =  147 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 44/186 (23%), Positives = 81/186 (43%), Gaps = 5/186 (2%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
            L  LK+   +   C L + +   +  +   G  LM++G      ++  G+PF+G  G +
Sbjct: 2   DLKGLKAKSPACRGCSLRTGTRQVVSGSGNPGAGLMLVGEGLGAREDRVGRPFAGAAGQL 61

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           L ++L++    R +++I+ I    PPGNR   + E+E CRP++   I+ + P+I++ +G 
Sbjct: 62  LGRLLKAAGFRREEVYITNIVKCRPPGNRMPESAEVEACRPLLDAAIDFVRPQIIVCLGA 121

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
                          +  G+W         I  L T HP  L++              L+
Sbjct: 122 LATRTLVAP-GASITRLRGRWIE----KDGIRYLPTFHPAALLRDGGKIPLVEEDFRKLR 176

Query: 256 KALKNL 261
            A + L
Sbjct: 177 AAYQAL 182


>gi|209884314|ref|YP_002288171.1| transcriptional regulator, Fis family [Oligotropha carboxidovorans
           OM5]
 gi|209872510|gb|ACI92306.1| transcriptional regulator, Fis family [Oligotropha carboxidovorans
           OM5]
          Length = 209

 Score =  147 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 43/200 (21%), Positives = 80/200 (40%), Gaps = 17/200 (8%)

Query: 75  CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
            +L +L+        CHL   +  T+         +M +G  P D ++++G+PF G  G 
Sbjct: 14  ENLADLREEAAHCRACHLYKNATQTVFGEGAAHAAVMFVGEQPGDKEDLAGRPFVGPAGQ 73

Query: 135 MLDKMLQSIEIMRTQIHISMISPWHPPG-------NRNLSNIEMEICRPIIMRQIELISP 187
           +LD+ L+   I R + +I+                ++  +  E++ CRP   R++  + P
Sbjct: 74  VLDRGLKEAGIARNKTYITNAVKHFKFVPRGKIRLHQKPTTPEIKACRPWYERELATVKP 133

Query: 188 KILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ--YPLIK- 244
            +++ +G       F        +N G+  +L         L TVHP  L++   P  K 
Sbjct: 134 ALVVAMGATAAQCVFG-KITPIGKNRGRLFDLAEDA---KALVTVHPSYLLRLPDPDSKE 189

Query: 245 ---KNTWHALITLKKALKNL 261
              K     L      L+ +
Sbjct: 190 REYKQFVSDLKLAASYLREI 209


>gi|327192707|gb|EGE59644.1| putative uracil DNA glycosylase protein [Rhizobium etli CNPAF512]
          Length = 484

 Score =  147 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 40/237 (16%), Positives = 93/237 (39%), Gaps = 17/237 (7%)

Query: 35  ATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCS 94
           A+ ES+ +E +   A Q +     +      +       A +L  L++       C L +
Sbjct: 248 ASAESKVREMAAREATQSLPFHDRLQQASHNRTREPEAPAGTLEALRAEAAVCTRCPLHA 307

Query: 95  TSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISM 154
            +  T+         +M +G  P D ++I+G+PF G  G + D+++    I R+ ++++ 
Sbjct: 308 KATQTVFGEGPRDAAVMFVGEQPGDQEDIAGRPFVGPAGKLFDQVIAEAGIDRSTLYVTN 367

Query: 155 ISPWHPPG-------NRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQ 207
                          ++  +  E++ CR  +  ++ L+ PK+++ +G        +   +
Sbjct: 368 SVKHFKYEPRGKRRIHQKPTMGEVKHCRWWLDLELTLVEPKLIVAMGATALAALTDMKDR 427

Query: 208 KTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIK------KNTWHALITLKKAL 258
                 GK   +           TVHP  L++ P  +            ++ +++ +
Sbjct: 428 LQ-DVRGKAMAIE---GGRTLFVTVHPSYLLRIPDERLKAEEMARFRQDMLEIQRLM 480


>gi|319780107|ref|YP_004139583.1| phage SPO1 DNA polymerase-related protein [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317165995|gb|ADV09533.1| phage SPO1 DNA polymerase-related protein [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 485

 Score =  147 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 38/239 (15%), Positives = 88/239 (36%), Gaps = 17/239 (7%)

Query: 35  ATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCS 94
           A   ++     + +   P            Q  ++    A ++ EL+   +    C L  
Sbjct: 251 ADKAAKDMIAKMPTTPAPHHAKVQARHWPKQPVEAPEDDASTIPELREAAKGCRRCPLWR 310

Query: 95  TSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISM 154
            +  T+     +   ++ +G  P D ++++GKPF G  G + D +L    + R +++++ 
Sbjct: 311 DATQTVFGEGPDNAKVIFVGEQPGDQEDLAGKPFVGPAGKVFDAILDDAGVDRQKVYVTN 370

Query: 155 ISPWHPPG-------NRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQ 207
                          +   ++ E++ CR  I ++ ELI P + + +G           A 
Sbjct: 371 AVKHFKFEPRGKRRIHSKPNSGEIQACRWWIDQEFELIKPNLAVALGATAAMSLLG-KAI 429

Query: 208 KTYQNLGKWSNLCTPHSIIPTLATVHPQELI--QYPLIK----KNTWHALITLKKALKN 260
              +  G+          +    T+HP  ++  + P  K    +     +  +K+ +  
Sbjct: 430 PVTKMRGQVIE---REDGLRVFITIHPSFILRIREPADKEAERERFLQDMKLVKRLMAA 485


>gi|327311693|ref|YP_004338590.1| phage SPO1 DNA polymerase-like protein [Thermoproteus uzoniensis
           768-20]
 gi|326948172|gb|AEA13278.1| phage SPO1 DNA polymerase-related protein [Thermoproteus uzoniensis
           768-20]
          Length = 198

 Score =  147 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 41/182 (22%), Positives = 69/182 (37%), Gaps = 4/182 (2%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L E+   +R    C L  T    +       + +MI+G  P + ++  G+PF G  G +L
Sbjct: 5   LLEIAERIRGCTRCRLHETRRLAVPGEGRAEKGIMIVGEAPGEKEDEEGRPFVGPAGRLL 64

Query: 137 DKMLQSIEIMR-TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
             +L    I R   + I+ +    PPGNR     E+  C P ++ QI  I P++++ +G 
Sbjct: 65  TSILTRYGIDRGRDVFITNVVKCRPPGNREPLEDEIAACTPYLVEQIAAIRPRLIVALGV 124

Query: 196 KTKNFFF---NNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALI 252
            +             K     GK   +           T HP   +  P ++      L 
Sbjct: 125 HSARTLMSFAGRRVAKITDVRGKCFKVRIAGVETTLCVTYHPAAALYNPRLRTTLEEDLR 184

Query: 253 TL 254
             
Sbjct: 185 RF 186


>gi|332284994|ref|YP_004416905.1| uracil-DNA glycosylase [Pusillimonas sp. T7-7]
 gi|330428947|gb|AEC20281.1| uracil-DNA glycosylase [Pusillimonas sp. T7-7]
          Length = 286

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 52/223 (23%), Positives = 84/223 (37%), Gaps = 8/223 (3%)

Query: 40  QRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLST 99
           Q   + + +  QP        SP + +         +   L S +     C L       
Sbjct: 63  QATRELLRTPPQPKAKQPAPESPEMPRLPV----PETWEALISHIAGCQACGLHVGRSHA 118

Query: 100 ICATQTEG-QDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQI-HISMISP 157
           +     E   + +++G  P   D+ +G PF GK G +L  ML SI++        + +  
Sbjct: 119 VSGAGAEHMPEWLVVGEAPGSVDDRTGLPFQGKAGQLLQAMLASIQVTEQTPVFFTNVIK 178

Query: 158 WHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWS 217
             P GNR  +  E+E C P + RQI L+ P  +L +G+                  GK  
Sbjct: 179 CRPLGNRTPTQDEIEACMPYLQRQIALLKPHRILALGSLAAQAVLGLQNDLEA-LRGKVH 237

Query: 218 NLCTP-HSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALK 259
            + +     IP + T HP  L+  P  K + W  L   +  L 
Sbjct: 238 AMRSEADQDIPVVVTYHPTALLLRPQHKPDAWRDLNLARTLLA 280


>gi|167045662|gb|ABZ10310.1| putative Uracil DNA glycosylase superfamily protein [uncultured
           marine crenarchaeote HF4000_APKG10L15]
          Length = 191

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 46/186 (24%), Positives = 85/186 (45%), Gaps = 6/186 (3%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           SL  ++  ++    C+LC T  + +     +  D++ IG  P  +++  G+PF G  G  
Sbjct: 6   SLKIIQEKVKICKKCNLCFTRKNAVPGKGNQNADIVFIGEAPGKNEDQHGEPFIGTAGKK 65

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN 195
           L+  L+++ + R  ++I+ I    PP NR  ++IE  +C   +  +I +I+PKI+  +GN
Sbjct: 66  LNDALENVGLTRNSVYITNIVKCRPPNNRVPNDIEKAMCSNYLEDEIAIINPKIICLLGN 125

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
                      ++  +N GK+              T HP   I    + K   + +  L 
Sbjct: 126 TPFYSILG--GKEISKNHGKFVYKDNRMY----FVTFHPAATIYNQKLGKVFKNDIRKLM 179

Query: 256 KALKNL 261
           K L+ L
Sbjct: 180 KELQKL 185


>gi|159900927|ref|YP_001547174.1| phage SPO1 DNA polymerase-related protein [Herpetosiphon
           aurantiacus ATCC 23779]
 gi|159893966|gb|ABX07046.1| phage SPO1 DNA polymerase-related protein [Herpetosiphon
           aurantiacus ATCC 23779]
          Length = 220

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 40/180 (22%), Positives = 79/180 (43%), Gaps = 4/180 (2%)

Query: 82  SLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQ 141
             +     C LC T  + +        ++++IG  P   ++  G+PF G +G++L++ L 
Sbjct: 13  EEVAQCTACPLCRTRTNAVPGEGPANAEILLIGEGPGQREDALGRPFVGPSGDLLEQWLA 72

Query: 142 SIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFF 201
            I + R Q+ I+ +    PPGNR+    E+  C   + RQI  ++PK++  +G  + N F
Sbjct: 73  EIGLTREQVFIANVVKCRPPGNRDPEPSEIAACAHFLDRQIAALAPKLIATLGRHSMNKF 132

Query: 202 FNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
           F     K  +  G    +      +  L   HP  +++      +    +  + + +  L
Sbjct: 133 F--PGGKITKIHG-IRGVKRQGQTV-FLPLFHPAYVLRNMNAMPDAIADIKLIPRLIARL 188


>gi|284047489|ref|YP_003397828.1| phage SPO1 DNA polymerase-related protein [Acidaminococcus
           fermentans DSM 20731]
 gi|283951710|gb|ADB46513.1| phage SPO1 DNA polymerase-related protein [Acidaminococcus
           fermentans DSM 20731]
          Length = 215

 Score =  146 bits (369), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 52/195 (26%), Positives = 87/195 (44%), Gaps = 10/195 (5%)

Query: 72  QKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGK 131
           + A +  ELK  L     C L     + +         LMI+G  P   ++  G P  G 
Sbjct: 2   EPAKTFDELKKQLEDCAACPLRKDCQAPVGWFGNLESPLMIVGEGPGGVEDDYGCPLIGP 61

Query: 132 TGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRP-IIMRQIELISPKIL 190
           +G +LDK L S+ I R +I+ + +    P GNR  +  E   C    + ++I L+ PK++
Sbjct: 62  SGQLLDKALWSVRITRDRIYTTNVIKCRPRGNRTPTVEEGSFCARLWLEQEIRLLRPKVI 121

Query: 191 LFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ-----YPLIKK 245
           L +G+    +F   +A +  +  G+W         IP LAT HP  L++         K 
Sbjct: 122 LALGSVALRYFKGPEA-RITRERGQWFTT---GEGIPCLATFHPSYLLRLTGQAQIAAKW 177

Query: 246 NTWHALITLKKALKN 260
           + +H L  +K  ++ 
Sbjct: 178 DVFHDLEAVKAKVEE 192


>gi|294666301|ref|ZP_06731551.1| uracil DNA glycosylase superfamily protein [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 10535]
 gi|292603952|gb|EFF47353.1| uracil DNA glycosylase superfamily protein [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 10535]
          Length = 478

 Score =  146 bits (369), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 45/267 (16%), Positives = 92/267 (34%), Gaps = 38/267 (14%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIH 60
           M  K   +  +   +     ++GV          A    +   + + +A  P+  +    
Sbjct: 225 MPQKYWKNLPEAALLPELIREAGVRV-----REMAERAPEPVRRRVPAAPAPLPEVAT-- 277

Query: 61  SPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDS 120
                          SL +L++  R    C L   +  T+     +   +M+IG  P D 
Sbjct: 278 --------------QSLAQLRTAARDCRRCELWQPATQTVFGEGPDDASVMVIGEQPGDE 323

Query: 121 DNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPG-------NRNLSNIEMEI 173
           +++SG+PF G  G + +  L  + + R + +++                +RN     ++ 
Sbjct: 324 EDLSGRPFVGPAGRLFNMALGELGVDREKFYVTNAVKHFRFEQRGKRRLHRNPERTHVQA 383

Query: 174 CRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVH 233
           C   +  +   + P  ++ +G         +  +   Q  G+W  L       P L TVH
Sbjct: 384 CSGWLQAERAQLRPAQIVCLGATAAQAVLGSRFRLMQQ-RGQWQRL---DDGTPVLTTVH 439

Query: 234 PQELIQYPLIK------KNTWHALITL 254
           P  +++ P         +     L  L
Sbjct: 440 PSWVLRQPSTDAREEGYRGFVEDLRRL 466


>gi|160902797|ref|YP_001568378.1| phage SPO1 DNA polymerase-related protein [Petrotoga mobilis SJ95]
 gi|160360441|gb|ABX32055.1| phage SPO1 DNA polymerase-related protein [Petrotoga mobilis SJ95]
          Length = 226

 Score =  146 bits (369), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 45/196 (22%), Positives = 86/196 (43%), Gaps = 11/196 (5%)

Query: 72  QKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGK 131
           +K  ++  +   +     C L  T  +T+  +      +M +G  P   ++  G+PF G+
Sbjct: 8   EKQKNIEMIAKRIEVCEKCPLNLTRTNTVPGSGNVDSPIMFVGEGPGADEDALGEPFVGR 67

Query: 132 TGNMLDKML-QSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKIL 190
            G +L+KML +  ++ R  + I+ I    PP NR  +  E++ C+  +  QI +I PKI+
Sbjct: 68  AGQLLEKMLKEYAKLERNDVFITNIVKCRPPQNRVPTQEEVKSCQSYLDGQIIVIKPKII 127

Query: 191 LFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLI-----KK 245
           + +GN    +F         Q+ G++ N    +  I    T HP  L++         K 
Sbjct: 128 VTLGNTPLYYFTGESK--ITQSRGRFFNW---YGDIKIFPTFHPSYLLRNQSSTKGSPKW 182

Query: 246 NTWHALITLKKALKNL 261
             +  +  +    + L
Sbjct: 183 YAYLDMRIIGIMYRAL 198


>gi|294625714|ref|ZP_06704335.1| DNA polymerase related protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292600018|gb|EFF44134.1| DNA polymerase related protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
          Length = 478

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 46/267 (17%), Positives = 92/267 (34%), Gaps = 38/267 (14%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIH 60
           M  K   +  +   +     D+GV          A    +   + + +A  P+  +    
Sbjct: 225 MPQKYWKNLPEATLLPELIRDAGVRV-----REMAERAPEPVRRRVPAAPAPLPEVAT-- 277

Query: 61  SPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDS 120
                          SL +L++  R    C L   +  T+     +   +M+IG  P D 
Sbjct: 278 --------------QSLAQLRTAARDCRRCELWQPATQTVFGEGPDDASVMVIGEQPGDE 323

Query: 121 DNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPG-------NRNLSNIEMEI 173
           +++SG+PF G  G + +  L  + + R + +++                +RN     ++ 
Sbjct: 324 EDLSGRPFVGPAGRLFNMALGELGVDREKFYVTNAVKHFRFEQRGKRRLHRNPERTHVQA 383

Query: 174 CRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVH 233
           C   +  +   + P  ++ +G         +  +   Q  G+W  L       P L TVH
Sbjct: 384 CSGWLQAERAQLRPAQVVCLGATAAQAVLGSRFRLMQQ-RGQWQRL---DDGTPVLITVH 439

Query: 234 PQELIQYPLIK------KNTWHALITL 254
           P  +++ P         +     L  L
Sbjct: 440 PSWVLRQPSTDAREEGYRGFVEDLRRL 466


>gi|87125791|ref|ZP_01081634.1| Uracil-DNA glycosylase [Synechococcus sp. RS9917]
 gi|86166600|gb|EAQ67864.1| Uracil-DNA glycosylase [Synechococcus sp. RS9917]
          Length = 341

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 44/230 (19%), Positives = 87/230 (37%), Gaps = 13/230 (5%)

Query: 37  YESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHE--LKSLLRSFHDCHLCS 94
             ++++    +  +      R +       A        + ++  L +  R    C L  
Sbjct: 105 EPARQEPFGAECWLADPEGNRLLLLSTAASATKAHSNDDTTNDTTLATACRQCQACDLAG 164

Query: 95  TSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQI-HIS 153
           +    + +  +    LM+IG  P  S++  G+PF G++G +LD++L+          +I 
Sbjct: 165 SRRQVVISRGSAAAPLMLIGEAPGASEDAEGRPFVGRSGRLLDQLLRETGFNPDHDLYIC 224

Query: 154 MISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNL 213
                 PPGNR     E+  CRP + +QI L++P ++  +G+                  
Sbjct: 225 NAVKCRPPGNRKPKRQELAACRPWLEQQIALVNPAVVALLGSTALAAVLEERG-PITGLR 283

Query: 214 GKWSNLCTPHSIIPTLATVHPQELIQYPLIKK-----NTWHALITLKKAL 258
           G+W            +   HP  L++ P  +       T   L  +++ L
Sbjct: 284 GQWIERDGRAW----MPLFHPSYLLRNPSTQPGRPLDLTRSDLRQIRERL 329


>gi|223939226|ref|ZP_03631107.1| phage SPO1 DNA polymerase-related protein [bacterium Ellin514]
 gi|223892058|gb|EEF58538.1| phage SPO1 DNA polymerase-related protein [bacterium Ellin514]
          Length = 201

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 51/205 (24%), Positives = 81/205 (39%), Gaps = 9/205 (4%)

Query: 60  HSPLVQQADSIAQK--ACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTP 117
              ++Q A   A+      L  L S +R    C L  +    +         +MIIG  P
Sbjct: 3   SRSVIQSAPGPAKSKVVKELESLDSKIRVCTACPLYKSRTLAVPGEGKFNSKVMIIGEAP 62

Query: 118 SDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRP- 176
             +++++G+PF G +G  LD +L+  E  R+   I+ I    PP NR     E+E C   
Sbjct: 63  GRNEDLTGRPFVGSSGKFLDHVLEGSEFDRSDFFITNICKCRPPSNRTPKTGEIETCTSL 122

Query: 177 IIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQE 236
            + RQIELI+P+I++ +G             +  +           H     L T HP  
Sbjct: 123 YLYRQIELINPRIIVLLGGVAVKKMLGKKTVEEARCG------IVEHEGRKFLVTYHPAV 176

Query: 237 LIQYPLIKKNTWHALITLKKALKNL 261
                 + +        LK  +K L
Sbjct: 177 RFYREELAEKIKEDFALLKSEMKKL 201


>gi|269836973|ref|YP_003319201.1| phage SPO1 DNA polymerase-like protein [Sphaerobacter thermophilus
           DSM 20745]
 gi|269786236|gb|ACZ38379.1| phage SPO1 DNA polymerase-related protein [Sphaerobacter
           thermophilus DSM 20745]
          Length = 202

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 42/184 (22%), Positives = 75/184 (40%), Gaps = 6/184 (3%)

Query: 75  CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
            SL  + + +R    C L     + +        ++M IG  P   ++  G PF G  G 
Sbjct: 3   ASLDTIAARVRVCTQCELHRMRTNAVPGNGNPNAEVMFIGEGPGWHEDRQGLPFVGAAGQ 62

Query: 135 MLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
            L++MLQSI + R ++ I+ I    PPGNR+    E+  C   +  QI  I PK+++ +G
Sbjct: 63  FLNEMLQSIGLSRDEVFITNIVKCRPPGNRDPLPDEIAACSAYLDAQIAAIKPKVIVTLG 122

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITL 254
             +   +F N+         +          +  +   HP   +    ++      +  L
Sbjct: 123 RFSMARWFPNERIS------RIHGQPRRFGDVVVVPMYHPAAALHQSSLRATIEADMAKL 176

Query: 255 KKAL 258
            + L
Sbjct: 177 PQIL 180


>gi|58039995|ref|YP_191959.1| bacteriophage-type DNA polymerase [Gluconobacter oxydans 621H]
 gi|58002409|gb|AAW61303.1| Bacteriophage-type DNA polymerase [Gluconobacter oxydans 621H]
          Length = 281

 Score =  146 bits (367), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 71/279 (25%), Positives = 122/279 (43%), Gaps = 21/279 (7%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVF-DEPNNEATYESQRKEKSID--------SAIQ 51
           MT + ++S+ ++L       + G      + P +  +  + R   S+         +A +
Sbjct: 1   MTPQPVVSRAELLAALQLQYEWGADEALCELPVDRLSEAAPRLPASMPQREGEGQRTAAR 60

Query: 52  PITNIRHIHSPLVQQADSIA---------QKACSLHELKSLLRSFHDCHLCSTSLSTICA 102
           P+  +     P   +   +A         +KA  L  L  L  +  D  L  T+   +  
Sbjct: 61  PLPEMWDGTRPAGAKVTGVATGSLSLQALEKAPDLPTLMRLTEAPDDLFLARTATHRLEP 120

Query: 103 TQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPG 162
              E    M+IG  P   ++ SG  F+G+ G +L+KML+S  + R QI ++   PW PPG
Sbjct: 121 VFVEDAPFMLIGEAPDADEDRSGTLFAGEAGALLEKMLRSAGLERGQISMAPALPWRPPG 180

Query: 163 NRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTP 222
            R  S+ EM+ C P+++R I L  P+ L+ +G          DA    +  GKW+ +  P
Sbjct: 181 GRTPSDTEMQACHPLLLRTIALCRPRFLVTMGVTPLKMLLGPDAAV-GRLRGKWTEVSVP 239

Query: 223 H--SIIPTLATVHPQELIQYPLIKKNTWHALITLKKALK 259
              + +P L   HP +L      ++N W  L+ L + L 
Sbjct: 240 GLATPVPLLPMRHPLQLRASAAARRNAWQDLLILMEKLA 278


>gi|325919263|ref|ZP_08181307.1| uracil-DNA glycosylase, family 4 [Xanthomonas gardneri ATCC 19865]
 gi|325550268|gb|EGD21078.1| uracil-DNA glycosylase, family 4 [Xanthomonas gardneri ATCC 19865]
          Length = 479

 Score =  146 bits (367), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 44/237 (18%), Positives = 78/237 (32%), Gaps = 17/237 (7%)

Query: 31  PNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDC 90
           P      E  R+       +             V  A        SL +L+   R    C
Sbjct: 234 PEASLLPELIREAGVRVREMAERAPEPVRRRVPVAPAPIPEVATQSLAQLRVAARDCRRC 293

Query: 91  HLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQI 150
            L   +  T+         +M+IG  P D +++SG+PF G  G + +  L  I I R  +
Sbjct: 294 ALWQPATQTVFGEGPNDASVMVIGEQPGDEEDLSGRPFVGPAGRLFNMALGEIGIDRATV 353

Query: 151 HISMISPWHPPG-------NRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFN 203
           +++                +RN     ++ C   +  +   + P  ++ +G         
Sbjct: 354 YVTNAVKHFRFEQRGKRRLHRNPERAHVQACSGWLHAERAQLRPAQIVCLGATAAQAVLG 413

Query: 204 NDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIK------KNTWHALITL 254
               +  +  G+W  L       P L TVHP  +++ P         +     L  L
Sbjct: 414 -SGFRLMRERGQWQRL---DDGTPVLTTVHPSWVLRQPTTAAREEGYRGFVEDLRQL 466


>gi|86358569|ref|YP_470461.1| putative uracil DNA glycosylase protein [Rhizobium etli CFN 42]
 gi|86282671|gb|ABC91734.1| putative uracil DNA glycosylase protein [Rhizobium etli CFN 42]
          Length = 484

 Score =  146 bits (367), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 39/239 (16%), Positives = 90/239 (37%), Gaps = 17/239 (7%)

Query: 35  ATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCS 94
           A+ ES+ +  +   A Q +     +              A +L  L++       C L +
Sbjct: 248 ASAESKVRAMAAREATQSLPFHERLQQAARNLPAEPELPAGTLEALRAEAAVCMRCPLHA 307

Query: 95  TSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISM 154
            +  T+         +M +G  P D ++I+G+PF G  G + D+++    I R+ ++++ 
Sbjct: 308 NATQTVFGEGPRDAAVMFVGEQPGDQEDIAGRPFVGPAGKLFDQVIAEAGIDRSMLYVTN 367

Query: 155 ISPWHPPG-------NRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQ 207
                          ++  +  E++ CR  +  ++ L+ PK+++ +G        +   +
Sbjct: 368 AVKHFKYEPRGKRRIHQKPTMGEVKQCRWWLDLELALVKPKLIVAMGATALAALTDVTGR 427

Query: 208 KTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWH------ALITLKKALKN 260
                 GK   +            VHP  L++ P  +            ++ ++  +K 
Sbjct: 428 LQ-DVRGKAMAIE---GGRTLFVIVHPSYLLRIPDERLKAEEMLRFRQDMMEIRGLMKA 482


>gi|73748279|ref|YP_307518.1| putative uracil-DNA glycosylase [Dehalococcoides sp. CBDB1]
 gi|73659995|emb|CAI82602.1| putative uracil-DNA glycosylase [Dehalococcoides sp. CBDB1]
          Length = 206

 Score =  146 bits (367), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 43/190 (22%), Positives = 79/190 (41%), Gaps = 6/190 (3%)

Query: 72  QKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGK 131
            K   L  +   +     C+L +T   ++         +M IG  P  +++  G+PF G 
Sbjct: 3   DKEELLKGIYIEIARCVRCNLHTTRTCSVPGEGNADAKIMFIGEAPGFNEDQQGRPFVGA 62

Query: 132 TGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILL 191
            G  L +++ SI + R  ++I+ +    PPGNR+    E+  C   + RQIE+I PKI++
Sbjct: 63  AGKFLTELICSIGLTREDVYITNVVKDRPPGNRDPLPDEISACCNFLDRQIEIIKPKIIV 122

Query: 192 FIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
            +G  +   +F            K          I      HP   +    ++K     +
Sbjct: 123 TLGRFSMARYFTGITIS------KIHGQPMRRDGIIYYPMYHPAAALHQGGLRKEIEQDM 176

Query: 252 ITLKKALKNL 261
           + + + L+ L
Sbjct: 177 LRIPRLLEEL 186


>gi|307293602|ref|ZP_07573446.1| phage SPO1 DNA polymerase-related protein [Sphingobium
           chlorophenolicum L-1]
 gi|306879753|gb|EFN10970.1| phage SPO1 DNA polymerase-related protein [Sphingobium
           chlorophenolicum L-1]
          Length = 465

 Score =  146 bits (367), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 42/245 (17%), Positives = 83/245 (33%), Gaps = 12/245 (4%)

Query: 24  VYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSL 83
           +  +  E   +            +           + +   + A      A +   L+  
Sbjct: 218 IGAMLSEMPRKYWRNLPEAALIPELVAGAQAREAAMIATPARPAARRGNAAPAWQALRDE 277

Query: 84  LRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSI 143
                 C L   +  T+         LM IG  P D ++++G+PF G  G + D+ L+  
Sbjct: 278 AMGCTRCPLYRDTTQTVFGEGPVDAPLMFIGEQPGDQEDLAGRPFVGPAGQLFDRALEEA 337

Query: 144 EIMRTQIHISMISPWHPPG-------NRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
            I R Q +++                ++     E++ CR  + +++ELI P+I++ +G  
Sbjct: 338 GIDRRQAYVTNAVKHFKHERRGKRRIHQTPETPEIQACRWWLTQELELIRPRIIVALGAT 397

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
                    A    +  G    L           TVHP  L++ P   +          +
Sbjct: 398 AGRALLG-KAVTISRVRGAPIALEGGAQG---WITVHPSYLLRVPDEARKAEE-RKRFVE 452

Query: 257 ALKNL 261
            L+ +
Sbjct: 453 ELREI 457


>gi|282163588|ref|YP_003355973.1| uracil-DNA glycosylase [Methanocella paludicola SANAE]
 gi|282155902|dbj|BAI60990.1| uracil-DNA glycosylase [Methanocella paludicola SANAE]
          Length = 182

 Score =  145 bits (366), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 41/179 (22%), Positives = 71/179 (39%), Gaps = 5/179 (2%)

Query: 82  SLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQ 141
             +     C L  +  + +  +      +M+IG  P  +++  G+PF G  G  L+++L+
Sbjct: 9   DDVLHCPRCDLKLSRTNVVVGSGPINAKIMLIGEAPGKNEDKQGQPFVGAAGRNLNELLE 68

Query: 142 SIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFF 201
              I R  ++I+ I    PP NR   + E+E C P + +QIE+I PK ++ +G       
Sbjct: 69  EAGIDRKDVYITNIVKCRPPENRPPFDYEVEACHPYLQKQIEVIGPKGIVLLGKTAAETM 128

Query: 202 FNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
                +      GK             L T HP  +I    +K         +   L  
Sbjct: 129 LGRKVEM-----GKEHGTVVEKDGHRYLITYHPAAMIYKRTLKDTLVEDYKKISALLAE 182


>gi|78049381|ref|YP_365556.1| uracil DNA glycosylase superfamily protein [Xanthomonas campestris
           pv. vesicatoria str. 85-10]
 gi|78037811|emb|CAJ25556.1| uracil DNA glycosylase superfamily protein [Xanthomonas campestris
           pv. vesicatoria str. 85-10]
          Length = 478

 Score =  145 bits (366), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 44/267 (16%), Positives = 93/267 (34%), Gaps = 38/267 (14%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIH 60
           M  K   +  +   +     ++GV          A    +   + + +A  P+ ++    
Sbjct: 225 MPQKYWKNLPEATLLPELIREAGVRV-----REMAERAPEPVRRRVPAAPAPLPDVVT-- 277

Query: 61  SPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDS 120
                          SL +L++  R    C L   +  T+     +   +M+IG  P D 
Sbjct: 278 --------------QSLAQLRTAARDCRRCELWQPATQTVFGEGPDDASVMVIGEQPGDE 323

Query: 121 DNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPG-------NRNLSNIEMEI 173
           +++SG+PF G  G + +  L  + + R + +++                +RN     ++ 
Sbjct: 324 EDLSGRPFVGPAGRLFNMALGELGVDREKFYVTNAVKHFRFEQRGKRRLHRNPERTHVQA 383

Query: 174 CRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVH 233
           C   +  +   + P  ++ +G         +  +   +  G+W  L       P L TVH
Sbjct: 384 CSGWLQAERAQLRPAQIVCLGATAAQAVLGSSFRLM-RERGQWQRL---DDGTPVLTTVH 439

Query: 234 PQELIQYPLIK------KNTWHALITL 254
           P  +++ P         +     L  L
Sbjct: 440 PSWVLRQPSTDAREEGYRGFVEDLRRL 466


>gi|77462785|ref|YP_352289.1| putative uracil-DNA glycosylase [Rhodobacter sphaeroides 2.4.1]
 gi|77387203|gb|ABA78388.1| putative uracil-DNA glycosylase [Rhodobacter sphaeroides 2.4.1]
          Length = 474

 Score =  145 bits (366), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 39/241 (16%), Positives = 83/241 (34%), Gaps = 17/241 (7%)

Query: 34  EATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLC 93
           E   E Q    +   A       +   +     A        +L E K+       C L 
Sbjct: 237 ERAAEMQAAAPTEPPARTAAVARQRAAAAGGPAAAGDGSAPGTLAEAKTAAEGCRRCGLW 296

Query: 94  STSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHIS 153
           + +   +         +MI+G  P D ++++G+PF G  G + D+   +  + R  ++++
Sbjct: 297 ANATQVVFGEGPATARMMIVGEQPGDREDLAGRPFVGPAGQLFDEEAAAAGLDRGSVYVT 356

Query: 154 MISPWHPPG-------NRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDA 206
                           ++     E+  CR  +  + +L+ P++++ +G            
Sbjct: 357 NAVKHFKFAPRGKRRIHQKPDAGEVTACRWWLDLERDLVRPRLIVAMGATALASLTG-SG 415

Query: 207 QKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP------LIKKNTWHALITLKKALKN 260
               +  G    L       P   TVHP  +++ P        ++     L   ++ L+ 
Sbjct: 416 AGILKRRGSVERL---DDGTPVFVTVHPSYILRLPDEAARVEERRRFRDDLQAARQLLER 472

Query: 261 L 261
           L
Sbjct: 473 L 473


>gi|270307805|ref|YP_003329863.1| uracil DNA glycosylase superfamily, DNA polymerase
           bacteriophage-type [Dehalococcoides sp. VS]
 gi|270153697|gb|ACZ61535.1| uracil DNA glycosylase superfamily, DNA polymerase
           bacteriophage-type [Dehalococcoides sp. VS]
          Length = 206

 Score =  145 bits (366), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 44/190 (23%), Positives = 78/190 (41%), Gaps = 6/190 (3%)

Query: 72  QKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGK 131
            K   L  + S +     C L +T   ++         +M IG  P  +++  G+PF G 
Sbjct: 3   DKEELLKGVYSEITRCVRCKLHTTRTRSVPGEGNADAKIMFIGEAPGFNEDQQGRPFVGA 62

Query: 132 TGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILL 191
            G  L +++ SI + R  ++I+ +    PPGNR+    E+  CR  + RQIE+I PKI++
Sbjct: 63  AGKFLTELIHSIGLTREDVYITNVVKDRPPGNRDPLPDEISACRNFLDRQIEIIKPKIIV 122

Query: 192 FIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
            +G  +   +F            K          I      HP   +    ++K     +
Sbjct: 123 TLGRYSMARYFTGITIS------KIHGQPMRRDGIIYYPMYHPAAALHQGGLRKEIEQDM 176

Query: 252 ITLKKALKNL 261
           + +   +  L
Sbjct: 177 LRIPGLVAEL 186


>gi|166713584|ref|ZP_02244791.1| DNA polymerase related protein [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 481

 Score =  145 bits (365), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 44/237 (18%), Positives = 79/237 (33%), Gaps = 17/237 (7%)

Query: 31  PNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDC 90
           P      E  R+       +                A        SL +L+S  R    C
Sbjct: 234 PEAALLPELIREAGVRVREMAERAPAPVRRRVPAAPAPQPDTTTHSLAQLRSAARDCRRC 293

Query: 91  HLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQI 150
            L   +  T+     +   +M+IG  P D +++SG+PF G  G +    L  + + R + 
Sbjct: 294 ELWQPATQTVFGEGPDDASVMVIGEQPGDEEDLSGRPFVGPAGRLFTMALGELGVDRQRF 353

Query: 151 HISMISPWHPPG-------NRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFN 203
           +++                +RN     ++ C   +  +   + P  ++ +G         
Sbjct: 354 YVTNAVKHFRFEQRGKRRLHRNPERAHVQACSGWLQAERTQLRPAQIVCLGATAAQAVLG 413

Query: 204 NDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIK------KNTWHALITL 254
               +  Q  G+W  L       P LATVHP  +++ P         +     L  L
Sbjct: 414 -SGFRLMQERGQWQRL---DDGTPILATVHPSWVLRQPSTDAREEGYRGFVEDLRQL 466


>gi|116253162|ref|YP_769000.1| helicase/glycosylase [Rhizobium leguminosarum bv. viciae 3841]
 gi|115257810|emb|CAK08908.1| putative helicase/glycosylase [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 484

 Score =  145 bits (365), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 42/237 (17%), Positives = 96/237 (40%), Gaps = 17/237 (7%)

Query: 35  ATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCS 94
           A+ ES+ +  +   A Q +     +              A +L  L++       C L +
Sbjct: 248 ASAESKVRAMAAREATQSLPFHDRLQEAARGIPAEPEAPAGTLEALRAEAAGCTRCPLHA 307

Query: 95  TSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISM 154
            +  T+        ++M++G  P D ++I+G+PF G  G +LD+++    I R+ ++++ 
Sbjct: 308 KATQTVFGEGPLDAEVMLVGEQPGDQEDIAGRPFVGPAGRLLDQVITEAGIDRSMLYVTN 367

Query: 155 ISPWHPPG-------NRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQ 207
                          ++  +  E++ CR  +  ++ LI PK+++ +G        +   +
Sbjct: 368 AVKHFKYEPRGKRRIHQKPNMGEVKHCRWWLNLEMALIKPKLVVAMGATALAALTDTKQR 427

Query: 208 KTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIK------KNTWHALITLKKAL 258
                 GK   +    +      TVHP  L++ P  +            ++T+++ +
Sbjct: 428 LQ-DVRGKAIAIDERRT---LFVTVHPSYLLRIPDERLKADELARFREDMLTIQRLM 480


>gi|289662533|ref|ZP_06484114.1| uracil DNA glycosylase superfamily protein [Xanthomonas campestris
           pv. vasculorum NCPPB702]
          Length = 481

 Score =  145 bits (365), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 43/237 (18%), Positives = 81/237 (34%), Gaps = 17/237 (7%)

Query: 31  PNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDC 90
           P      E  R+       +             V  A        +L +L+S  R    C
Sbjct: 234 PEAALLPELIREAGVRVREMAERAPEPVRRRVPVAPAPMPDVATQNLAQLRSAARDCRRC 293

Query: 91  HLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQI 150
            L   +  T+     +   +M+IG  P D +++SG+PF G  G + +  L  + + R + 
Sbjct: 294 ELWQPATQTVFGEGPDDASVMVIGEQPGDEEDLSGRPFVGPAGRLFNMALGELGVDRERF 353

Query: 151 HISMISPWHPPG-------NRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFN 203
           +++                +RN     ++ C   +  +   + P  ++ +G         
Sbjct: 354 YVTNAVKHFRFEQRGKRRLHRNPERTHVQACSGWLQAERAQLRPAQIICLGATAAQAVLG 413

Query: 204 NDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIK------KNTWHALITL 254
           +  +   Q  G+W  L       P L TVHP  +++ P         +     L  L
Sbjct: 414 SSFRLM-QERGQWQRLE---DGTPVLTTVHPSWVLRQPSTDAREEGYRGFVEDLRRL 466


>gi|91976376|ref|YP_569035.1| phage SPO1 DNA polymerase-related protein [Rhodopseudomonas
           palustris BisB5]
 gi|91682832|gb|ABE39134.1| phage SPO1 DNA polymerase-related protein [Rhodopseudomonas
           palustris BisB5]
          Length = 480

 Score =  145 bits (365), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 42/231 (18%), Positives = 79/231 (34%), Gaps = 24/231 (10%)

Query: 35  ATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCS 94
           A   +     +  +A +         S    + D        L  L+   R    C L  
Sbjct: 250 AERAAHAMIAAEATAPKKPQRQEQPMSRAGHEGDR-------LETLREQARDCRACDLWK 302

Query: 95  TSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISM 154
            +  T+         +M++G  P D ++++G PF G  G MLD+ L    I R + +++ 
Sbjct: 303 DATQTVFGEGPPHASVMLVGEQPGDKEDLAGHPFVGPAGQMLDRALAEAGIDRAETYVTN 362

Query: 155 ISPWHPPG-------NRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQ 207
                          ++  +  E++ CRP   R++  + P++++ +G             
Sbjct: 363 AVKHFKFVPRGKIRLHQKPAMPEIKACRPWYERELAAVRPQLVVAMGATAAQSVLG-RIT 421

Query: 208 KTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWH------ALI 252
              +N G   +          L TVHP  L++ P               L 
Sbjct: 422 PINKNRGHLID---RDGGPQVLVTVHPSYLLRLPDDDAKAREYARFVDDLK 469


>gi|289669765|ref|ZP_06490840.1| uracil DNA glycosylase superfamily protein [Xanthomonas campestris
           pv. musacearum NCPPB4381]
          Length = 481

 Score =  144 bits (364), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 43/237 (18%), Positives = 81/237 (34%), Gaps = 17/237 (7%)

Query: 31  PNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDC 90
           P      E  R+       +             V  A        +L +L+S  R    C
Sbjct: 234 PEAALLPELIREAGVRVREMAERAPEPVRRRVPVAPAPMPDVATQNLAQLRSAARDCRRC 293

Query: 91  HLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQI 150
            L   +  T+     +   +M+IG  P D +++SG+PF G  G + +  L  + + R + 
Sbjct: 294 ELWQPATQTVFGEGPDDASVMVIGEQPGDEEDLSGRPFVGPAGRLFNMALGELGVDRERF 353

Query: 151 HISMISPWHPPG-------NRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFN 203
           +++                +RN     ++ C   +  +   + P  ++ +G         
Sbjct: 354 YVTNAVKHFRFEQRGKRRLHRNPERTHVQACSGWLQAERAQLRPAQIICLGATAAQAVLG 413

Query: 204 NDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIK------KNTWHALITL 254
           +  +   Q  G+W  L       P L TVHP  +++ P         +     L  L
Sbjct: 414 SSFRLM-QERGQWQRLE---DGTPVLTTVHPSWVLRQPSTDAREEGYRGFVEDLRRL 466


>gi|147669059|ref|YP_001213877.1| phage SPO1 DNA polymerase-related protein [Dehalococcoides sp.
           BAV1]
 gi|146270007|gb|ABQ16999.1| phage SPO1 DNA polymerase-related protein [Dehalococcoides sp.
           BAV1]
          Length = 206

 Score =  144 bits (364), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 43/190 (22%), Positives = 78/190 (41%), Gaps = 6/190 (3%)

Query: 72  QKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGK 131
            K   L  +   +     C+L +T   ++         +M IG  P  +++  G+PF G 
Sbjct: 3   DKEELLKGIYIEIARCVRCNLHTTRTCSVPGEGNADAKIMFIGEAPGFNEDQQGRPFVGA 62

Query: 132 TGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILL 191
            G  L +++ SI + R  ++I+ +    PPGNR+    E+  C   + RQIE+I PKI++
Sbjct: 63  AGKFLTELICSIGLTREDVYITNVVKDRPPGNRDPLPDEISACCNFLDRQIEIIKPKIIV 122

Query: 192 FIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
            +G  +   +F            K          I      HP   +    ++K     +
Sbjct: 123 TLGRFSMARYFTGITIS------KIHGQPMRRDGIIYYPMYHPAAALHQGGLRKEIEQDM 176

Query: 252 ITLKKALKNL 261
           + +   L+ L
Sbjct: 177 LRIPGLLEEL 186


>gi|148242559|ref|YP_001227716.1| Uracil-DNA glycosylase [Synechococcus sp. RCC307]
 gi|147850869|emb|CAK28363.1| Uracil-DNA glycosylase [Synechococcus sp. RCC307]
          Length = 194

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 39/192 (20%), Positives = 79/192 (41%), Gaps = 11/192 (5%)

Query: 74  ACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTG 133
           + S   L +       C L +T  + +         +++IG  P   ++  G+PF G+ G
Sbjct: 2   SSSWPHLSAACHGCERCELATTRHNVVVGRGNPQARVLLIGEAPGQQEDEQGEPFVGRAG 61

Query: 134 NMLDKMLQSIEIM-RTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLF 192
            +L+K+L    +  R  ++I+ +    PP NR  +  E+E C P + +Q+EL+ P +++ 
Sbjct: 62  QLLEKLLGEAGLDSRRDLYIANVIKCRPPQNRKPTRTEIERCLPWLYQQLELLDPPLVVL 121

Query: 193 IGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLI-----KKNT 247
            G                +  G+W            L   HP  L+++        ++ T
Sbjct: 122 AGATALQAVLGIKG-GISKLRGQWIEQQGRAY----LPVFHPSYLLRFGSRAPGAPQELT 176

Query: 248 WHALITLKKALK 259
              +  +++ L 
Sbjct: 177 LADMQDVRRRLD 188


>gi|94970381|ref|YP_592429.1| phage SPO1 DNA polymerase-related protein [Candidatus Koribacter
           versatilis Ellin345]
 gi|94552431|gb|ABF42355.1| phage SPO1 DNA polymerase-related protein [Candidatus Koribacter
           versatilis Ellin345]
          Length = 217

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 43/215 (20%), Positives = 83/215 (38%), Gaps = 17/215 (7%)

Query: 58  HIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTP 117
            +    VQ    +  K  SL  L    +   +C L  T   T+         ++ +G  P
Sbjct: 2   PMRRKPVQSELPLLMKPRSLEALAHDAKDCRNCDLWKTGTQTVFGEGGAHARVVFVGEQP 61

Query: 118 SDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMIS---PWHPPG----NRNLSNIE 170
            D +++ G+PF G  GN+L+  L+   I R +++++       W P G    ++  +  E
Sbjct: 62  GDKEDLEGRPFVGPAGNLLNTALEQAGINRNEVYVTNAVKHFKWEPRGKRRLHKKPNAAE 121

Query: 171 MEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLA 230
           +  CR  +  +I  I P+I++ +G           + +  +  G         +    LA
Sbjct: 122 VAACRSWMDGEIAAIQPEIIVCLGATAAQAMLG-RSFRVTKQRG---EFLPGPNGASVLA 177

Query: 231 TVHPQELIQYP------LIKKNTWHALITLKKALK 259
           TVHP  +++ P         +     L  +   + 
Sbjct: 178 TVHPSSILRAPDEDARHEEMRLFVDDLRKVAARMN 212


>gi|75676446|ref|YP_318867.1| phage SPO1 DNA polymerase-related protein [Nitrobacter winogradskyi
           Nb-255]
 gi|74421316|gb|ABA05515.1| phage SPO1 DNA polymerase-related protein [Nitrobacter winogradskyi
           Nb-255]
          Length = 225

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 43/223 (19%), Positives = 83/223 (37%), Gaps = 17/223 (7%)

Query: 50  IQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQD 109
           I     +        Q     +    SL  L+        C L   +  T+         
Sbjct: 2   IATEATMPRKPQKREQPMARQSSAHDSLPSLREEAAGCRACPLWKDATQTVFGEGLAHAQ 61

Query: 110 LMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPG------- 162
           +M++G  P D ++++GKPF G  G MLD+ L+   I RT+++++                
Sbjct: 62  VMLVGEQPGDKEDLAGKPFIGPAGQMLDRALKEAGIDRTKVYVTNAVKHFKFVPRGKIRL 121

Query: 163 NRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTP 222
           ++  +  E+  CRP   R++  ++P +++ +G+      F        ++ G+  ++   
Sbjct: 122 HQKPNTPEIRACRPWYERELAAVNPALVVAMGSTAAQSVFG-KITPINKSRGRLIDMK-- 178

Query: 223 HSIIPTLATVHPQELIQYPLIKKNTWH------ALITLKKALK 259
                 L TVHP  L++ P               L      L+
Sbjct: 179 -DGRKALVTVHPSYLLRLPDQDDRAREYKRFVDDLKIAATHLQ 220


>gi|302382564|ref|YP_003818387.1| phage SPO1 DNA polymerase-related protein [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302193192|gb|ADL00764.1| phage SPO1 DNA polymerase-related protein [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 481

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 43/237 (18%), Positives = 84/237 (35%), Gaps = 17/237 (7%)

Query: 35  ATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCS 94
           A+ +           +        +   +        Q    L EL+  ++    C L  
Sbjct: 249 ASRDRTETMVDSAPTLPNAKLASAVAPDVRGGGLDDQQIVGDLGELRQAIQGCRRCPLWR 308

Query: 95  TSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISM 154
            +   +C     G  LMI+G  P D ++++G PF G  G +LD  L+   I R+ ++++ 
Sbjct: 309 DATQGVCGVGPVGARLMIVGEQPGDQEDLAGLPFVGPAGQVLDAALEEAGIDRSDVYVTN 368

Query: 155 ISPWHPPG-------NRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQ 207
                          ++  +  E+  CR  + ++  L+ P + L +G        N    
Sbjct: 369 AVKHFKHEPRGKRRLHKTPNAGEVTACRWWLDQERTLVRPSLTLTLGATAAFAVLNQKVA 428

Query: 208 KTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWH------ALITLKKAL 258
              +  G+   L         + TVHP  L++ P  +            L+ ++  L
Sbjct: 429 VM-KTRGEPLPLP---DGSRAMVTVHPSYLLRLPDEEARVRERAAFVRDLVKVRALL 481


>gi|289432328|ref|YP_003462201.1| phage SPO1 DNA polymerase-related protein [Dehalococcoides sp. GT]
 gi|288946048|gb|ADC73745.1| phage SPO1 DNA polymerase-related protein [Dehalococcoides sp. GT]
          Length = 206

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 43/190 (22%), Positives = 78/190 (41%), Gaps = 6/190 (3%)

Query: 72  QKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGK 131
            K   L  +   +     C+L +T   ++         +M IG  P  +++  G+PF G 
Sbjct: 3   DKEELLKGIYIEIARCVRCNLHTTRTCSVPGEGNADAKIMFIGEAPGFNEDQQGRPFVGA 62

Query: 132 TGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILL 191
            G  L +++ SI + R  ++I+ +    PPGNR+    E+  C   + RQIE+I PKI++
Sbjct: 63  AGKFLTELICSIGLTREDVYITNVVKDRPPGNRDPLPDEISACCNFLDRQIEIIKPKIIV 122

Query: 192 FIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
            +G  +   +F            K          I      HP   +    ++K     +
Sbjct: 123 TLGRFSMARYFTGITIS------KIHGQPMRRDGIIYYPMYHPAAALHQGGLRKEIEQDM 176

Query: 252 ITLKKALKNL 261
           + +   L+ L
Sbjct: 177 LRIPGLLEEL 186


>gi|116070628|ref|ZP_01467897.1| Phage SPO1 DNA polymerase-related protein [Synechococcus sp. BL107]
 gi|116066033|gb|EAU71790.1| Phage SPO1 DNA polymerase-related protein [Synechococcus sp. BL107]
          Length = 187

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 39/183 (21%), Positives = 66/183 (36%), Gaps = 11/183 (6%)

Query: 82  SLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQ 141
                   C L  T    +         LM+IG  P   ++ SG PF G++G  LD++L 
Sbjct: 7   DACLRCSACELARTRQQVVVCRGNPSAPLMLIGEAPGAQEDQSGVPFVGRSGQALDRLLI 66

Query: 142 SIEIM-RTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNF 200
                    ++I       PP NR     E+  CRP + +QI  ++P +++  G      
Sbjct: 67  EAGFNIEQDLYICNAVKCRPPNNRRPKKNELAACRPWLDKQIAEVNPAVIVLTGATAVQA 126

Query: 201 FFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIK-----KNTWHALITLK 255
                     +  G+W            +   HP  L+++   K     + T   L  ++
Sbjct: 127 VL-EKKAAMTELRGQWQTWQ----GRSVMPIFHPAYLLRHASSKEGGPVELTRQDLSAVR 181

Query: 256 KAL 258
             L
Sbjct: 182 TKL 184


>gi|153005432|ref|YP_001379757.1| phage SPO1 DNA polymerase-like protein [Anaeromyxobacter sp.
           Fw109-5]
 gi|152029005|gb|ABS26773.1| phage SPO1 DNA polymerase-related protein [Anaeromyxobacter sp.
           Fw109-5]
          Length = 260

 Score =  144 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 40/238 (16%), Positives = 88/238 (36%), Gaps = 17/238 (7%)

Query: 36  TYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCST 95
           +      ++  + A                 A +      SL  L+   R    C L   
Sbjct: 18  SVPPAPAQRMAERAGGAPRPTAAEPRSRGASAVAPVPADASLASLREAARGCRACPLWER 77

Query: 96  SLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMI 155
           +  T+        +++++G  P + ++++G PF G  G +LDK L +  I R +++++  
Sbjct: 78  ATQTVFGEGPSRAEVVLVGEQPGNEEDLAGLPFVGPAGRLLDKALAAAGIDRRRVYVTNA 137

Query: 156 SPWH-------PPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQK 208
                         ++  +  E+  CRP +  ++ L+ P+ ++ +G             +
Sbjct: 138 VKHFKWEPRGKRRIHQKPNAGEVRACRPWLDAELRLVRPRAVVCLGATAAQALLG-KGFR 196

Query: 209 TYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNT------WHALITLKKALKN 260
             ++ G              LATVHP  +++ P  +            L  + +AL++
Sbjct: 197 VTRSRG---EPLASPLAPIVLATVHPSAILRAPDDETRAAELSRFVEDLRRVAEALRS 251


>gi|188993245|ref|YP_001905255.1| Uracil DNA glycosylase superfamily protein,probable [Xanthomonas
           campestris pv. campestris str. B100]
 gi|167735005|emb|CAP53217.1| Uracil DNA glycosylase superfamily protein,probable [Xanthomonas
           campestris pv. campestris]
          Length = 472

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 45/234 (19%), Positives = 82/234 (35%), Gaps = 17/234 (7%)

Query: 31  PNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDC 90
           P      E  R+       +                A   A  A SL +L+   R    C
Sbjct: 234 PEATLLPELIREAGVRVREMAERAPEPVRRRVPATPAALPAVAAQSLAQLRVAARDCRRC 293

Query: 91  HLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQI 150
            L   +  T+     +   +M+IG  P D +++SG+PF G  G + ++ L  + I R + 
Sbjct: 294 DLWQPATQTVFGEGPDDAAVMVIGEQPGDEEDLSGRPFVGPAGRLFNQALGELGIDRQRF 353

Query: 151 HISMISPWHPPG-------NRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFN 203
           +++                +RN     ++ C   +  +   + P  ++ +G         
Sbjct: 354 YVTNAVKHFRFEQRGKRRLHRNPERSHVQACNGWLQAERAQLRPAQIVCLGATAAQAVLG 413

Query: 204 NDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQY--PLIK----KNTWHAL 251
               +  Q  G+W  L       P LATVHP  +++   P  +    +     L
Sbjct: 414 P-GFRLMQERGQWQRL---DDGTPVLATVHPSWVLRQGTPSAREAGYRGFVADL 463


>gi|284044347|ref|YP_003394687.1| phage SPO1 DNA polymerase-related protein [Conexibacter woesei DSM
           14684]
 gi|283948568|gb|ADB51312.1| phage SPO1 DNA polymerase-related protein [Conexibacter woesei DSM
           14684]
          Length = 254

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 47/191 (24%), Positives = 80/191 (41%), Gaps = 1/191 (0%)

Query: 69  SIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPF 128
           + A++   L E+     +   C L  T  + +        DLM +G  P  +++  G PF
Sbjct: 3   TAAERRERLKEVWREASTCTLCALSETRQTVVFGAGNADADLMFVGEAPGANEDRGGLPF 62

Query: 129 SGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPK 188
            G+ G +LDK+LQ + + R  + I+ +    PPGNR+    E+  CR  + RQ+ELI PK
Sbjct: 63  IGQAGRLLDKLLQEVGLERADVFIANVLKCRPPGNRDPRPTEIATCRDYLHRQVELIEPK 122

Query: 189 ILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTW 248
           ++  +GN +      +D     +  G+          +      HP   +  P +     
Sbjct: 123 VICTLGNFSTK-LLRDDPTGISRVHGQPEVHVLGRRAVRIFPIFHPAAALYTPSMLDTLR 181

Query: 249 HALITLKKALK 259
                L   L 
Sbjct: 182 ADFAQLPGLLA 192


>gi|320355015|ref|YP_004196354.1| Uracil-DNA glycosylase superfamily [Desulfobulbus propionicus DSM
           2032]
 gi|320123517|gb|ADW19063.1| Uracil-DNA glycosylase superfamily [Desulfobulbus propionicus DSM
           2032]
          Length = 315

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 43/269 (15%), Positives = 92/269 (34%), Gaps = 21/269 (7%)

Query: 8   SQEQILTI-------ALFYADSGVYWVFDEP-------NNEATYESQRKEKSIDSAIQPI 53
            +  +L +          +   G+      P         +A    Q+K     +     
Sbjct: 38  DRAALLALGEGVRTLLRLHQQMGISHYPLTPGLGTFVRAKQARPNEQKKRMRPPAPTAAP 97

Query: 54  TNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMII 113
              +   +           ++  L  L+  +     C L +     + A  T    L++I
Sbjct: 98  VGKKTAPAATATAGQPPPTESDRLSVLRRDIEVCRLCPLAADRWGVVFAAGTAPARLLVI 157

Query: 114 GYTPSDSDNISGKP-FSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEME 172
           G         S    F G+   ML  M+++I +    I ++           +L    + 
Sbjct: 158 GGHSRQEGEYSPTILFGGQEDVMLWNMMRAIGLGSGDIVVTNAIKC--CPKADLPPESLH 215

Query: 173 ICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHS---IIPTL 229
            C   + R+I L+ P+++L +G +  +       +   +  G++       +    IP +
Sbjct: 216 ACTVHLRREIALVQPRVILAMGEEAAHAVLG-TGEPISRLRGRFHAARQDDANGVPIPVM 274

Query: 230 ATVHPQELIQYPLIKKNTWHALITLKKAL 258
            T HP+ L+  P +K+  W  L  +++ L
Sbjct: 275 VTFHPRFLLAQPAMKQAAWQDLQMIQRRL 303


>gi|33240466|ref|NP_875408.1| Uracil-DNA glycosylase [Prochlorococcus marinus subsp. marinus str.
           CCMP1375]
 gi|33237994|gb|AAQ00061.1| Uracil-DNA glycosylase [Prochlorococcus marinus subsp. marinus str.
           CCMP1375]
          Length = 202

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 42/181 (23%), Positives = 75/181 (41%), Gaps = 11/181 (6%)

Query: 87  FHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEI- 145
            H C L   +   + +      +LM+IG  P   ++ +G PF G++G +L+ +L++    
Sbjct: 12  CHSCGLDKDTCRIVVSRGDPTSNLMLIGEAPGAKEDETGIPFVGRSGKLLNILLENEGFD 71

Query: 146 MRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNND 205
               + I  +    PP NR  +  E++   P + +QI+L+ P I++ IG+          
Sbjct: 72  YEKDVFICNLLKSRPPNNRTPTRQEIQNHIPWLYQQIKLVDPLIIVLIGSSALRAILGIK 131

Query: 206 AQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIK-----KNTWHALITLKKALKN 260
           + K     G W N       I  +   HP  L++ P          T   L  + + L  
Sbjct: 132 S-KISDLRGTWHNWN----GIYAMPIFHPSYLLRNPSKTIGGPYNLTCLDLREVNRKLVE 186

Query: 261 L 261
           L
Sbjct: 187 L 187


>gi|307321350|ref|ZP_07600749.1| phage SPO1 DNA polymerase-related protein [Sinorhizobium meliloti
           AK83]
 gi|306892995|gb|EFN23782.1| phage SPO1 DNA polymerase-related protein [Sinorhizobium meliloti
           AK83]
          Length = 213

 Score =  142 bits (359), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 31/200 (15%), Positives = 75/200 (37%), Gaps = 17/200 (8%)

Query: 72  QKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGK 131
            +A ++  L+        C L   +   +         ++ +G  P D ++++G+PF G 
Sbjct: 17  AEATTIASLRRQAEGCERCDLYKNATQLVFGEGPVDARVVFVGEQPGDREDLAGRPFVGP 76

Query: 132 TGNMLDKMLQSIEIMRTQIHISMISPWHPPG-------NRNLSNIEMEICRPIIMRQIEL 184
            G +LD+ L    I R++ +++                +   +  E++ C   +  +++ 
Sbjct: 77  AGRILDECLHEAGIDRSECYLTNAVKHFKFEQRGKRRMHSRPNAGEIQACAWWLGAELDE 136

Query: 185 ISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ----- 239
           + P+I++ +G           +    +N G+             L T+HP  L++     
Sbjct: 137 LRPEIVVALGATALMSLLG-RSVGVTRNRGQLLTAP---GGFSVLVTIHPSYLLRIRGRS 192

Query: 240 YPLIKK-NTWHALITLKKAL 258
            P  ++      L  +   +
Sbjct: 193 DPEAERARFVDDLAKVATRI 212


>gi|269216098|ref|ZP_06159952.1| uracil-DNA glycosylase, family 4 [Slackia exigua ATCC 700122]
 gi|269130357|gb|EEZ61435.1| uracil-DNA glycosylase, family 4 [Slackia exigua ATCC 700122]
          Length = 211

 Score =  142 bits (359), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 40/184 (21%), Positives = 70/184 (38%), Gaps = 5/184 (2%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L E+   + +   C L     + +         +M++G  P  ++++ GKPF G  G  L
Sbjct: 23  LEEISDAVWACRRCELAEGRTNAVPGFGNASARIMLVGEAPGRNEDLQGKPFVGAAGKYL 82

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
            ++L    + R ++ I+ +    PP NRN    E+E+C P +  Q+  I P+ L+ +GN 
Sbjct: 83  TELLGYAGLTREEVFIANVLKCRPPSNRNPRPEEIEVCTPFLRDQVRTIEPEYLVTMGNF 142

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
           +  F      +      G                  HP   I     +         L +
Sbjct: 143 STKFVL-RTERGITGLRGSVHVT----GPFKVFPVFHPAAAIYDRSKRDVLEADFRALGR 197

Query: 257 ALKN 260
            L N
Sbjct: 198 LLGN 201


>gi|72381948|ref|YP_291303.1| phage SPO1 DNA polymerase-related protein [Prochlorococcus marinus
           str. NATL2A]
 gi|72001798|gb|AAZ57600.1| phage SPO1 DNA polymerase-related protein [Prochlorococcus marinus
           str. NATL2A]
          Length = 187

 Score =  142 bits (359), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 39/177 (22%), Positives = 77/177 (43%), Gaps = 11/177 (6%)

Query: 91  HLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIM-RTQ 149
            L ++    + +       LMIIG  P   +   G+PF G++G +LDK+LQ+  I     
Sbjct: 16  DLDNSINKIVVSRGNPFAKLMIIGEAPGAKEEEIGEPFVGRSGKLLDKLLQNAGIDINQD 75

Query: 150 IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKT 209
           ++   +    PP NR  + IE++   P + +QI+L++P +++ +G           +   
Sbjct: 76  VYFCNVIKCRPPKNRRPTKIEIQENLPWLYQQIKLVNPSVIVLVGATALEAILKIKS-PI 134

Query: 210 YQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKK-----NTWHALITLKKALKNL 261
               G+W +          +   HP  L++ P  ++      T    + +K+ +  L
Sbjct: 135 SILRGEWIDWEGK----LVMPVFHPSYLLRNPSKEEGKPMSLTKSDFLKIKEKIDFL 187


>gi|51245612|ref|YP_065496.1| DNA polymerase [Desulfotalea psychrophila LSv54]
 gi|50876649|emb|CAG36489.1| related to DNA polymerase, bacteriophage-type [Desulfotalea
           psychrophila LSv54]
          Length = 269

 Score =  142 bits (359), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 43/264 (16%), Positives = 100/264 (37%), Gaps = 9/264 (3%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVFDEP--NNEATYESQRKEKSIDSAIQPITNIRH 58
           M+ K I++   +  +  ++   G+    D     +   Y+++          Q ++    
Sbjct: 1   MSKKEIIT--DLYNLLQYHEILGIKEYPDREGLQDFLAYQAEAPATIPSPPPQAVSRPPK 58

Query: 59  IH--SPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGY- 115
                P+   A  + + A +  E   L +   +C L +   + +     +   L+++G  
Sbjct: 59  AREYRPVTPIATVVKEPAPTKTEGTDLKKLCANCGLQTRQQAFVAGKGGKQVRLLVVGGW 118

Query: 116 TPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICR 175
               ++ +    F  +   ML +M  ++++    + ++ +              +++ C 
Sbjct: 119 RIDGNETLRSAVFGAEEDLMLARMFAAMKLPAANVFVTNLVKCALRVGDRPEAADIDSCL 178

Query: 176 PIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCT-PHSIIPTLATVHP 234
            ++ RQIEL+ P+++  +G                   GK+  +       IP LAT HP
Sbjct: 179 RLLHRQIELLQPEMVCVMGTLAARKVLG-KPHSLSHLRGKFYQIELLKGQTIPVLATYHP 237

Query: 235 QELIQYPLIKKNTWHALITLKKAL 258
             L++   +K+ TW  L  +   L
Sbjct: 238 SYLLKNDEMKRPTWEDLQKVATRL 261


>gi|23011683|ref|ZP_00051971.1| COG1573: Uracil-DNA glycosylase [Magnetospirillum magnetotacticum
           MS-1]
          Length = 152

 Score =  142 bits (359), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 55/151 (36%), Positives = 80/151 (52%), Gaps = 2/151 (1%)

Query: 111 MIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIE 170
           M +G  P   ++  GKPF G++G +LD+M+ +I + RT  ++S I PW PPGNRN +  E
Sbjct: 1   MFVGEAPGADEDRIGKPFMGRSGQLLDRMMAAIGLDRTTSYVSNIVPWRPPGNRNPTPQE 60

Query: 171 MEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTP-HSIIPTL 229
           + ICRP I RQIEL +P IL+ +G                +  G++          I  L
Sbjct: 61  VSICRPFIERQIELANPDILVCLGAPATQTLTGTK-DGILKARGRFYPYRLGDGREIRAL 119

Query: 230 ATVHPQELIQYPLIKKNTWHALITLKKALKN 260
           AT+HP  L++ P+ K+  W     LK AL  
Sbjct: 120 ATLHPAYLLRQPVQKRLAWRDFRMLKAALDA 150


>gi|78184753|ref|YP_377188.1| Phage SPO1 DNA polymerase-related protein [Synechococcus sp.
           CC9902]
 gi|78169047|gb|ABB26144.1| Phage SPO1 DNA polymerase-related protein [Synechococcus sp.
           CC9902]
          Length = 187

 Score =  142 bits (359), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 39/183 (21%), Positives = 67/183 (36%), Gaps = 11/183 (6%)

Query: 82  SLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQ 141
                   C L +T    +         LM+IG  P   ++ +G PF G++G  LD++L 
Sbjct: 7   DACLRCSACELATTRQKVVVYRGNPKAPLMLIGEAPGAQEDQTGLPFKGRSGQALDRLLI 66

Query: 142 SIEIM-RTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNF 200
                    ++I       PP NR     E+  CRP + +QI  ++P +++  G      
Sbjct: 67  EAGFNIEKDLYICNAVKCRPPNNRRPKKTELTACRPWLDKQIAEVNPAVIVLTGATAVQA 126

Query: 201 FFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIK-----KNTWHALITLK 255
                     +  GKW            +   HP  L+++   K     + T   L  ++
Sbjct: 127 LLELKT-AMTELRGKWQTWQ----GRSVMPIFHPAYLLRHASAKEGGPVELTRQDLSAVR 181

Query: 256 KAL 258
             L
Sbjct: 182 TKL 184


>gi|124025440|ref|YP_001014556.1| Uracil-DNA glycosylase [Prochlorococcus marinus str. NATL1A]
 gi|123960508|gb|ABM75291.1| Uracil-DNA glycosylase [Prochlorococcus marinus str. NATL1A]
          Length = 187

 Score =  142 bits (359), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 39/177 (22%), Positives = 77/177 (43%), Gaps = 11/177 (6%)

Query: 91  HLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIM-RTQ 149
            L ++    + +       LMIIG  P   +   G+PF G++G +LDK+LQ+  I     
Sbjct: 16  DLDNSINKIVVSRGNPFAKLMIIGEAPGAKEEEIGEPFVGRSGKLLDKLLQNAGIDINQD 75

Query: 150 IHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKT 209
           ++   +    PP NR  + IE++   P + +QI+L++P +++ +G           +   
Sbjct: 76  VYFCNVVKCRPPKNRRPTKIEIQENLPWLYQQIKLVNPSVIVLVGATALEAILKIKS-PI 134

Query: 210 YQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKK-----NTWHALITLKKALKNL 261
               G+W +          +   HP  L++ P  ++      T    + +K+ +  L
Sbjct: 135 SILRGEWIDWEGK----LVMPVFHPSYLLRNPSKEEGKPMSLTKSDFLKIKEKIDFL 187


>gi|299134859|ref|ZP_07028051.1| phage SPO1 DNA polymerase-related protein [Afipia sp. 1NLS2]
 gi|298590669|gb|EFI50872.1| phage SPO1 DNA polymerase-related protein [Afipia sp. 1NLS2]
          Length = 217

 Score =  142 bits (359), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 40/197 (20%), Positives = 76/197 (38%), Gaps = 17/197 (8%)

Query: 75  CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
            SL +L+        CHL   +  T+         +M++G  P D ++++GKPF G  G 
Sbjct: 18  ESLADLREEAAHCRACHLYKDATQTVFGEGAAHAPIMLVGEQPGDKEDLAGKPFVGPAGQ 77

Query: 135 MLDKMLQSIEIMRTQIHISMISPWHPPG-------NRNLSNIEMEICRPIIMRQIELISP 187
           +L + L   +I R +++I+                ++  +  E+  CR    R++  + P
Sbjct: 78  VLARGLDEAKIPRNKVYITNAVKHFKFVLRGKVRLHQKPNTSEIRACRQWYERELLAVKP 137

Query: 188 KILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNT 247
            +++ +G       F        +N G + +L         L TVHP  L++ P      
Sbjct: 138 ALVVAMGATAAQCVFG-KITPIGKNRGHFLDLTED---TKALVTVHPSYLLRLPDADAKA 193

Query: 248 WH------ALITLKKAL 258
                    L    + +
Sbjct: 194 REYAHFVSDLKLAFEYI 210


>gi|294010642|ref|YP_003544102.1| DNA polymerase bacteriophage-type [Sphingobium japonicum UT26S]
 gi|292673972|dbj|BAI95490.1| DNA polymerase bacteriophage-type [Sphingobium japonicum UT26S]
          Length = 464

 Score =  142 bits (358), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 40/233 (17%), Positives = 80/233 (34%), Gaps = 11/233 (4%)

Query: 24  VYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSL 83
           V  +  E   +            +      +    + +   + +      A +   L+  
Sbjct: 217 VGAMLSEMPRKYWRNLPEAALIPELVAGAQSREAAMIATPPKPSARQGNAAAAWSALREE 276

Query: 84  LRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSI 143
                 C L   +  T+         LM IG  P D ++++G+PF G  G + D  L+  
Sbjct: 277 AMGCTRCPLYRDTTQTVFGEGPVDAPLMFIGEQPGDQEDLAGRPFVGPAGQLFDYALEEA 336

Query: 144 EIMRTQIHISMISPWHPPG-------NRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
            I R + +I+                ++     E++ CR  + +++EL+ P+I++ +G  
Sbjct: 337 GIDRRRAYITNAVKHFKHERRGKRRIHQTPETPEIQACRWWLTQELELVRPRIIVALGAT 396

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWH 249
                    A    +  G    L +         TVHP  L++ P   +    
Sbjct: 397 AGRALLG-KAVTISRVRGAPIALESGAQG---WITVHPSYLLRVPDEARKMEE 445


>gi|82702415|ref|YP_411981.1| phage SPO1 DNA polymerase-related protein [Nitrosospira multiformis
           ATCC 25196]
 gi|82410480|gb|ABB74589.1| phage SPO1 DNA polymerase-related protein [Nitrosospira multiformis
           ATCC 25196]
          Length = 209

 Score =  142 bits (357), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 44/212 (20%), Positives = 84/212 (39%), Gaps = 16/212 (7%)

Query: 60  HSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSD 119
             PL   +        ++  L+    +   CHL   +  T+         +M++G  P D
Sbjct: 2   KMPLPDTSHPAEHAGNTVASLRKAATNCRACHLWEHATQTVFGEGPSHASIMLVGEQPGD 61

Query: 120 SDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPG-------NRNLSNIEME 172
            ++ +G PF G  G++L   L ++ I R +++++                ++   + E+ 
Sbjct: 62  REDATGHPFVGPAGSILSHALTAVGISREEVYVTNAVKHFKFELRGKRRMHKKPIDTEIV 121

Query: 173 ICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATV 232
            C   + R+IELI+P++++ +G           A     N GK        + +  L TV
Sbjct: 122 ACHAWLQREIELITPRLIIALGATAARSLLG-RATPVKVNRGKLLEYA---TGVSLLITV 177

Query: 233 HPQELIQYPLIKKN-----TWHALITLKKALK 259
           HP  L++ P   K+       + L   K  L 
Sbjct: 178 HPSFLLRMPEENKDEEYEHFVNDLNLAKPFLD 209


>gi|325915940|ref|ZP_08178236.1| uracil-DNA glycosylase, family 4 [Xanthomonas vesicatoria ATCC
           35937]
 gi|325537907|gb|EGD09607.1| uracil-DNA glycosylase, family 4 [Xanthomonas vesicatoria ATCC
           35937]
          Length = 479

 Score =  142 bits (357), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 43/242 (17%), Positives = 83/242 (34%), Gaps = 25/242 (10%)

Query: 26  WVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLR 85
            +  E   EA    +   +     ++    +    +P V           SL +L++  R
Sbjct: 237 ALLPELIREAGVRVREMAERAPEPVRRRVPMTPAPTPDVAT--------QSLAQLRTAAR 288

Query: 86  SFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEI 145
               C L   +  T+     +   +M+IG  P D +++SG+PF G  G +    L  + +
Sbjct: 289 DCRRCELWQPATQTVFGEGPDDASVMVIGEQPGDEEDLSGRPFVGPAGRLFTMALGELGV 348

Query: 146 MRTQIHISMISPWHPPG-------NRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTK 198
            R   +++                +RN     ++ C   +  +   + P  ++ +G    
Sbjct: 349 DRQAFYVTNAVKHFRFEQRGKRRLHRNPERAHVQACSGWLQAERAQLRPAQIVCLGATAA 408

Query: 199 NFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLI------KKNTWHALI 252
                    +  Q  G+W  L       P LATVHP  +++           +     L 
Sbjct: 409 QAVLG-SGFRLMQQRGQWQRL---DDGTPVLATVHPSWVLRQGSEVAREEGYRGFVQDLR 464

Query: 253 TL 254
            L
Sbjct: 465 QL 466


>gi|21244429|ref|NP_644011.1| DNA polymerase-like protein [Xanthomonas axonopodis pv. citri str.
           306]
 gi|21110092|gb|AAM38547.1| DNA polymerase related protein [Xanthomonas axonopodis pv. citri
           str. 306]
          Length = 478

 Score =  141 bits (356), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 42/237 (17%), Positives = 79/237 (33%), Gaps = 17/237 (7%)

Query: 31  PNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDC 90
           P      E  R        +                A        SL +L++  R    C
Sbjct: 234 PEATLLPELIRDAGMRVREMAERAPEPVRRRVPAAPAPLPEAATQSLAQLRTAARDCRRC 293

Query: 91  HLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQI 150
            L   +  T+    ++   +M+IG  P D +++SG+PF G  G + +  L  + + R   
Sbjct: 294 ELWQPATQTVFGEGSDDASVMVIGEQPGDEEDLSGRPFVGPAGRLFNMALGELGVDRETF 353

Query: 151 HISMISPWHPPG-------NRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFN 203
           +++                +RN     ++ C   +  +   + P  ++ +G         
Sbjct: 354 YVTNAVKHFRFEQRGKRRLHRNPERTHVQACSGWLQAERAHLRPAQIVCLGATAAQAVLG 413

Query: 204 NDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIK------KNTWHALITL 254
           +  +   Q  G+W  L       P L TVHP  +++ P         +     L  L
Sbjct: 414 SRFRLMQQ-RGQWQRL---DDGTPVLTTVHPSWVLRQPSTDAREEGYRGFVEDLRQL 466


>gi|16265025|ref|NP_437817.1| putative DNA polymerase related protein [Sinorhizobium meliloti
           1021]
 gi|15141164|emb|CAC49677.1| putative DNA polymerase related protein [Sinorhizobium meliloti
           1021]
          Length = 213

 Score =  141 bits (356), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 31/200 (15%), Positives = 76/200 (38%), Gaps = 17/200 (8%)

Query: 72  QKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGK 131
            +A ++  L+        C L   +   +         ++++G  P D ++++G+PF G 
Sbjct: 17  AEATTIASLRRQAEGCERCDLYKNATQLVFGEGPVDARVVLVGEQPGDREDLAGRPFVGP 76

Query: 132 TGNMLDKMLQSIEIMRTQIHISMISPWHPPG-------NRNLSNIEMEICRPIIMRQIEL 184
            G +LD+ L    I R++ +++                +   +  E++ C   +  +++ 
Sbjct: 77  AGRILDECLHEAGIDRSECYLTNAVKHFKFEQRGKRRMHSRPNAGEIQACAWWLGAELDE 136

Query: 185 ISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ----- 239
           + P+I++ +G           +    +N G+             L T+HP  L++     
Sbjct: 137 LRPEIVVALGATALMSLLG-RSVGVTRNRGQLLTAP---GGFSVLVTIHPSYLLRIRGRS 192

Query: 240 YPLIKK-NTWHALITLKKAL 258
            P  ++      L  +   +
Sbjct: 193 DPEAERARFVDDLAKVATRI 212


>gi|150376548|ref|YP_001313144.1| phage SPO1 DNA polymerase-like protein [Sinorhizobium medicae
           WSM419]
 gi|150031095|gb|ABR63211.1| phage SPO1 DNA polymerase-related protein [Sinorhizobium medicae
           WSM419]
          Length = 213

 Score =  141 bits (355), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 31/200 (15%), Positives = 75/200 (37%), Gaps = 17/200 (8%)

Query: 72  QKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGK 131
            +A ++  L+        C L   +   +         ++++G  P D ++++G+PF G 
Sbjct: 17  AEAPTIASLRREAEGCERCDLYKNATQLVFGEGPTDARVVLVGEQPGDREDLAGRPFVGP 76

Query: 132 TGNMLDKMLQSIEIMRTQIHISMISPWHPPG-------NRNLSNIEMEICRPIIMRQIEL 184
            G +LD+ +    I R++ +++                +   +  E++ C   +  +I+ 
Sbjct: 77  AGRLLDECMHEAGIDRSECYLTNAVKHFKFEPRGKRRLHSRPNAGEVQACAWWLGAEIDE 136

Query: 185 ISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ----- 239
           + P+I++ +G                +N G+             L T+HP  L++     
Sbjct: 137 LRPEIVVALGATALMSLLG-RGVGVTKNRGQ---FVPAPGGFSVLVTIHPSYLLRIRGRG 192

Query: 240 YPLIKK-NTWHALITLKKAL 258
            P  ++      L  +   +
Sbjct: 193 DPEAERARFVDDLAKVAVRI 212


>gi|260463163|ref|ZP_05811365.1| phage SPO1 DNA polymerase-related protein [Mesorhizobium
           opportunistum WSM2075]
 gi|259031013|gb|EEW32287.1| phage SPO1 DNA polymerase-related protein [Mesorhizobium
           opportunistum WSM2075]
          Length = 226

 Score =  141 bits (355), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 38/224 (16%), Positives = 86/224 (38%), Gaps = 19/224 (8%)

Query: 52  PITNIRHIHSPLVQQADSIAQK--ACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQD 109
           P           V +A+ I+ +  A S+ EL+        C L   +  T+     +   
Sbjct: 7   PRNAKMPARRVSVPRAELISDETDANSIPELRDAAEGCRRCPLWRNATQTVFGEGPDNAK 66

Query: 110 LMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPG------- 162
           ++ +G  P D ++++GKPF G  G + D +L   ++ R +++++                
Sbjct: 67  VIFVGEQPGDQEDLAGKPFVGPAGRVFDAILVDADVDRQKVYVTNAVKHFKFEPRGKRRI 126

Query: 163 NRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTP 222
           +   +  E++ CR  + ++ +LI P + + +G           A    +  G+       
Sbjct: 127 HSKPNAGEVQACRWWLDQEFDLIKPNLAVALGATAALSLLG-KATPVMKMRGQVIE---R 182

Query: 223 HSIIPTLATVHPQELI--QYPLIK----KNTWHALITLKKALKN 260
              +    T+HP  ++  + P  K    +     +  +K+ +  
Sbjct: 183 EDGLRVFITIHPSFILRIREPADKEAERERFLKDMREVKRLMAA 226


>gi|292492113|ref|YP_003527552.1| phage SPO1 DNA polymerase-related protein [Nitrosococcus halophilus
           Nc4]
 gi|291580708|gb|ADE15165.1| phage SPO1 DNA polymerase-related protein [Nitrosococcus halophilus
           Nc4]
          Length = 194

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 56/193 (29%), Positives = 91/193 (47%), Gaps = 6/193 (3%)

Query: 68  DSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKP 127
           D   +K  +L+ELK L   +    +       +    +   ++MIIG  P   +  +G+P
Sbjct: 6   DEQLEKVATLNELKQLCEHYLGSEVSKGEK-FVFGEGSPQAEVMIIGEAPGVQEAKTGRP 64

Query: 128 FSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISP 187
           F G  G +L+ +L  I + R QI+IS I   HP GNR     E++   P ++RQIEL+ P
Sbjct: 65  FVGNAGKLLNTLLNQIGLEREQIYISNILKTHPSGNRKPYRGEIKKELPFLLRQIELLRP 124

Query: 188 KILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNT 247
           K+L+ +G       ++  A K  +  G W  +      +PT  T HP   ++    KK  
Sbjct: 125 KLLVLLGATALQALYDPKA-KITELRGNWIEV----KNLPTFVTYHPAAALRDETKKKTL 179

Query: 248 WHALITLKKALKN 260
            H    L++ L +
Sbjct: 180 EHDFSKLQERLAS 192


>gi|325293540|ref|YP_004279404.1| DNA polymerase bacteriophage-type [Agrobacterium sp. H13-3]
 gi|325061393|gb|ADY65084.1| putative DNA polymerase bacteriophage-type [Agrobacterium sp.
           H13-3]
          Length = 481

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 44/231 (19%), Positives = 91/231 (39%), Gaps = 14/231 (6%)

Query: 37  YESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTS 96
            E++  E +  +A QP      + +    + +       +L  L         C L   +
Sbjct: 252 AEARVLEMAAKAASQPQPFHHRLQAAASAREEPPPAPDGTLASLAQEAGQCTRCALHCKA 311

Query: 97  LSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMIS 156
             T+     E   +MI+G  P D ++++GKPF G  G + D+ L    I R +++++   
Sbjct: 312 TQTVFGMGPEDAKVMIVGEQPGDHEDLAGKPFVGPAGQLFDRTLVEAGIDRKKLYVTNAV 371

Query: 157 PWHPPG-------NRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKT 209
                        ++     E++ CR  + ++IEL+ PK+++ +G            +K 
Sbjct: 372 KHFKYEARGKRRIHQRPDAGEVQQCRWWLNKEIELVRPKLIVAMGATALYALTGGK-EKV 430

Query: 210 YQNLGKWSNLCTPHSIIPTLATVHPQELIQYP-LIKKNTWHALITLKKALK 259
            +  G+   +    +      TVHP  L++ P   +K     +   +  + 
Sbjct: 431 SEVRGRPIPMQEERT---LFVTVHPSYLLRLPDSQQKEAE--MQNFRNEID 476


>gi|295695673|ref|YP_003588911.1| phage SPO1 DNA polymerase-related protein [Bacillus tusciae DSM
           2912]
 gi|295411275|gb|ADG05767.1| phage SPO1 DNA polymerase-related protein [Bacillus tusciae DSM
           2912]
          Length = 193

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 39/182 (21%), Positives = 77/182 (42%), Gaps = 5/182 (2%)

Query: 75  CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
            +L++L+S  +S   C L       + +  T G  ++++G  P   ++  G PF G+ G 
Sbjct: 5   QNLNQLESAFKSCRRCGLRGGCSQVVVSRGTPG-PVVLVGEAPGADEDAQGFPFVGRAGQ 63

Query: 135 MLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
           +LD+ML+       +++I+      PPGNR  +  EM  CRP +M Q  ++ P+I++ +G
Sbjct: 64  LLDRMLKEAGFDPARLYITNAVKCRPPGNRKPAPEEMVACRPYLMAQFAVLQPEIVVTMG 123

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNT---WHAL 251
                           +   ++ +              HP  +++ P    +    W  +
Sbjct: 124 ATAIQAVLGRT-IPVGRASTRFYHARHREREFLVAPCYHPSAILRDPRKYPDAVARWVDI 182

Query: 252 IT 253
             
Sbjct: 183 RK 184


>gi|329114631|ref|ZP_08243390.1| Phage SPO1 DNA Polymerase-Related Protein [Acetobacter pomorum
           DM001]
 gi|326696111|gb|EGE47793.1| Phage SPO1 DNA Polymerase-Related Protein [Acetobacter pomorum
           DM001]
          Length = 420

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 42/200 (21%), Positives = 74/200 (37%), Gaps = 17/200 (8%)

Query: 72  QKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGK 131
            +A SL  L +       C L   +  T+     E   LM +G  P D ++++G+PF G 
Sbjct: 220 AQAASLASLSAEAMDCRACSLWQPAKRTVFGEGVENTPLMFVGEQPGDQEDLAGRPFVGP 279

Query: 132 TGNMLDKMLQSIEIMRTQIHISMISP-----WH--PPGNRNLSNIEMEICRPIIMRQIEL 184
            G + DK L+   I+R  I+++         W      ++      +E CR  +  +  L
Sbjct: 280 AGQVFDKALEEAGILRNHIYVTNAVKHFRFTWRNTRRLHQKPDQESVEACRIWLDAERRL 339

Query: 185 ISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIK 244
           + PK+++ +G                +   +   L    S    L TVHP  L++ P  +
Sbjct: 340 VQPKLIVMLGVTAAQSLLK-RPVTISRERSRIFQLNEQCSG---LVTVHPSYLLRLPNEE 395

Query: 245 KNTW------HALITLKKAL 258
                       L      +
Sbjct: 396 AKAREYARFVEDLRLAHSFI 415


>gi|329889045|ref|ZP_08267388.1| uracil-DNA glycosylase, family 4 family protein [Brevundimonas
           diminuta ATCC 11568]
 gi|328844346|gb|EGF93910.1| uracil-DNA glycosylase, family 4 family protein [Brevundimonas
           diminuta ATCC 11568]
          Length = 475

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 45/235 (19%), Positives = 87/235 (37%), Gaps = 17/235 (7%)

Query: 31  PNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDC 90
           P   A    + +     SA +P    + + +P V +A +       L EL   ++    C
Sbjct: 239 PELTAAASVRTEAMVTQSAPKPNERFQRVRAPSVDRAPTDDLVPGDLDELARGVQGCRRC 298

Query: 91  HLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQI 150
            L   +   +C    +   LM++G  P D +++ G+PF+G  G +LD   +   + R  +
Sbjct: 299 PLWRDATQGVCGEGPKRAALMVVGEQPGDQEDLVGRPFTGPAGRLLDAAFEEAGLHRRDL 358

Query: 151 HISMISPWHPPG-------NRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFN 203
           +++                +R  S  E++ CR  +  +  L+ P+++L +G         
Sbjct: 359 YLTNAVKHFKHEPRGKRRLHRTPSPSEVQACRWWLDHERRLVKPRLILALGATAGLAVLG 418

Query: 204 NDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP------LIKKNTWHALI 252
                  +  G+     T         TVHP  L++ P        +      L 
Sbjct: 419 RKPAVQAE-RGRV---ITADDGARVFLTVHPAYLLRLPVPAARDSERAKFLADLR 469


>gi|171910613|ref|ZP_02926083.1| phage SPO1 DNA polymerase-related protein [Verrucomicrobium
           spinosum DSM 4136]
          Length = 476

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 49/245 (20%), Positives = 88/245 (35%), Gaps = 22/245 (8%)

Query: 34  EATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKA-----CSLHELKSLLRSFH 88
                      ++     P   +    S  +Q     A  A       L  L+    +  
Sbjct: 235 WRNLPEAAIIPTLLEQASPRVEVMMERSHALQSQLKEAHPADVPNTNDLEVLRDAAATCK 294

Query: 89  DCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRT 148
            C L   +  T+        +++ +G  P D ++++GKPF G  G +LD+ LQ   I R 
Sbjct: 295 ACPLYKDATQTVFGEGHVSAEIVFLGEQPGDQEDLAGKPFVGPAGRLLDQALQEAGIDRE 354

Query: 149 QIHISMIS---PWHPPG----NRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFF 201
             +++       W   G    ++     E+  C+P    ++ +I P+IL+ +G       
Sbjct: 355 TCYVTNAVKHFKWKRQGKRRLHQTPVQAEIHACKPWWRAELAIIKPRILVCLGATAARTV 414

Query: 202 FNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWH------ALITLK 255
               A K     G++           TL TVHP  L++ P  +            L  + 
Sbjct: 415 L-EHAVKIGDVRGEFMETTWCE---KTLVTVHPSSLLRQPDPEIRAEEMARFVADLKLVA 470

Query: 256 KALKN 260
           +AL +
Sbjct: 471 RALAS 475


>gi|330507398|ref|YP_004383826.1| uracil DNA glycosylase [Methanosaeta concilii GP-6]
 gi|328928206|gb|AEB68008.1| uracil DNA glycosylase [Methanosaeta concilii GP-6]
          Length = 192

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 40/188 (21%), Positives = 78/188 (41%), Gaps = 11/188 (5%)

Query: 74  ACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTG 133
              L  L+  + S   C L  +   T+  +     ++M++G  P   +++ G PF G+ G
Sbjct: 7   PPDLILLQEKIASCDLCPLSLSRNLTVPGSGPSKAEIMLVGEAPGREEDLKGLPFVGRAG 66

Query: 134 NMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFI 193
            +LD+ L    + R  + I+ +    PP NR  +  E+E+C P +  Q++ I P+I+  +
Sbjct: 67  RLLDEALNEAGLKREDVFITSVIKCRPPQNRKPNKKEIELCLPYLEDQMDAIRPRIICLM 126

Query: 194 GNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALIT 253
           GN                  G+  +          L T HP  +++   +  +    L  
Sbjct: 127 GNTAIQA--VLGVVGVTVLRGRILSD-------RFLVTYHPAAVLRNRNLMADFVSDLRE 177

Query: 254 LKKALKNL 261
               +++L
Sbjct: 178 --AKIQSL 183


>gi|190572663|ref|YP_001970508.1| putative uracil DNA glycosylase [Stenotrophomonas maltophilia
           K279a]
 gi|190010585|emb|CAQ44194.1| putative uracil DNA glycosylase [Stenotrophomonas maltophilia
           K279a]
          Length = 486

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 43/218 (19%), Positives = 85/218 (38%), Gaps = 17/218 (7%)

Query: 53  ITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMI 112
                    P+   A +      SL  L+    +   C L  T+  T+         +M+
Sbjct: 268 PAQAPQRRIPMRGDAAAARPDTASLQTLRQQASACRQCPLWETATQTVFGQGPADARVMV 327

Query: 113 IGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPG-------NRN 165
           IG  P D++++ G+PF+G  G +LD+ L  + I R  ++++                ++ 
Sbjct: 328 IGEQPGDTEDLRGQPFAGPAGQLLDRALAELGIDRATLYLTNAVKHFHHERRGKVRLHKR 387

Query: 166 LSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSI 225
             +  ++ CRP +M +I  + P++++ +G       F  D     ++ G+W  L      
Sbjct: 388 PESRHIQACRPWLMGEIARVRPQLIVCLGATAAASVFGRDFNL-SRDRGRWHTLEEGTRG 446

Query: 226 IPTLATVHPQELIQYPLIKK------NTWHALITLKKA 257
               ATVHP  +++     +           L  L + 
Sbjct: 447 Y---ATVHPAWVLRQGDGARRERAYALFRDDLAQLLQK 481


>gi|332703223|ref|ZP_08423311.1| phage SPO1 DNA polymerase-related protein [Desulfovibrio africanus
           str. Walvis Bay]
 gi|332553372|gb|EGJ50416.1| phage SPO1 DNA polymerase-related protein [Desulfovibrio africanus
           str. Walvis Bay]
          Length = 189

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 45/187 (24%), Positives = 80/187 (42%), Gaps = 6/187 (3%)

Query: 74  ACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTG 133
           +  L EL   +R    C L       +          +++G  P   ++  G+PF G+TG
Sbjct: 7   SARLDELAEGIRICERCPLHLGRRHAVPGEGGFRLHCLLVGEAPGQREDEVGRPFIGRTG 66

Query: 134 NMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRP-IIMRQIELISPKILLF 192
             LD+ L    + R    I+      PPGNR    +EM+ICR   ++ QI+ + P++++ 
Sbjct: 67  AFLDRFLVPFGLSRDDFFITSSVKCRPPGNRAPKPLEMDICREAWLLPQIQALKPRLVVL 126

Query: 193 IGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALI 252
           +GN               +  GK       HS +  L T HP   +++P +++       
Sbjct: 127 MGNAPIRSLLGVRT-PMNELHGKLR----QHSGLSMLPTYHPTAAMRFPAVRRLAEADWE 181

Query: 253 TLKKALK 259
           T++  L+
Sbjct: 182 TIRTLLR 188


>gi|94265274|ref|ZP_01289033.1| Phage SPO1 DNA polymerase-related protein [delta proteobacterium
           MLMS-1]
 gi|93454255|gb|EAT04571.1| Phage SPO1 DNA polymerase-related protein [delta proteobacterium
           MLMS-1]
          Length = 276

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 54/248 (21%), Positives = 96/248 (38%), Gaps = 14/248 (5%)

Query: 19  YADSGVYWVFDEPNNEATYE-------SQRKEKSIDSAIQPITNIRHIHSPLVQQADSIA 71
           + + GV           T         +  ++K   +A       R   +   Q   +  
Sbjct: 33  HQELGVDAYPPSARPLLTATGPGENHRAAAEQKGHQAASATPPPERAEQAGPAQAPAAAR 92

Query: 72  QKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGK 131
           Q    L  +   +R+ + C L       I         L+I+   P  ++  +G P  G+
Sbjct: 93  QPRPELAAVAGRIRACNRCPL--QRPRIIVGQGNPEARLLIVAPPPGPAEEAAGLPCQGE 150

Query: 132 TGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILL 191
            G +LDKML +I + R+ ++++ +    PP  R  +  E   CRP ++ QI  I P +L 
Sbjct: 151 AGALLDKMLAAIGLARSTVYLTTVVKCDPPDCRPPTPEESRQCRPWLLEQIAAIRPTLLC 210

Query: 192 FIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
            +G +       +      Q  G++ +       I  + T+ P  L+  P +KK  WH L
Sbjct: 211 TMGQEAAQSLLKSSRNL-LQLRGRFHD----CQGIALMPTLAPDFLLPNPEMKKAAWHDL 265

Query: 252 ITLKKALK 259
             + K L 
Sbjct: 266 QLIAKRLA 273


>gi|258542770|ref|YP_003188203.1| phage SPO1 DNA polymerase-related protein [Acetobacter pasteurianus
           IFO 3283-01]
 gi|256633848|dbj|BAH99823.1| phage SPO1 DNA polymerase-related protein [Acetobacter pasteurianus
           IFO 3283-01]
 gi|256636907|dbj|BAI02876.1| phage SPO1 DNA polymerase-related protein [Acetobacter pasteurianus
           IFO 3283-03]
 gi|256639960|dbj|BAI05922.1| phage SPO1 DNA polymerase-related protein [Acetobacter pasteurianus
           IFO 3283-07]
 gi|256643016|dbj|BAI08971.1| phage SPO1 DNA polymerase-related protein [Acetobacter pasteurianus
           IFO 3283-22]
 gi|256646071|dbj|BAI12019.1| phage SPO1 DNA polymerase-related protein [Acetobacter pasteurianus
           IFO 3283-26]
 gi|256649124|dbj|BAI15065.1| phage SPO1 DNA polymerase-related protein [Acetobacter pasteurianus
           IFO 3283-32]
 gi|256652111|dbj|BAI18045.1| phage SPO1 DNA polymerase-related protein [Acetobacter pasteurianus
           IFO 3283-01-42C]
 gi|256655168|dbj|BAI21095.1| phage SPO1 DNA polymerase-related protein [Acetobacter pasteurianus
           IFO 3283-12]
          Length = 417

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 39/200 (19%), Positives = 75/200 (37%), Gaps = 17/200 (8%)

Query: 72  QKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGK 131
            +A SL  L +       C L   +  T+     E   LM +G  P D ++++G+PF G 
Sbjct: 220 AQASSLASLSAEAMDCRACSLWQPANRTVFGEGVENTPLMFVGEQPGDQEDLAGRPFVGP 279

Query: 132 TGNMLDKMLQSIEIMRTQIHISMISPWHPPG-------NRNLSNIEMEICRPIIMRQIEL 184
            G + D+ L+   I+R  ++++                ++      +E CR  +  + +L
Sbjct: 280 AGQVFDRALEEAGILRNHVYVTNAVKHFRFTWKNNRRLHQKPDQESVEACRIWLDAERKL 339

Query: 185 ISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIK 244
           + PK+++ +G                +   +   L    S    L TVHP  L++ P  +
Sbjct: 340 VHPKLIVMLGVTAAQSLLK-RPVTISRERSRIFQLDEQCSG---LVTVHPSYLLRLPNEE 395

Query: 245 KNTW------HALITLKKAL 258
                       L   +  +
Sbjct: 396 AKAREYTRFVEDLRLAQSFI 415


>gi|254521313|ref|ZP_05133368.1| uracil DNA glycosylase superfamily protein [Stenotrophomonas sp.
           SKA14]
 gi|219718904|gb|EED37429.1| uracil DNA glycosylase superfamily protein [Stenotrophomonas sp.
           SKA14]
          Length = 472

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 42/218 (19%), Positives = 88/218 (40%), Gaps = 17/218 (7%)

Query: 53  ITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMI 112
            +       P+ + + + +    SL  L+    +   C L  T+  T+         +M+
Sbjct: 254 PSQAPQRRIPMREDSATSSTDTRSLQNLRQQASACRQCPLWETATQTVFGQGPADARVMV 313

Query: 113 IGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPG-------NRN 165
           IG  P D++++ G PF+G  G +LD+ L  + I R  ++++                ++ 
Sbjct: 314 IGEQPGDTEDLRGLPFAGPAGQLLDRALAELGIDRATLYLTNAVKHFHHERRGKIRLHKR 373

Query: 166 LSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSI 225
             +  ++ CRP +M +I  + P++++ +G       F  D     ++ G+W  L      
Sbjct: 374 PESRHIQACRPWLMGEIARVRPQVIVCLGATAAASVFGRDFNL-SRDRGRWHTLEDGTQS 432

Query: 226 IPTLATVHPQELIQY------PLIKKNTWHALITLKKA 257
               ATVHP  +++           +     L  L++ 
Sbjct: 433 Y---ATVHPAWVLRQGDDVRREAAYRLFRDDLARLQQK 467


>gi|116074927|ref|ZP_01472188.1| phage SPO1 DNA polymerase-related protein [Synechococcus sp.
           RS9916]
 gi|116068149|gb|EAU73902.1| phage SPO1 DNA polymerase-related protein [Synechococcus sp.
           RS9916]
          Length = 201

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 40/183 (21%), Positives = 68/183 (37%), Gaps = 11/183 (6%)

Query: 82  SLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQ 141
                   C L +     + +       +M+IG  P  S++  G PF G++G +LD++L 
Sbjct: 12  EACGGCCRCSLSTQRQQVVVSRGNPNAQVMLIGEAPGASEDAQGLPFVGRSGQLLDQLLV 71

Query: 142 SIEIMRTQI-HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNF 200
              +   +   I+ +    PP NR  S  E+  CRP I  QI ++ P +++ +G    + 
Sbjct: 72  QAGLSPDRDLFITNVVKCRPPDNRKPSAKELSACRPWIEEQIAIVDPTVVILVGATAVSA 131

Query: 201 FFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKK-----NTWHALITLK 255
                        G W            L   HP  L++ P          T   L  ++
Sbjct: 132 MLGLKQAMRS-LRGVWIEQDQRSW----LPIFHPSYLLRNPSRDPGKPVSLTLEDLCQVR 186

Query: 256 KAL 258
             L
Sbjct: 187 DRL 189


>gi|239815784|ref|YP_002944694.1| phage SPO1 DNA polymerase-related protein [Variovorax paradoxus
           S110]
 gi|239802361|gb|ACS19428.1| phage SPO1 DNA polymerase-related protein [Variovorax paradoxus
           S110]
          Length = 237

 Score =  139 bits (349), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 34/190 (17%), Positives = 78/190 (41%), Gaps = 11/190 (5%)

Query: 72  QKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGK 131
           +   +L  L     +  +C L + +  ++      G  LM++G  P D +++ G+PF G 
Sbjct: 6   EATAALKALSVATDACRECPLGAHATQSVFGEGPVGAALMVVGEQPGDKEDLVGRPFVGP 65

Query: 132 TGNMLDKMLQSIEIMRTQIHISMISPWHPPG-------NRNLSNIEMEICRPIIMRQIEL 184
            G + D+ +  +   R +++++                ++     E++ C   +  ++EL
Sbjct: 66  AGKLFDRAVAELGWSREKLYVTNAVKHFKYEPRGKRRMHKTPGQREVDACHHWLESEMEL 125

Query: 185 ISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ-YPLI 243
           + P+  + +G                +  G+W  +    +    L T+HP  L++  PL 
Sbjct: 126 VQPRACIALGGTAARSLLGRPVAVM-KERGQW--VEDAATGRRVLVTLHPSALLRGDPLQ 182

Query: 244 KKNTWHALIT 253
           ++  W A + 
Sbjct: 183 REAAWEAWLK 192


>gi|329850866|ref|ZP_08265711.1| uracil DNA glycosylase superfamily protein [Asticcacaulis
           biprosthecum C19]
 gi|328841181|gb|EGF90752.1| uracil DNA glycosylase superfamily protein [Asticcacaulis
           biprosthecum C19]
          Length = 278

 Score =  139 bits (349), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 62/277 (22%), Positives = 115/277 (41%), Gaps = 26/277 (9%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVF-DEPNNEATYESQRKEKSIDSAIQPITNIRHI 59
           M     L  ++I +   F  D  +   + + P N    E++       +++  I      
Sbjct: 1   MFPSDDL-AKEIESYLGFLIDHELEESYANAPLNRTLSENKSPNPRAAASVTQIRVTPVA 59

Query: 60  HSPL--------------------VQQADSIAQKACSLHELKSLLRSFHDCHL-CSTSLS 98
            +P                     + +A   A  A SL EL + L +F    L    +  
Sbjct: 60  SAPQGGSLNALKPQNLAGLDTGAVLHEAKQRAGSARSLDELYAELEAFQHMPLRHEGATQ 119

Query: 99  TICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPW 158
            +    T   DL+++G  P   ++ SG+ F+GK G ++DK LQ+  ++  +  ++    W
Sbjct: 120 LVKFRGTADPDLIVVGECPDAEEDASGQAFAGKPGALIDKALQAAGVVE-RTLLTPCVFW 178

Query: 159 HPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSN 218
            P G R L++ ++ +  P +   I L SPK +L +G    +   N D +   +  G+   
Sbjct: 179 RPAGGRPLTDEDVSLTAPFMHALIRLASPKAILLLGAGAVSVVLNLDQRL-SELRGRVVG 237

Query: 219 LCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
                + +P++A+  P  L++ PL K   W  L+ LK
Sbjct: 238 YHGEPN-VPSMASYPPNFLLRQPLAKGLFWRDLLQLK 273


>gi|282857034|ref|ZP_06266285.1| uracil-DNA glycosylase [Pyramidobacter piscolens W5455]
 gi|282585195|gb|EFB90512.1| uracil-DNA glycosylase [Pyramidobacter piscolens W5455]
          Length = 201

 Score =  138 bits (348), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 45/196 (22%), Positives = 79/196 (40%), Gaps = 14/196 (7%)

Query: 77  LHELKSLLRSFHDCHLCS--------TSLSTICATQTEGQDLMIIGYTPSDSDNISGKPF 128
           L  L   +    +C L          ++   +     E   LMI+G  P   +  +G+PF
Sbjct: 4   LSALHRRVCQCRNCPLGQADGVREDGSAFYHVPGEGPENASLMIVGEAPGAEEERTGRPF 63

Query: 129 SGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPK 188
            G++G +L ++L + E+ R +I I+ I    PP NRN    E+  C P +  Q E I P+
Sbjct: 64  VGRSGRLLTEILAAAELKREEIFITSICKCRPPKNRNPLKTEIAACLPWLTDQFEAIRPR 123

Query: 189 ILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNT- 247
           ++L +GN                  G++         +      HP  L++ P   + + 
Sbjct: 124 LVLAVGNVPSQTLLGVKTGING-LRGRFHQFTWNGRRMTLRPLFHPAYLLRNPRRVEGSP 182

Query: 248 WH----ALITLKKALK 259
           W      L+  ++ L 
Sbjct: 183 WDKMLRDLVEARRFLA 198


>gi|296117296|ref|ZP_06835886.1| phage SPO1 DNA polymerase-related protein [Gluconacetobacter
           hansenii ATCC 23769]
 gi|295976062|gb|EFG82850.1| phage SPO1 DNA polymerase-related protein [Gluconacetobacter
           hansenii ATCC 23769]
          Length = 292

 Score =  138 bits (348), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 60/284 (21%), Positives = 107/284 (37%), Gaps = 35/284 (12%)

Query: 11  QILTIALFYADSGVYWVFDE-PNNE---------------------ATYESQRKEKSIDS 48
             L++   Y + G        P +                       +           S
Sbjct: 3   DSLSLLQLYVEWGADEALSPVPVDRLAQPQAKPPPPIQRARDEEHHFSRSPPSAPAVRPS 62

Query: 49  AIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQ 108
              P  +           A   A +A ++ EL   + +F  C L  T+  T+      G 
Sbjct: 63  RPAPPPSAATTAELAAADARDRAARATTVEELHIAMATFGQCALRDTATHTVTPQGRPGA 122

Query: 109 DLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSN 168
            +M++G  P   ++  G  F G+TG + D+M  SI + R  + ++ +  W PPG R  S 
Sbjct: 123 HVMVVGEAPDADEDRGGMAFCGETGKLTDRMFGSIGLSRDDLFLAPVIAWRPPGGRPPSA 182

Query: 169 IEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTP------ 222
           +E++ C P + R I L  P+ L+ +GN         +     +  G+W ++  P      
Sbjct: 183 MELKSCLPFLQRLIVLARPRRLILMGNIPV-ALLTGERITAARARGRWRDITVPENLSAT 241

Query: 223 ------HSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
                   +IP L   H Q+L   P  +++ W  ++ L+K L+ 
Sbjct: 242 GNNSAVPHVIPALPMRHAQQLRASPTARRDAWKDMLELRKTLQE 285


>gi|294630778|ref|ZP_06709338.1| uracil-DNA glycosylase, family 4 [Streptomyces sp. e14]
 gi|292834111|gb|EFF92460.1| uracil-DNA glycosylase, family 4 [Streptomyces sp. e14]
          Length = 216

 Score =  138 bits (348), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 31/193 (16%), Positives = 63/193 (32%), Gaps = 10/193 (5%)

Query: 56  IRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGY 115
                      A+        L  L+        C L   +  T+         +M++G 
Sbjct: 2   PTTHAPEDAYTAEPFVPADADLAALREAAAGCRGCPLHRDATQTVFGAGDTTARVMLVGE 61

Query: 116 TPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSN------- 168
            P D ++  G+PF G  G +LD+ L    I   + +++                      
Sbjct: 62  QPGDQEDRQGRPFVGPAGKLLDRALAEAGIDPGEAYVTNAVKHFKFTRAEPRKRRIHKAP 121

Query: 169 --IEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSII 226
              EM  C P +  ++ L+ P++++ +G         +  +   +  G            
Sbjct: 122 TLREMTACGPWLAAELALVEPELIVVLGATAGKALLGSSFRV-TEVRGTVLEHEIHGRPE 180

Query: 227 PTLATVHPQELIQ 239
             + TVHP  +++
Sbjct: 181 RLVPTVHPSSVLR 193


>gi|332187341|ref|ZP_08389079.1| uracil-DNA glycosylase, 4 family protein [Sphingomonas sp. S17]
 gi|332012502|gb|EGI54569.1| uracil-DNA glycosylase, 4 family protein [Sphingomonas sp. S17]
          Length = 465

 Score =  138 bits (347), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 40/250 (16%), Positives = 77/250 (30%), Gaps = 19/250 (7%)

Query: 24  VYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQAD--SIAQKACSLHELK 81
           +  +  E   +                        +                  +   L+
Sbjct: 219 IGAMLKEMPRKYWKNMPETALVPQLIAGAQARETGMIDTAKVDVRSGRGGNAQAAWAALR 278

Query: 82  SLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQ 141
                   C L + +  T+         LM +G  P D ++++G+PF G  G + D+ + 
Sbjct: 279 DEAMGCTRCPLHAPATQTVFGEGPVDASLMFVGEQPGDQEDLAGRPFVGPAGQVFDRAVA 338

Query: 142 SIEIMRTQIHISMISPWHPPG-------NRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
              I R   +++                + + +  E++ CR  + ++  LI PK+ + +G
Sbjct: 339 EAGIDRATAYVTNAVKHFKFEPRGKRRIHSSPNAGEIQACRWWVEQERLLIQPKVTVALG 398

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ--YPLIKK----NTW 248
                  F        +  GK   L    +      TVHP  L++   P  K+       
Sbjct: 399 ATAARSLFG-KVMTIGRERGKALTLPDGGT---AFITVHPSYLLRLPDPAAKEVEYTRFV 454

Query: 249 HALITLKKAL 258
             L     AL
Sbjct: 455 EDLKLAANAL 464


>gi|309790323|ref|ZP_07684890.1| phage SPO1 DNA polymerase-related protein [Oscillochloris
           trichoides DG6]
 gi|308227657|gb|EFO81318.1| phage SPO1 DNA polymerase-related protein [Oscillochloris
           trichoides DG6]
          Length = 210

 Score =  138 bits (347), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 38/189 (20%), Positives = 75/189 (39%), Gaps = 7/189 (3%)

Query: 73  KACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKT 132
            A ++  +   +R+   C L +     +         +M+IG  P   ++  G+PF G +
Sbjct: 2   SAETIQLIAQEVRTCTLCGLANGRTRAVPGEGPADARIMVIGEGPGFHEDRQGRPFVGPS 61

Query: 133 GNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEIC-RPIIMRQIELISPKILL 191
           G  LD +L    + R  + I+ +    PP NR+    E+ IC    + RQI  I P +++
Sbjct: 62  GKFLDDLLAMAGLSRETVFIANVVKCRPPQNRDPQPDEIAICTEHYLYRQIVAIDPPVIV 121

Query: 192 FIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
            +G  + +       ++  +  G+  N+         +  +HP   +  P  +       
Sbjct: 122 TLGRFSMS--LFMPGERIMRVHGQPRNI----DGRLVVPMLHPAAALHQPQNRPLIEADF 175

Query: 252 ITLKKALKN 260
             L + L  
Sbjct: 176 RRLPEILAQ 184


>gi|162450005|ref|YP_001612372.1| putative DNA polymerase related protein [Sorangium cellulosum 'So
           ce 56']
 gi|161160587|emb|CAN91892.1| putative DNA polymerase related protein [Sorangium cellulosum 'So
           ce 56']
          Length = 220

 Score =  138 bits (347), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 40/207 (19%), Positives = 79/207 (38%), Gaps = 17/207 (8%)

Query: 65  QQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNIS 124
             A ++     SL  L+        C L      T+        D++++G  P D ++++
Sbjct: 17  ATAAALVPSPPSLPSLREAAARCRACPLWERGTQTVFGEGAARSDVLLVGEQPGDKEDLA 76

Query: 125 GKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWH-------PPGNRNLSNIEMEICRPI 177
           GKPF G  G +LD+ L++  I R + +++ +              +      E+  C P 
Sbjct: 77  GKPFVGPAGQLLDRALEAAGIERRRAYVTNVVKHFKWEPRGKRRIHMKPDAREIRACLPW 136

Query: 178 IMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQEL 237
           +  +I ++ P I++ +G            +   +  G+             LATVHP  +
Sbjct: 137 LAAEIAVVQPAIVVCLGATAAQALLGGSFRV-TRERGRI---VASPLAPRVLATVHPASI 192

Query: 238 IQYPLI--KK----NTWHALITLKKAL 258
           ++ P    ++         L    +AL
Sbjct: 193 LRAPDEATRRAELSRFIEDLTVAARAL 219


>gi|110634843|ref|YP_675051.1| phage SPO1 DNA polymerase-related protein [Mesorhizobium sp. BNC1]
 gi|110285827|gb|ABG63886.1| phage SPO1 DNA polymerase-related protein [Chelativorans sp. BNC1]
          Length = 476

 Score =  138 bits (347), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 37/239 (15%), Positives = 82/239 (34%), Gaps = 18/239 (7%)

Query: 32  NNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCH 91
            +       R  +   +A +         +  +    + + +   L  L+  ++S   C 
Sbjct: 239 PDMVRAAGARVAEMETTAPETPPRFAERLAERMASISAQSGELLPLDVLREEIQSCRLCP 298

Query: 92  LCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIH 151
           L   +   +        ++M +G  P D ++++G+PF G  G + ++ L    I R + +
Sbjct: 299 LHGPATQAVPGEGAPEAEIMFVGEQPGDQEDLAGRPFVGPAGQVFERALLEAGIARQKTY 358

Query: 152 ISMISPWHPPG-------NRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNN 204
           ++                +   S  E+  CR  + R+I  + PK+++ +G          
Sbjct: 359 VTNAVKHFKFEPRGKRRVHMKPSGGEVSKCRFWLDREISAVKPKLVVALGATAMLGLTG- 417

Query: 205 DAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKK------NTWHALITLKKA 257
                 +  G+             L TVHP  L++ P  ++           L   +  
Sbjct: 418 RPVPVTKARGQV----IAADSFSILVTVHPSYLLRLPEKERAEAEYERFVEDLRKARDW 472


>gi|190895487|ref|YP_001985779.1| DNA-directed DNA polymerase protein [Rhizobium etli CIAT 652]
 gi|190699432|gb|ACE93516.1| probable DNA-directed DNA polymerase protein [Rhizobium etli CIAT
           652]
          Length = 213

 Score =  138 bits (347), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 36/199 (18%), Positives = 77/199 (38%), Gaps = 17/199 (8%)

Query: 72  QKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGK 131
             A S+ EL+        C L   +  T+        +++I+G  P D ++I+G+PF G 
Sbjct: 16  ADADSIDELRHQAEGCTRCDLYRNATQTVFGEGPNKAEIVIVGEQPGDREDITGRPFVGP 75

Query: 132 TGNMLDKMLQSIEIMRTQIHISMISPWHPPG-------NRNLSNIEMEICRPIIMRQIEL 184
            G++LD  L+   + R + +++                +   +  E+  C   +  ++ +
Sbjct: 76  AGHLLDHCLEEAGVDRQRCYVTNAVKHFKFTPRGKRRLHAKPNAGEIRRCAWWLGAELNI 135

Query: 185 ISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPL-- 242
           + PK+++ +G           A+      G       P +  P L T+HP  L++     
Sbjct: 136 LQPKLIVTLGASALYALLGPKAKL-TPERGHILQ---PRNHPPILVTIHPSFLLRIRDEA 191

Query: 243 ----IKKNTWHALITLKKA 257
                ++     L  + + 
Sbjct: 192 EKHRQRQAFVSDLHKVAEF 210


>gi|54024698|ref|YP_118940.1| hypothetical protein nfa27290 [Nocardia farcinica IFM 10152]
 gi|54016206|dbj|BAD57576.1| hypothetical protein [Nocardia farcinica IFM 10152]
          Length = 211

 Score =  138 bits (347), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 30/195 (15%), Positives = 75/195 (38%), Gaps = 13/195 (6%)

Query: 72  QKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGK 131
                L  L++ ++    C L   +   +         + ++G  P D ++++G PF G 
Sbjct: 14  PADADLDTLRTAVQGCRGCELYRGATQAVFGEGPAHAPVFVVGEQPGDREDVAGHPFVGP 73

Query: 132 TGNMLDKMLQSIEIMRTQIHISMISPWHPPG-------NRNLSNIEMEICRPIIMRQIEL 184
            G +LDK L   +I R  ++++                ++     E+  C P +  +++ 
Sbjct: 74  AGRLLDKALTEADIDREAVYLTNAVKHFKFEERGKRRIHKQPGRTEVVACSPWLTAELDA 133

Query: 185 ISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIK 244
           + P++++ +G            +   +  G+             +ATVHP  +++ P  +
Sbjct: 134 VRPQLVVCLGAVAAKAVLGPSFKV-SERRGEVVEA----GEHRVIATVHPSSVLRAPD-R 187

Query: 245 KNTWHALITLKKALK 259
              +   +   + ++
Sbjct: 188 AAAYADFLADLRKVR 202


>gi|89899005|ref|YP_521476.1| phage SPO1 DNA polymerase-like protein [Rhodoferax ferrireducens
           T118]
 gi|89343742|gb|ABD67945.1| phage SPO1 DNA polymerase-related protein [Rhodoferax ferrireducens
           T118]
          Length = 296

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 47/251 (18%), Positives = 93/251 (37%), Gaps = 20/251 (7%)

Query: 29  DEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKA---CSLHELKSLLR 85
           + P+N     +     +  +A + +       +        +            L   + 
Sbjct: 43  EAPSNAIENVATNITTTGATAQKILKTSAPPETRGTATGSGVPATDVAGLDWPALTQAIA 102

Query: 86  SFHDCHLCSTSLSTICA--TQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSI 143
           +   C LC    + + A        D +++G  P D+D  +G PF+G  G +LD ML+++
Sbjct: 103 TCQACPLCIGRRTAVQAAPDAPRLADWLLVGEPPDDADEQAGAPFAGAAGQLLDNMLKAL 162

Query: 144 EIMRT--------------QIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKI 189
            + R                 +++ I    P   RN +  E+  C   + R++ L+ PK+
Sbjct: 163 GLSRHAGSGVAAPAAQATTAAYVTPIVKCRPAQTRNPTQAELASCENYLRREVALVQPKV 222

Query: 190 LLFIGNKTKNFFF-NNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTW 248
           +L +G          +        LG+       +  IP + +  P  L++ P  K   W
Sbjct: 223 ILALGRFAAQGLLQGSLPGLAGTPLGQLRGQIYRYQGIPVIVSYPPSYLLRSPQHKARAW 282

Query: 249 HALITLKKALK 259
             L   ++AL+
Sbjct: 283 VDLCQAQEALR 293


>gi|329765399|ref|ZP_08256979.1| uracil-DNA glycosylase-like protein [Candidatus Nitrosoarchaeum
           limnia SFB1]
 gi|329138305|gb|EGG42561.1| uracil-DNA glycosylase-like protein [Candidatus Nitrosoarchaeum
           limnia SFB1]
          Length = 197

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 42/184 (22%), Positives = 78/184 (42%), Gaps = 6/184 (3%)

Query: 78  HELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLD 137
             ++  + +   C L  T  +++        D++ +G  P  +++  G+PF G  G  L 
Sbjct: 6   EAIRQKVIACTKCDLSKTRTNSVPGKGNFQSDVIFVGEAPGRNEDKKGEPFVGIAGQRLS 65

Query: 138 KMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKT 197
             L+S  + R  I+I+ +    PP NR  + +E+++C   + ++I +I PKI+  +GN  
Sbjct: 66  AALESAGVSRESIYITNVVKCRPPNNRIPTIMELDMCHDYLQKEIAIIKPKIICILGNTA 125

Query: 198 KNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKA 257
            N        +  +  GK             L TVHP   I    +       +I L   
Sbjct: 126 FNSILG--GSEITKYRGKI---VKKDKEFYFL-TVHPAATIYNQELITVLKEDIIKLFDL 179

Query: 258 LKNL 261
           ++ L
Sbjct: 180 IREL 183


>gi|21233093|ref|NP_639010.1| DNA polymerase related protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66770033|ref|YP_244795.1| DNA polymerase related protein [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|21114947|gb|AAM42934.1| DNA polymerase related protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66575365|gb|AAY50775.1| DNA polymerase related protein [Xanthomonas campestris pv.
           campestris str. 8004]
          Length = 425

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 45/234 (19%), Positives = 82/234 (35%), Gaps = 17/234 (7%)

Query: 31  PNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDC 90
           P      E  R+       +                A   A  A SL +L+   R    C
Sbjct: 187 PEATLLPELIREAGVRVREMAERAPEPVRRRVPAAPAALPAVAAQSLAQLRVAARDCRRC 246

Query: 91  HLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQI 150
            L   +  T+     +   +M+IG  P D +++SG+PF G  G + ++ L  + I R + 
Sbjct: 247 DLWQPATQTVFGEGPDDAAVMVIGEQPGDEEDLSGRPFVGPAGRLFNQALGELGIDRQRF 306

Query: 151 HISMISPWHPPG-------NRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFN 203
           +++                +RN     ++ C   +  +   + P  ++ +G         
Sbjct: 307 YVTNAVKHFRFEQRGKRRLHRNPERSHVQACNGWLQAERAQLRPAQIVCLGATAAQAVLG 366

Query: 204 NDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQY--PLIK----KNTWHAL 251
               +  Q  G+W  L       P LATVHP  +++   P  +    +     L
Sbjct: 367 P-GFRLMQERGQWQRL---DDGTPVLATVHPSWVLRQGTPSARDAGYRGFVADL 416


>gi|307309406|ref|ZP_07589065.1| phage SPO1 DNA polymerase-related protein [Sinorhizobium meliloti
           BL225C]
 gi|306900136|gb|EFN30755.1| phage SPO1 DNA polymerase-related protein [Sinorhizobium meliloti
           BL225C]
          Length = 213

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 35/216 (16%), Positives = 80/216 (37%), Gaps = 18/216 (8%)

Query: 56  IRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGY 115
            +         A   A+ A ++  L+        C L   +   +         ++++G 
Sbjct: 2   PKQPAKLGPALAGEHAE-ATTIASLRRQAERCERCDLYKDATQLVFGEGPVDARVVLVGE 60

Query: 116 TPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPG-------NRNLSN 168
            P D ++++G+PF G  G +LD+ L    I R++ +++                +   + 
Sbjct: 61  QPGDREDLAGRPFVGPAGRILDECLHEAGIDRSECYLTNAVKHFKFEQRGKRRLHSRPNA 120

Query: 169 IEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPT 228
            E++ C   +  +++ + P+I++ +G           +    +N G    L T       
Sbjct: 121 GEIQACAWWLGAELDELRPEIVVALGATALMSLLG-RSVGVTRNRG---ELLTAPGGFSV 176

Query: 229 LATVHPQELIQ-----YPLIKK-NTWHALITLKKAL 258
           L T+HP  L++      P  ++      L  +   +
Sbjct: 177 LVTIHPSYLLRIRGRSDPEAERARFVGDLAKVAARI 212


>gi|327194181|gb|EGE61045.1| DNA-directed DNA polymerase protein [Rhizobium etli CNPAF512]
          Length = 218

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 31/199 (15%), Positives = 73/199 (36%), Gaps = 17/199 (8%)

Query: 72  QKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGK 131
             A S+ +L+        C L   +   +     +  ++ ++G  P D ++I+G+PF G 
Sbjct: 21  ADAESIADLRRQAEGCTRCDLYRNATQLVFGEGPDKAEVALVGEQPGDREDITGRPFVGP 80

Query: 132 TGNMLDKMLQSIEIMRTQIHISMISPWHPPG-------NRNLSNIEMEICRPIIMRQIEL 184
            G++LD+ L+   + R + +++                +   +  E+  C   +  ++ +
Sbjct: 81  AGHLLDQCLEEAGLDRQRCYVTNAVKHFKFTPRGKRRLHAKPNAGEIRRCAWWLGAELNI 140

Query: 185 ISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ----- 239
           + PK+++ +G            +      G            P L T+HP  L++     
Sbjct: 141 LQPKLVVALGATALYALLGPKVKL-TPERGHILQPTNRP---PVLVTIHPSYLLRIRDEA 196

Query: 240 -YPLIKKNTWHALITLKKA 257
                ++     L    + 
Sbjct: 197 EQHRQRRQFVSDLHKAAEF 215


>gi|116620515|ref|YP_822671.1| Fis family transcriptional regulator [Candidatus Solibacter
           usitatus Ellin6076]
 gi|116223677|gb|ABJ82386.1| transcriptional regulator, Fis family [Candidatus Solibacter
           usitatus Ellin6076]
          Length = 204

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 42/206 (20%), Positives = 77/206 (37%), Gaps = 17/206 (8%)

Query: 67  ADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGK 126
           A ++     S   L         CHL   +  T+         LM++G  P + ++++G 
Sbjct: 3   ASALIPVKLSWQSLHDAAGGCKACHLWEHATQTVFGEGKSHAPLMLVGEQPGNEEDLAGH 62

Query: 127 PFSGKTGNMLDKMLQSIEIMRTQIHISMISPWH-------PPGNRNLSNIEMEICRPIIM 179
           PF G  G +LD  L++  I R Q +++ +              +   +  E+  C P + 
Sbjct: 63  PFVGPAGRLLDDALEAAGIDRKQAYVTNVVKHFKWEPRGKRRIHAKPTTAEITACIPWLT 122

Query: 180 RQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ 239
            ++EL+ P+IL+ +G            +   +  GK             +ATVHP  +++
Sbjct: 123 AELELVKPRILICLGATAAQALLGRTFRV-TKQRGKLVESKLAP---YVMATVHPSSILR 178

Query: 240 YPLIKKN------TWHALITLKKALK 259
            P               L +  K L 
Sbjct: 179 APDADARHAEMQSFIADLKSAAKILA 204


>gi|13474291|ref|NP_105859.1| hypothetical protein mll5147 [Mesorhizobium loti MAFF303099]
 gi|14025043|dbj|BAB51645.1| mll5147 [Mesorhizobium loti MAFF303099]
          Length = 223

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 36/224 (16%), Positives = 82/224 (36%), Gaps = 17/224 (7%)

Query: 48  SAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEG 107
           +AI P             +         S+ EL+   +    C L   +  T+     + 
Sbjct: 2   TAILPHRTQTSAGRASRARQALDEHFDGSISELREAAKGCRRCPLWRDATQTVFGEGPDN 61

Query: 108 QDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPG----- 162
             ++ +G  P D ++++GKPF G  G + D +L   E+ R +++++              
Sbjct: 62  AKVIFVGEQPGDQEDLAGKPFVGPAGKVFDAILDEAEVDRLKVYVTNAVKHFKFEPRGKR 121

Query: 163 --NRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLC 220
             +   +  E++ CR  + R+  LI P++ + +G           A    +  G+     
Sbjct: 122 RIHSKPNAGEVQACRWWLDREFALIKPELAVALGATAALSLLG-KAIPVTKMRGQVIE-- 178

Query: 221 TPHSIIPTLATVHPQELIQ------YPLIKKNTWHALITLKKAL 258
                +    T+HP  +++          ++     +  +K+ +
Sbjct: 179 -REDGLRVFITIHPSFILRIHEPVDKEAERERFLRDMREVKRLM 221


>gi|257063504|ref|YP_003143176.1| uracil-DNA glycosylase, family 4 [Slackia heliotrinireducens DSM
           20476]
 gi|256791157|gb|ACV21827.1| uracil-DNA glycosylase, family 4 [Slackia heliotrinireducens DSM
           20476]
          Length = 213

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 44/180 (24%), Positives = 73/180 (40%), Gaps = 5/180 (2%)

Query: 82  SLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQ 141
             +R+   C+LC    + +      G  +M+IG  P  ++++ GKPF G  GN L ++L 
Sbjct: 28  DAVRACRKCYLCEGRTNAVPGFGNAGARIMLIGEAPGKNEDLQGKPFVGAAGNYLTELLG 87

Query: 142 SIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFF 201
              + R ++ I+ I    PP NRN    E+  C P +  Q+  I P+ ++ +GN    F 
Sbjct: 88  YAGLTREEVFIANILKCRPPSNRNPQPDEIFECTPYLRDQVRAIMPEYIVTMGNFATKFI 147

Query: 202 FNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
              D        G              L   HP   I     ++      + L + L N+
Sbjct: 148 LRTDR-GITGLRGNL----QKTGQFSVLPVFHPAAAIYDRTKREVLEADFVYLGRLLGNV 202


>gi|56552010|ref|YP_162849.1| phage SPO1 DNA polymerase-related protein [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|241761912|ref|ZP_04759997.1| phage SPO1 DNA polymerase-related protein [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|56543584|gb|AAV89738.1| phage SPO1 DNA polymerase-related protein [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|241373592|gb|EER63164.1| phage SPO1 DNA polymerase-related protein [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
          Length = 206

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 36/207 (17%), Positives = 82/207 (39%), Gaps = 16/207 (7%)

Query: 67  ADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGK 126
           +++  +KA S  +L   L     C L   +   +C   +    ++ +G  P D ++++G+
Sbjct: 2   SEAAVKKAPSWEDLTEALHHCTRCALYQKATQVVCGEGSHTSPVIFVGEQPGDQEDLAGR 61

Query: 127 PFSGKTGNMLDKMLQSIEIMRTQIHISMISPWH-------PPGNRNLSNIEMEICRPIIM 179
           PF G  G + D+++ SI   R +I+++                ++  +  E++ CR  + 
Sbjct: 62  PFVGPAGQVFDEVMASIGWPREEIYLTNAVKHFKFWLKGERRIHQTPAPEEVDCCRYWLR 121

Query: 180 RQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ 239
           ++  L+ P++ + +G                   GK   L    +  P + T HP  +++
Sbjct: 122 QEWRLLKPRLTIALGGTAVLALTGKKQTLGS-LRGKI--LTLGKAAAPFIVTYHPSYILR 178

Query: 240 YPLI--KKNTW----HALITLKKALKN 260
                 ++  +      L   +  L  
Sbjct: 179 QASEEGRQRAYQAMQQDLTIARNFLAA 205


>gi|15889460|ref|NP_355141.1| hypothetical protein Atu2180 [Agrobacterium tumefaciens str. C58]
 gi|15157326|gb|AAK87926.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 481

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 45/210 (21%), Positives = 87/210 (41%), Gaps = 11/210 (5%)

Query: 37  YESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTS 96
            E++  E +  +A QP      + +    +         +L  L    R    C L   +
Sbjct: 252 AEARVLEMAAKAASQPQPFHHRLQAAASAREMPQPVSDGTLQSLAREARQCTRCALHCKA 311

Query: 97  LSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMIS 156
             T+     E  D+MI+G  P D+++++GKPF G  G + D+ L+ I   R +++++   
Sbjct: 312 TQTVFGEGPEDADIMIVGEQPGDNEDLAGKPFIGPAGQLFDRTLREIGAERKKLYVTNAV 371

Query: 157 PWHPPG-------NRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKT 209
                        ++  +  E+E CR  + R+I L+ PK+++ +G            +K 
Sbjct: 372 KHFKYETRGKRRIHQRPNAGEVEQCRWWLNREIALVRPKLIVAMGATALYALTGGK-EKV 430

Query: 210 YQNLGKWSNLCTPHSIIPTLATVHPQELIQ 239
            +  G+   +           TVHP  L++
Sbjct: 431 SEIRGRPLPME---EGRTLFVTVHPSYLLR 457


>gi|114766766|ref|ZP_01445703.1| putative uracil-DNA glycosylase [Pelagibaca bermudensis HTCC2601]
 gi|114541023|gb|EAU44080.1| putative uracil-DNA glycosylase [Roseovarius sp. HTCC2601]
          Length = 316

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 40/223 (17%), Positives = 85/223 (38%), Gaps = 12/223 (5%)

Query: 27  VFDEP-NNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLR 85
           + + P   E   E+Q + +++  A   +  IR        +A            L + L 
Sbjct: 69  LPEAPLIPELIAEAQSRAQAMADAAPSLPPIRAERITERLRAPEAPAPVGDREALLTGLA 128

Query: 86  SFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEI 145
               C L   +   +         LMI+G  P D ++++G+PF G  G + D + +   +
Sbjct: 129 GCRRCPLWQNATQPVAGEGPLDAALMIVGEQPGDQEDLAGRPFVGPAGQLFDAVAERAGL 188

Query: 146 MRTQIHISMISPWHPPG-------NRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTK 198
            R + +++                +++ ++ E+  CR  +  + +L+ PK+++ +G    
Sbjct: 189 ARDRAYVTNAVKHFKFAPRGKRRLHQSPNSGEIAHCRWWLDMERQLVRPKLIVAMGASAA 248

Query: 199 NFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
                 D ++     G            P + T HP  L++ P
Sbjct: 249 ESLTG-DGRRIGTRRGTL---EQAPDGTPVMVTWHPSYLLRLP 287


>gi|74317499|ref|YP_315239.1| putative phage DNA polymerase [Thiobacillus denitrificans ATCC
           25259]
 gi|74056994|gb|AAZ97434.1| putative phage DNA polymerase [Thiobacillus denitrificans ATCC
           25259]
          Length = 235

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 35/205 (17%), Positives = 77/205 (37%), Gaps = 11/205 (5%)

Query: 43  EKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICA 102
             +  +A      +          A     K  S+  L+   R    C L   +  T+  
Sbjct: 7   RPARRAAHPEEAQMAEADDETPPTAAPFVPKTRSIDALRRAARGCRGCALYRNATQTVFG 66

Query: 103 TQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWH--- 159
                  ++++G  P + +++ G+PF G  G +LD+ L +  I R   +++ +       
Sbjct: 67  EGASHARVLLVGEQPGNDEDLEGRPFVGSAGRVLDEGLAAAGIDRAATYVTNVVKHFKWE 126

Query: 160 ----PPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGK 215
                  +   +  E++ C P + R+I L+ P +++ +G          D +   +  G+
Sbjct: 127 PSGKRRMHSKPNLREIDACFPWLEREIALLRPHLIVCLGATAAQALLGRDFRV-TRQRGQ 185

Query: 216 WSNLCTPHSIIPTLATVHPQELIQY 240
                        +AT+HP  +++ 
Sbjct: 186 LVASPLAPH---VVATIHPSAILRQ 207


>gi|5932364|gb|AAD56917.1|AF180145_9 hypothetical protein; zm12orf4 [Zymomonas mobilis subsp. mobilis
           ZM4]
          Length = 206

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 37/207 (17%), Positives = 83/207 (40%), Gaps = 16/207 (7%)

Query: 67  ADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGK 126
           +++  +KA S  +L   L   H C L   +   +C   +    ++ +G  P D ++++G+
Sbjct: 2   SEAAVKKAPSWEDLTEALHHCHSCALYQKATQVVCGEGSHTSPVIFVGEQPGDQEDLAGR 61

Query: 127 PFSGKTGNMLDKMLQSIEIMRTQIHISMISPWH-------PPGNRNLSNIEMEICRPIIM 179
           PF G  G + D+++ SI   R +I+++                ++  +  E++ CR  + 
Sbjct: 62  PFVGPAGQVFDEVMASIGWPREEIYLTNAVKHFKFWLKGERRIHQTPAPEEVDCCRYWLR 121

Query: 180 RQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ 239
           ++  L+ P++ + +G                   GK   L    +  P + T HP  +++
Sbjct: 122 QEWRLLKPRLTIALGGTAVLALTGKKQTLGS-LRGKI--LTLGKAAAPFIVTYHPSYILR 178

Query: 240 YPLI--KKNTW----HALITLKKALKN 260
                 ++  +      L   +  L  
Sbjct: 179 QASEEGRQRAYQAMQQDLTIARNFLAA 205


>gi|260752452|ref|YP_003225345.1| phage SPO1 DNA polymerase-related protein [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
 gi|258551815|gb|ACV74761.1| phage SPO1 DNA polymerase-related protein [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
          Length = 206

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 35/207 (16%), Positives = 82/207 (39%), Gaps = 16/207 (7%)

Query: 67  ADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGK 126
           +++  +KA S  +L   L     C L   +   +C   +    ++ +G  P D ++++G+
Sbjct: 2   SEAAVKKAPSWEDLTEALHHCTRCALYQKATQVVCGEGSHTSPVIFVGEQPGDQEDLAGR 61

Query: 127 PFSGKTGNMLDKMLQSIEIMRTQIHISMISPWH-------PPGNRNLSNIEMEICRPIIM 179
           PF G  G + D+++ SI   + +I+++                ++  +  E++ CR  + 
Sbjct: 62  PFVGPAGQVFDEVMASIGWPKEEIYLTNAVKHFKFWLKGERRIHQTPAPEEVDCCRYWLR 121

Query: 180 RQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ 239
           ++  L+ P++ + +G                   GK   L    +  P + T HP  +++
Sbjct: 122 QEWRLLKPRLTIALGGTAVLALTGKKQTLGS-LRGKI--LTLGKAAAPFIVTYHPSYILR 178

Query: 240 YPLI--KKNTW----HALITLKKALKN 260
                 ++  +      L   +  L  
Sbjct: 179 QASEEGRQRAYQAMQQDLTMARNFLAA 205


>gi|225164210|ref|ZP_03726485.1| phage SPO1 DNA polymerase-related protein [Opitutaceae bacterium
           TAV2]
 gi|224801184|gb|EEG19505.1| phage SPO1 DNA polymerase-related protein [Opitutaceae bacterium
           TAV2]
          Length = 310

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 48/226 (21%), Positives = 80/226 (35%), Gaps = 23/226 (10%)

Query: 51  QPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCH-LCSTSLSTICATQTEGQD 109
           +   +      P          KA     LK L+ +   C          +    T    
Sbjct: 75  RSAQSAAASLPPPPVVTLPDGDKATRWACLKDLVTNHPICRANVRPGTLPVLGVGTLDAK 134

Query: 110 LMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPP-------- 161
           +M +G  P   + + G+PF G  G +L +M+  + + R  ++I  I  W P         
Sbjct: 135 IMFVGEAPGAEEEVRGEPFVGPAGQLLTRMIAGMGLKREDVYIGNIMNWRPQIPTPPGCE 194

Query: 162 --GNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFN-NDAQKTYQNLGKWSN 218
             GNR  S  EME C P    Q+ +++P IL+ +G           + +   Q  G+W  
Sbjct: 195 QIGNRPPSQAEMEFCLPFFRAQVAIVNPDILVALGKTAAQGMLGLGNVKTLGQVRGRWHT 254

Query: 219 LCTPHSIIPTLATVHPQELIQYPLI-------KKNTWHALITLKKA 257
                   P + T HP  L+            K+  W  L+ + + 
Sbjct: 255 FDGK----PLMVTYHPSYLLHQSDQSARAKQSKRMIWEDLLQVMER 296


>gi|163746768|ref|ZP_02154125.1| uracil-DNA glycosylase, putative [Oceanibulbus indolifex HEL-45]
 gi|161379882|gb|EDQ04294.1| uracil-DNA glycosylase, putative [Oceanibulbus indolifex HEL-45]
          Length = 476

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 35/185 (18%), Positives = 72/185 (38%), Gaps = 13/185 (7%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           + EL + +R+   C L   +   +        DLM++G  P D ++++G+PF G  G M 
Sbjct: 282 MEELPAAIRACTRCPLHCHATQAVPGEGPTRADLMVVGEQPGDQEDLAGRPFVGPAGQMF 341

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPG-------NRNLSNIEMEICRPIIMRQIELISPKI 189
           D++     + R   +++                ++     E++ CR  +  ++  + PK+
Sbjct: 342 DRVASEAGLDREAAYVTNAVKHFKFTARGKRRIHQRPETSEIDQCRWWVNAEVAQVQPKL 401

Query: 190 LLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ--YPLIKKNT 247
           +L +G                +  G           IP L T+HP  L++   P +++  
Sbjct: 402 ILAMGATAAQSLTG-SGAGILKRRGTI---EAGPEGIPVLITLHPSYLLRVPDPALREEA 457

Query: 248 WHALI 252
                
Sbjct: 458 EAQFR 462


>gi|256371255|ref|YP_003109079.1| phage SPO1 DNA polymerase-related protein [Acidimicrobium
           ferrooxidans DSM 10331]
 gi|256007839|gb|ACU53406.1| phage SPO1 DNA polymerase-related protein [Acidimicrobium
           ferrooxidans DSM 10331]
          Length = 189

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 39/166 (23%), Positives = 73/166 (43%), Gaps = 6/166 (3%)

Query: 75  CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
             L  L++ +R+ H C L +     +         L+++G  P   ++  G+PF G++G 
Sbjct: 4   PELEALEAEVRACHACRLSAGRHQAVPGEGAAPAPLLVVGEGPGAREDELGRPFVGRSGQ 63

Query: 135 MLDKMLQS-IEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFI 193
           +LD +L     + R+ ++I+      PPGNR     E+E CR  + RQI L+ P +++ +
Sbjct: 64  LLDALLADETGLDRSGLYIANTVKCRPPGNRTPRPDEVEACRGFLARQIHLVDPVVIVAL 123

Query: 194 GNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ 239
           G     +F      +     G+             + T HP   ++
Sbjct: 124 GQSAAAWFLGP-GARVGALRGQVLEWE----GRALVVTYHPSAALR 164


>gi|258541499|ref|YP_003186932.1| bacteriophage-type DNA polymerase [Acetobacter pasteurianus IFO
           3283-01]
 gi|256632577|dbj|BAH98552.1| bacteriophage-type DNA polymerase [Acetobacter pasteurianus IFO
           3283-01]
 gi|256635634|dbj|BAI01603.1| bacteriophage-type DNA polymerase [Acetobacter pasteurianus IFO
           3283-03]
 gi|256638689|dbj|BAI04651.1| bacteriophage-type DNA polymerase [Acetobacter pasteurianus IFO
           3283-07]
 gi|256641743|dbj|BAI07698.1| bacteriophage-type DNA polymerase [Acetobacter pasteurianus IFO
           3283-22]
 gi|256644798|dbj|BAI10746.1| bacteriophage-type DNA polymerase [Acetobacter pasteurianus IFO
           3283-26]
 gi|256647853|dbj|BAI13794.1| bacteriophage-type DNA polymerase [Acetobacter pasteurianus IFO
           3283-32]
 gi|256650906|dbj|BAI16840.1| bacteriophage-type DNA polymerase [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256653897|dbj|BAI19824.1| bacteriophage-type DNA polymerase [Acetobacter pasteurianus IFO
           3283-12]
          Length = 284

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 67/281 (23%), Positives = 107/281 (38%), Gaps = 32/281 (11%)

Query: 9   QEQILTIALFYADSGVY-WVFDEPNNEATYESQ-------------------------RK 42
            E  L++   Y + GV   V D P +     +                          R 
Sbjct: 2   MEAALSLLRLYTEWGVDVAVTDAPVDHRHAGAGLVLPPLRGKTPPQAPPYIPPQPGTGRT 61

Query: 43  EKSIDSAIQPITNIRHIHS--PLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTI 100
                    P        S    V+QA  +A  A +  EL   + SF  C L   ++ T+
Sbjct: 62  PAPAAVTQNPAQQPPVPTSFADTVEQAQRLAAAANTPEELFEAMDSFTACPLRGAAMHTL 121

Query: 101 CATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHP 160
             +      LM+IG  P + ++ SG+ F+G  G MLD ML  + + R+Q+ ++   PW P
Sbjct: 122 MPSGPRNAPLMLIGEAPDEDEDRSGQVFAGLCGTMLDTMLAPLPLERSQLALATALPWRP 181

Query: 161 PGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLC 220
            G    + ++  ICRP + R I L +P+ LL  G                     W N+ 
Sbjct: 182 AGGTPPTEMDQRICRPFLERAITLFAPQRLLLCGRLPARMLLGKTTDL---PRRNWQNIT 238

Query: 221 TPHS-IIPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
            P    +P +   HP +L   P  ++  W  L+T+   L+ 
Sbjct: 239 LPGLPPLPVMFMRHPLQLRASPAARREIWTTLMTVMDTLRQ 279


>gi|302389751|ref|YP_003825572.1| phage SPO1 DNA polymerase-related protein [Thermosediminibacter
           oceani DSM 16646]
 gi|302200379|gb|ADL07949.1| phage SPO1 DNA polymerase-related protein [Thermosediminibacter
           oceani DSM 16646]
          Length = 252

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 46/205 (22%), Positives = 85/205 (41%), Gaps = 17/205 (8%)

Query: 68  DSIAQKACSLHELKSLLR----SFHDCHLC--STSLSTICATQTEGQDLMIIGYTPSDSD 121
           D   Q A     LK+ +        +C L         +         LM+IG  P   +
Sbjct: 48  DKGEQSAKMRDFLKNEVLKLLYECGECPLHLAECHTQKVPGDGDWNSPLMLIGEGPGFEE 107

Query: 122 NISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQ 181
           +  GKPF G+ G +L  +L  + I R +++I+ +    PP NR   + E++ C+ I+  +
Sbjct: 108 DKQGKPFVGRAGQLLTAILNKLNIDRKKVYITNVVKCRPPMNRTPQSKEIKACKRILELE 167

Query: 182 IELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP 241
           +E I+PK+++ +G+   N+F         Q+ G+W            + T HP  +++  
Sbjct: 168 LEFIAPKVIITLGSVPLNYF--KPNSSIMQSRGQW----IYKRGFWIMPTFHPAYILRQG 221

Query: 242 LI-----KKNTWHALITLKKALKNL 261
                  K   W       + ++ L
Sbjct: 222 GETLKRVKWQVWGDFNKAIEKVREL 246


>gi|163739158|ref|ZP_02146570.1| uracil-DNA glycosylase, putative [Phaeobacter gallaeciensis BS107]
 gi|161387558|gb|EDQ11915.1| uracil-DNA glycosylase, putative [Phaeobacter gallaeciensis BS107]
          Length = 481

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 41/235 (17%), Positives = 78/235 (33%), Gaps = 16/235 (6%)

Query: 31  PNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKA---CSLHELKSLLRSF 87
           P   A  E      +   A+               QA              EL + + S 
Sbjct: 233 PEAAAIPELIATAPARARAMAEAAPTLPPLRAARVQARLPEANPHWQGPAAELPAAINSC 292

Query: 88  HDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR 147
             C L   +   +        DLMI+G  P D +++ G+PF G  G + D++     + R
Sbjct: 293 TRCPLHGPATQAVPGEGPTDADLMIVGEQPGDQEDLVGRPFVGPAGQLFDQLATEAGLPR 352

Query: 148 TQIHISMISPW-------HPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNF 200
              +++                ++  +  E+  C+  +  +++ + PK +L +G      
Sbjct: 353 EAAYVTNAVKHFKFLPRGRKRLHQQPNGSEIRHCQVWLRAELDQVRPKRILALGATAAEA 412

Query: 201 FFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPL--IKKNTWHALIT 253
                 +   Q  G            P L T+HP  L++ P   +++     L  
Sbjct: 413 LLG-SGKDILQRRGTI---ERRVDGTPVLITLHPSYLLRVPDRYLRERATEDLRA 463


>gi|108762098|ref|YP_630262.1| uracil-DNA glycosylase [Myxococcus xanthus DK 1622]
 gi|108465978|gb|ABF91163.1| uracil-DNA glycosylase, family 4 [Myxococcus xanthus DK 1622]
          Length = 231

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 43/223 (19%), Positives = 86/223 (38%), Gaps = 21/223 (9%)

Query: 56  IRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQT----EGQDLM 111
                  +   A  +  ++ +  +L+        C L  T   T+          G  +M
Sbjct: 3   AMPKRPSVQTTAAPLIPESPTYDKLRKAAAGCQACPLWRTGTQTVFGEPEGQPRPGPRVM 62

Query: 112 IIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMIS---PWHPPGNRNLSN 168
           ++G  P D ++ +G+PF G +G +LD+ L++  I R Q++++       W   G R +  
Sbjct: 63  LVGEQPGDQEDRAGRPFVGPSGRLLDEALEAAGIDRAQVYVTNTVKHFKWTGQGPRRIHA 122

Query: 169 I----EMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHS 224
                E+  C P +  +I +  P +L+ +G           A +  Q+ G+         
Sbjct: 123 KPTTTEIRACLPWLEAEIRVFRPDVLVCLGATAAQALLG-KAFRVTQSRGQPMASEWARV 181

Query: 225 IIPTLATVHPQELIQYPLIKKN------TWHALITLKKALKNL 261
               +ATVHP  +++ P  +            L  + + +  L
Sbjct: 182 ---VVATVHPSSILRAPDPRAKEAALEAFVDDLRQVARIIHGL 221


>gi|209546253|ref|YP_002278143.1| phage SPO1 DNA polymerase-related protein [Rhizobium leguminosarum
           bv. trifolii WSM2304]
 gi|209539110|gb|ACI59043.1| phage SPO1 DNA polymerase-related protein [Rhizobium leguminosarum
           bv. trifolii WSM2304]
          Length = 213

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 36/212 (16%), Positives = 82/212 (38%), Gaps = 18/212 (8%)

Query: 59  IHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPS 118
           + S     A  +A+ A S+ EL+        C L   +   +        +++++G  P 
Sbjct: 4   VASAGPALALDVAE-AESIAELRHQAEGCTRCDLYRNATQIVFGEGPGKAEIVLVGEQPG 62

Query: 119 DSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPG-------NRNLSNIEM 171
           D ++++G+PF G  G +LD+ L+   + R + +++                +   +  E+
Sbjct: 63  DQEDLAGRPFVGPAGRLLDRCLEEAGLDRRRCYVTNAVKHFKFTQRGKRRLHAKPNAGEI 122

Query: 172 EICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLAT 231
           + C   +  +I ++ PK+++ +G            +      G       P +  P L T
Sbjct: 123 KRCAWWLGAEINILKPKLVVTLGASALYALLGPKVKL-TPERGHILQ---PANHPPVLVT 178

Query: 232 VHPQELIQ------YPLIKKNTWHALITLKKA 257
           +HP  L++         ++++    L      
Sbjct: 179 IHPSYLLRIRDEAEQQRLRQDFVSDLHKAAAF 210


>gi|57234761|ref|YP_181181.1| uracil-DNA glycosylase, putative [Dehalococcoides ethenogenes 195]
 gi|57225209|gb|AAW40266.1| uracil-DNA glycosylase, putative [Dehalococcoides ethenogenes 195]
          Length = 189

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 39/171 (22%), Positives = 73/171 (42%), Gaps = 6/171 (3%)

Query: 91  HLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQI 150
           +L +T    +         +M IG  P  +++  G+PF G  G  L +++ SI + R  +
Sbjct: 5   NLHTTRTHAVPGEGNADAKIMFIGEAPGFNEDQQGRPFVGAAGKFLTELIHSIGLRREDV 64

Query: 151 HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTY 210
           +I+ +    PPGNR+    E+  CR  + RQIE+I PKI++ +G  +   +F        
Sbjct: 65  YITNVVKDRPPGNRDPLPDEISACRNFLDRQIEIIKPKIIVTLGRYSMARYFTGSTIS-- 122

Query: 211 QNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
               +          +      HP   +    ++K     ++ +   L+ L
Sbjct: 123 ----RIHGKPMRRDGVIYYPMYHPAAALHQGGLRKEIEQDMLRIPGLLEEL 169


>gi|33863050|ref|NP_894610.1| Uracil-DNA glycosylase [Prochlorococcus marinus str. MIT 9313]
 gi|33634967|emb|CAE20953.1| Uracil-DNA glycosylase [Prochlorococcus marinus str. MIT 9313]
          Length = 207

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 39/180 (21%), Positives = 76/180 (42%), Gaps = 11/180 (6%)

Query: 85  RSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIE 144
                C L       + +       LM+IG  P   ++  GKPF G++G ++D++++S+ 
Sbjct: 13  NGCGSCDLPVNQPQVVVSRGNPHASLMLIGEAPGAREDELGKPFVGRSGQLIDRLMESVG 72

Query: 145 IMRTQI-HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFN 203
           +      +I  +    PP NR  + +E+  CRP + +QIEL+ P ++   G+        
Sbjct: 73  LDPQTDAYICNVVKCRPPKNRRPTLVEIASCRPWLQQQIELVDPCVIALAGSTAVEAILG 132

Query: 204 NDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPL-----IKKNTWHALITLKKAL 258
                  +  G+W +          +  +HP  L++ P          T   L+ +++ L
Sbjct: 133 IKG-GITRLRGQWQHWQ----GRLLMPLLHPAYLLRNPSPVDGAPVALTRGDLLEVRQRL 187


>gi|254776520|ref|ZP_05218036.1| hypothetical protein MaviaA2_17874 [Mycobacterium avium subsp.
           avium ATCC 25291]
          Length = 221

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 43/220 (19%), Positives = 83/220 (37%), Gaps = 21/220 (9%)

Query: 59  IHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPS 118
             +     AD    +   +  LK    +   C L + +  T+      G  +M++G  P 
Sbjct: 2   TATSKAPGADRYLPEQRDIEALKHAAETCRGCSLFADATQTVFGNGHPGAPIMLVGEQPG 61

Query: 119 DSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPG--------NRNLSNIE 170
           D ++ +G PF G  G +L + LQ   I     + +                 ++     E
Sbjct: 62  DQEDRAGAPFVGPAGRLLARALQDAGIDPGLTYQTNAVKHFKFTRKDGKRRIHQKPGRTE 121

Query: 171 MEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIP--- 227
           +  CRP ++ +IE + P+I++ +G            + + Q  G+   L     +IP   
Sbjct: 122 IVACRPWLITEIEAVHPRIIVCLGATAAQSLLGTSFRVSTQ-RGQPLKLPASPEVIPDVS 180

Query: 228 ----TLATVHPQELIQYPLIK-----KNTWHALITLKKAL 258
                +ATVHP  +++    +     +     L + + AL
Sbjct: 181 PEPVLVATVHPSSVLRDRSERHDEVYRLFVDDLRSARSAL 220


>gi|21233304|ref|NP_639221.1| DNA polymerase-related protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66770264|ref|YP_245026.1| DNA polymerase-related protein [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|188993464|ref|YP_001905474.1| putative phage-related protein [Xanthomonas campestris pv.
           campestris str. B100]
 gi|21115573|gb|AAM43495.1| DNA polymerase-related protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66575596|gb|AAY51006.1| DNA polymerase-related protein [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|167735224|emb|CAP53436.1| putative phage-related protein [Xanthomonas campestris pv.
           campestris]
          Length = 219

 Score =  136 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 42/218 (19%), Positives = 82/218 (37%), Gaps = 18/218 (8%)

Query: 56  IRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGY 115
                +PL +  D++   + +L  L++  +    C L   +   +         LMIIG 
Sbjct: 7   PSAPTTPLAKPVDTV--PSGTLTALRAQAQDCRRCDLWKPATQVVFGAGPARAPLMIIGE 64

Query: 116 TPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPG-------NRNLSN 168
            P D ++  G+PF G  G +L  ++    +     +++                ++  + 
Sbjct: 65  QPGDQEDQQGRPFVGPAGQLLGTLMADAGLDPAMAYVTNTVKHFKFVPRGKRRLHQRATA 124

Query: 169 IEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPT 228
            E   CRP +  ++  + P+I+L +G       F  +A +     G+W  L         
Sbjct: 125 GEQAACRPWLAAELLRVRPRIVLALGAMAAQTLFG-NAFRLTTERGQWRALDGR---TTA 180

Query: 229 LATVHPQELIQ-----YPLIKKNTWHALITLKKALKNL 261
           LA+ HP  +++         +      L  +  AL NL
Sbjct: 181 LASWHPSAILRMREPDRTATRALLREDLAQVAAALDNL 218


>gi|41409354|ref|NP_962190.1| hypothetical protein MAP3256c [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|41398174|gb|AAS05804.1| hypothetical protein MAP_3256c [Mycobacterium avium subsp.
           paratuberculosis K-10]
          Length = 221

 Score =  136 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 41/220 (18%), Positives = 82/220 (37%), Gaps = 21/220 (9%)

Query: 59  IHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPS 118
             +     AD    +   +  LK    +   C L + +  T+      G  +M++G  P 
Sbjct: 2   TATSKAPGADRYLPEQRDIEALKHAAETCRGCSLFADATQTVFGNGHPGAPIMLVGEQPG 61

Query: 119 DSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPG--------NRNLSNIE 170
           D ++ +G PF G  G +L + L    I     + +                 ++     E
Sbjct: 62  DQEDRAGAPFVGPAGRLLARALHDAGIDPGLTYQTNAVKHFKFTRKDGKRRIHQKPGRTE 121

Query: 171 MEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIP--- 227
           +  CRP ++ +IE + P++++ +G            + + Q  G+   L     +IP   
Sbjct: 122 IVACRPWLIAEIEAVHPRVIVCLGATAAQSLLGTSFRVSTQ-RGQPLKLPASPEVIPDVA 180

Query: 228 ----TLATVHPQELIQYPLIK-----KNTWHALITLKKAL 258
                +ATVHP  +++    +     +     L + + AL
Sbjct: 181 PEPVLVATVHPSSVLRDRSERHDEVYRLFVDDLRSARSAL 220


>gi|218679206|ref|ZP_03527103.1| phage SPO1 DNA polymerase-related protein [Rhizobium etli CIAT 894]
          Length = 209

 Score =  136 bits (341), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 34/198 (17%), Positives = 75/198 (37%), Gaps = 17/198 (8%)

Query: 72  QKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGK 131
             A S+  L+        C L   +   +        +++++G  P D +++SGKPF G 
Sbjct: 16  ADATSIAGLRHQAEGCTRCDLYRNATQIVFGEGAGQAEIVLVGEQPGDREDLSGKPFVGP 75

Query: 132 TGNMLDKMLQSIEIMRTQIHISMISPWHPPG-------NRNLSNIEMEICRPIIMRQIEL 184
            G +LD+ L+   + R + +++                +   +  E+  C   +  ++ +
Sbjct: 76  AGRLLDQCLEEAGLDRERCYVTNAVKHFKFTSRGKRRLHAKPNAGEIRRCAWWLGAELNI 135

Query: 185 ISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ----- 239
           I PK+++ +G            + T +          P    P L T+HP  L++     
Sbjct: 136 IKPKLVVTLGASALYALLGPKVKLTPERGHILHPANRP----PVLVTIHPSYLLRIRDEA 191

Query: 240 -YPLIKKNTWHALITLKK 256
               ++++    L    +
Sbjct: 192 EQRRLRRDFVSDLHMAAE 209


>gi|329115091|ref|ZP_08243846.1| Phage SPO1 DNA Polymerase-Related Protein [Acetobacter pomorum
           DM001]
 gi|326695534|gb|EGE47220.1| Phage SPO1 DNA Polymerase-Related Protein [Acetobacter pomorum
           DM001]
          Length = 284

 Score =  136 bits (341), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 61/281 (21%), Positives = 102/281 (36%), Gaps = 32/281 (11%)

Query: 9   QEQILTIALFYADSGVYWVFDE---------------PNNEATYESQRKEKSIDSAIQPI 53
            E  L++   Y + GV     +               P    T +               
Sbjct: 2   MEAALSLLRLYTEWGVDVAVTDAAVDHRHAGAGLVLPPLRGKTPQQAPPYTPPQLGTGRT 61

Query: 54  TNIRHIH-------------SPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTI 100
                               +  V+QA  +A  A +  EL   + SF  C L   ++ T+
Sbjct: 62  PAPATTAQRPPQQQPGPTSFADTVEQAQRLAAAATTPEELFQAMDSFMACPLRGAAMHTL 121

Query: 101 CATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHP 160
                    LM+IG  P + ++ SG+ F+G  G +LD ML  + + R+Q+ ++   PW P
Sbjct: 122 MPAGPHHAPLMLIGEAPDEDEDRSGQVFAGLCGTLLDTMLAPLPLERSQLALATALPWRP 181

Query: 161 PGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLC 220
            G    + ++  ICRP + R I L +P+ LL  G                     W  + 
Sbjct: 182 AGGTAPTEMDQRICRPFLERAITLFAPQRLLLCGRLPARMLLGKTTDL---PRRNWQEIT 238

Query: 221 TPHSI-IPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
            P    +P +   HP +L   P  ++  W  L+T+   L+ 
Sbjct: 239 LPGLPALPVMVMRHPLQLRASPAARREIWATLMTVMDTLRQ 279


>gi|323135754|ref|ZP_08070837.1| Uracil-DNA glycosylase superfamily [Methylocystis sp. ATCC 49242]
 gi|322398845|gb|EFY01364.1| Uracil-DNA glycosylase superfamily [Methylocystis sp. ATCC 49242]
          Length = 281

 Score =  135 bits (340), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 52/274 (18%), Positives = 96/274 (35%), Gaps = 22/274 (8%)

Query: 8   SQEQILTIALFYADSGVYWVFD-EPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQ 66
           ++E +L +  +Y +SG  +  D  P++     ++      +         R      +  
Sbjct: 9   TREALLALLDWYVESGADFALDDSPHDRYADSARAPTAVSEPPPPSRAVERGEPRAPLTP 68

Query: 67  ADSIAQK--------------------ACSLHELKSLLRSFHDCHLCSTSLSTICATQTE 106
           A   A+                     A  L +L + L  F        +   +      
Sbjct: 69  APRRARPETLIAPPDEAARAAEATAAAARDLDDLAARLADFPHAPFRDMARHFLFGAGAP 128

Query: 107 GQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNL 166
           G  LM     P  ++   G  FSG+   +LD ML +I + R    ++ +SPW PPG++ L
Sbjct: 129 GARLMAFDAAPGATEESGGAAFSGERAKLLDNMLAAIGLDRGSARLAYVSPWRPPGDKAL 188

Query: 167 SNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSII 226
           +  EM +  P   R +EL  P++LL  G            +   +  GK  ++       
Sbjct: 189 TPQEMAVFAPFARRHVELARPEVLLLFGEAPARIML-ETGEPLAKLRGKCFDVRCGDHAA 247

Query: 227 PTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260
                     +++   +K   W  L      L++
Sbjct: 248 RAFVFSSLDAMLKSAGLKPAAWRDLRAAAALLRS 281


>gi|209967194|ref|YP_002300109.1| Uracil DNA glycosylase superfamily [Rhodospirillum centenum SW]
 gi|209960660|gb|ACJ01297.1| Uracil DNA glycosylase superfamily [Rhodospirillum centenum SW]
          Length = 230

 Score =  135 bits (340), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 44/214 (20%), Positives = 79/214 (36%), Gaps = 17/214 (7%)

Query: 59  IHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPS 118
                   A      A ++  L+        C L  T   T+     E   L+++G  P 
Sbjct: 2   PPRAPPDTAARFLPPARTIPALREAAAGCTACPLHETGTRTVFGEGPERARLVLVGEQPG 61

Query: 119 DSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMIS---PWHPPGNRNLSNI----EM 171
           D ++  G+PF G  G ++D  L +  I RT I+++       W   G+R L       E+
Sbjct: 62  DREDAQGRPFVGPAGQLMDLALNAAGIDRTGIYVTNAVKHFKWVQRGHRRLHEKPGRLEI 121

Query: 172 EICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLAT 231
             C P +  +I  I+P+ ++ +G            +   +  G++        I    AT
Sbjct: 122 LACLPWLENEIAAIAPEGIVCLGATAAQALIGRTFKV-TEERGQFLRTPLAGWIT---AT 177

Query: 232 VHPQELIQ--YPLIKKNTWH----ALITLKKALK 259
           VHP  L++      ++  +      L  +   L 
Sbjct: 178 VHPSSLLRIEDRETQRAAYERFVDDLARIADRLA 211


>gi|332557671|ref|ZP_08411993.1| phage SPO1 DNA polymerase-related protein [Rhodobacter sphaeroides
           WS8N]
 gi|332275383|gb|EGJ20698.1| phage SPO1 DNA polymerase-related protein [Rhodobacter sphaeroides
           WS8N]
          Length = 485

 Score =  135 bits (340), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 41/241 (17%), Positives = 84/241 (34%), Gaps = 17/241 (7%)

Query: 34  EATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLC 93
           E   E Q    +   A       +   +     A S      SL E K+       C L 
Sbjct: 248 ERAAEMQAAAPTEPPARTAAVARQRAAAAGGPPAASDGSAPGSLAEAKTAAEGCRRCGLW 307

Query: 94  STSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHIS 153
           + +   +         +MI+G  P D ++++G+PF G  G + D+   +  + R  ++++
Sbjct: 308 ANATQVVFGEGPATARMMIVGEQPGDREDLAGRPFVGPAGQLFDEEAAAAGLDRGSVYVT 367

Query: 154 MISPWHPPG-------NRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDA 206
                           ++     E+  CR  +  + +L+ P++++ +G            
Sbjct: 368 NAVKHFKFTPRGKRRIHQKPDAGEVTACRWWLDLERDLVRPRLIVAMGATALASLTG-SG 426

Query: 207 QKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPL------IKKNTWHALITLKKALKN 260
               +  G    L       P   TVHP  +++ P        ++     L   ++ L+ 
Sbjct: 427 AGILKRRGSVERL---DDGTPLFVTVHPSYILRLPDEAARAEERRRFRADLEEARQLLER 483

Query: 261 L 261
           L
Sbjct: 484 L 484


>gi|118575792|ref|YP_875535.1| uracil-DNA glycosylase [Cenarchaeum symbiosum A]
 gi|118194313|gb|ABK77231.1| uracil-DNA glycosylase [Cenarchaeum symbiosum A]
          Length = 216

 Score =  135 bits (340), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 38/182 (20%), Positives = 71/182 (39%), Gaps = 6/182 (3%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L  + + +     C LC    + +  T       +++G  P   +++ GKPF G  G +L
Sbjct: 38  LGGIAARVSVCTRCGLCEGRTNAVPGTGPASARAILVGEAPGREEDLQGKPFVGGAGRVL 97

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
           DK L+   I R+ ++I+ +    PP NR  S+ E + C   +  +I +I+P+I+  +G  
Sbjct: 98  DKELERAGIPRSTVYITNVVKCRPPKNRVPSDEERDACIEYLKEEISVINPRIVCILGAT 157

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKK 256
                            G   N          L ++HP   +    +       +  L  
Sbjct: 158 ALRSLLGLGG--ITGIRGTIINQDNTDY----LVSLHPAATMYRRDLLPAFRRDMKKLAG 211

Query: 257 AL 258
            +
Sbjct: 212 MI 213


>gi|171913025|ref|ZP_02928495.1| phage SPO1 DNA polymerase-related protein [Verrucomicrobium
           spinosum DSM 4136]
          Length = 315

 Score =  135 bits (340), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 45/233 (19%), Positives = 91/233 (39%), Gaps = 37/233 (15%)

Query: 40  QRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLST 99
           +R   S  S + P    R      +        KA SL  L+ ++               
Sbjct: 85  ERISLSAPSPLTPQAQTRDEMLAHLALEAENNDKARSLGTLRDIM--------------- 129

Query: 100 ICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWH 159
           + AT T   +++ +G  P   +    +PF G  G +L K++Q++ + R  ++I+ I  + 
Sbjct: 130 VFATGTPDAEIVFVGEAPGAEEEKMREPFVGPAGQLLTKIIQAMGLRRNDVYITNICKFR 189

Query: 160 PP---------GNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTY 210
           P           NR  S  EM  C+  ++ ++E+I PK+++ +G+               
Sbjct: 190 PKIDDGRFQGAKNRAPSVGEMLSCQQFVLAELEIIKPKVIVALGSTAATGL--GIEGTVG 247

Query: 211 QNLGKWSNLCTPHSIIPTLATVHPQELIQYP-------LIKKNTWHALITLKK 256
           +  G++ +        P + T HP  L++           K+  W  ++ + +
Sbjct: 248 RLRGQFHDF----RGTPIMVTYHPSYLLRREQEDGGGIAEKRLVWEDMMKVMQ 296


>gi|116255511|ref|YP_771344.1| putative uracil-DNA glycosylase [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115260159|emb|CAK03262.1| putative uracil-DNA glycosylase [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 213

 Score =  135 bits (340), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 33/199 (16%), Positives = 75/199 (37%), Gaps = 17/199 (8%)

Query: 72  QKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGK 131
             A S+ EL+        C L   +   +        +++++G  P D ++++G+PF G 
Sbjct: 16  ADADSIAELRHQAEGCTRCDLFRNATQVVFGEGLVKSEIVLVGEQPGDQEDLTGRPFVGP 75

Query: 132 TGNMLDKMLQSIEIMRTQIHISMISPWHPPG-------NRNLSNIEMEICRPIIMRQIEL 184
            G +LD+ L+   + R + +++                +   +  E+  C   +  ++ +
Sbjct: 76  AGRLLDRCLEEAGLDRQRCYVTNAVKHFKFTPRGKRRLHAKPNAGEIRRCAWWLGAELNI 135

Query: 185 ISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ----- 239
           + PK+++ +G          +A+ T +          P    P L T+HP  L++     
Sbjct: 136 LQPKLVVALGASALYALLGPNAKLTPERGHILHPTNRP----PVLVTIHPSYLLRIRDEQ 191

Query: 240 -YPLIKKNTWHALITLKKA 257
                ++     L      
Sbjct: 192 EQHRQRREFVSDLHKAAAF 210


>gi|163846564|ref|YP_001634608.1| phage SPO1 DNA polymerase-like protein [Chloroflexus aurantiacus
           J-10-fl]
 gi|222524355|ref|YP_002568826.1| phage SPO1 DNA polymerase-related protein [Chloroflexus sp.
           Y-400-fl]
 gi|163667853|gb|ABY34219.1| phage SPO1 DNA polymerase-related protein [Chloroflexus aurantiacus
           J-10-fl]
 gi|222448234|gb|ACM52500.1| phage SPO1 DNA polymerase-related protein [Chloroflexus sp.
           Y-400-fl]
          Length = 210

 Score =  135 bits (339), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 36/186 (19%), Positives = 72/186 (38%), Gaps = 7/186 (3%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L  +   ++    C+L       +         +M+IG  P   ++  G+PF G +G  
Sbjct: 6   TLFAIAQEVQHCTACNLHKGRTRAVPGEGPANARIMLIGEGPGYHEDRQGRPFVGPSGQF 65

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRP-IIMRQIELISPKILLFIG 194
           L  +L    + R +++I+ +    PP NR+    E+  C    +MRQI  I P +++ +G
Sbjct: 66  LTDLLALAGLRRDEVYIANVVKCRPPQNRDPEPEEIATCTKLFLMRQIAAIDPAVIVTLG 125

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITL 254
             +   F     ++  +  G+   +         +  +HP   +  P  +         L
Sbjct: 126 RFSMGLFL--PGERISRIHGQPRYVQ----GRLIVPMIHPAAALHQPQNRPLLEADFRRL 179

Query: 255 KKALKN 260
              L  
Sbjct: 180 PDILAE 185


>gi|315636217|ref|ZP_07891471.1| uracil-DNA glycosylase [Arcobacter butzleri JV22]
 gi|315479578|gb|EFU70257.1| uracil-DNA glycosylase [Arcobacter butzleri JV22]
          Length = 222

 Score =  135 bits (339), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 43/189 (22%), Positives = 89/189 (47%), Gaps = 8/189 (4%)

Query: 74  ACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTG 133
              + ELK+ +   + C LC    + +         +M I   P+ S++  G  + G +G
Sbjct: 40  PNDIKELKNSVEHCYLCELCKVRKNVLFGYGNINSKIMFICDEPTKSEDELGSFYVGNSG 99

Query: 134 NMLDKMLQSI-EIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLF 192
            +L KM++++  I +  ++I+ +           S+   + C   +++QIELI PK+++ 
Sbjct: 100 ELLSKMIENVLNIKKEDVYITTLVKCKSLNGATNSS--FDTCNDYLLKQIELIKPKLIVS 157

Query: 193 IGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALI 252
           +G KT   +   +    +Q  GK  N       I  +A   P  L++ P +KK+ ++ ++
Sbjct: 158 LGEKT-YSYLMKNGDNFFQIRGKMLNFN----SIALMAVYSPTFLLRNPSLKKDAYYDML 212

Query: 253 TLKKALKNL 261
            +K  ++ L
Sbjct: 213 KIKSFMEEL 221


>gi|241666692|ref|YP_002984776.1| phage SPO1 DNA polymerase-related protein [Rhizobium leguminosarum
           bv. trifolii WSM1325]
 gi|240862149|gb|ACS59814.1| phage SPO1 DNA polymerase-related protein [Rhizobium leguminosarum
           bv. trifolii WSM1325]
          Length = 213

 Score =  135 bits (339), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 34/199 (17%), Positives = 76/199 (38%), Gaps = 17/199 (8%)

Query: 72  QKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGK 131
             A S+ EL         C L   +   +    +   ++++IG  P D ++++G+PF G 
Sbjct: 16  ANADSIAELWHQAEDCTRCDLYRNATQIVFGEGSGKAEIVLIGEQPGDQEDLTGRPFVGP 75

Query: 132 TGNMLDKMLQSIEIMRTQIHISMISPWHPPG-------NRNLSNIEMEICRPIIMRQIEL 184
            G +LD+ L+   + R + +++                +   +  E+  C   +  ++ +
Sbjct: 76  AGRLLDRCLEEAGLDRQRCYVTNAVKHFKFTPRGKRRLHAKPNAGEIRRCAWWLGAELNI 135

Query: 185 ISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ----- 239
           + PK+++ +G           A+ T +          P    P L T+HP  L++     
Sbjct: 136 LQPKLVVTLGASALYALLGPKAKLTPERGHILHPTNHP----PVLVTIHPSYLLRIRNEA 191

Query: 240 -YPLIKKNTWHALITLKKA 257
                +++    L    + 
Sbjct: 192 DRDQQRRDFVSDLHKAAEF 210


>gi|163742352|ref|ZP_02149739.1| Uracil-DNA glycosylase superfamily protein [Phaeobacter
           gallaeciensis 2.10]
 gi|161384302|gb|EDQ08684.1| Uracil-DNA glycosylase superfamily protein [Phaeobacter
           gallaeciensis 2.10]
          Length = 481

 Score =  135 bits (339), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 41/235 (17%), Positives = 79/235 (33%), Gaps = 16/235 (6%)

Query: 31  PNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKA---CSLHELKSLLRSF 87
           P   A  E      +   A+               QA              EL + + S 
Sbjct: 233 PEAAAIPELIATAPARARAMAEAAPTLPPLRAARVQARLPEANPHWQGPAAELPAAINSC 292

Query: 88  HDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR 147
             C L   +   +        DLMI+G  P D +++ G+PF G  G + D++     + R
Sbjct: 293 TLCPLYGPATQAVPGEGPTDADLMIVGEQPGDQEDLVGRPFVGPAGQLFDQLATEAGLPR 352

Query: 148 TQIHISMISPW-------HPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNF 200
              +++                ++  +  E+  C+  +  +++ + PK++L +G      
Sbjct: 353 EAAYVTNAVKHFKFLPRGRKRLHQQPNGSEIRHCQVWLRAELDQVRPKLILALGATAAEA 412

Query: 201 FFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPL--IKKNTWHALIT 253
                 +   Q  G            P L T+HP  L++ P   +++     L  
Sbjct: 413 LLG-SGKHILQRRGTI---ERRVDGTPVLITLHPSYLLRVPDRYLRERATEDLRA 463


>gi|161528564|ref|YP_001582390.1| phage SPO1 DNA polymerase-related protein [Nitrosopumilus maritimus
           SCM1]
 gi|160339865|gb|ABX12952.1| phage SPO1 DNA polymerase-related protein [Nitrosopumilus maritimus
           SCM1]
          Length = 196

 Score =  135 bits (339), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 39/187 (20%), Positives = 72/187 (38%), Gaps = 6/187 (3%)

Query: 75  CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGN 134
             L  +K  +     C L  T  +++        D++ +G  P  +++ +G+PF G  G 
Sbjct: 2   NQLETIKQNVIKCTKCDLYKTRTNSVPGKGNFQSDVIFVGEAPGRNEDKNGEPFVGAAGK 61

Query: 135 MLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194
            L   L+   + R  ++I+ +    PP NR  +  E + C+  +  +I +I PKI+  +G
Sbjct: 62  KLSAALEGAGVSREDVYITNVVKCRPPNNRVPNTNERDTCKEYLKNEILIIKPKIICVLG 121

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITL 254
           N   N        +  +  GK               T+HP   I    +       +  L
Sbjct: 122 NTAFNSVLG--GSEITKFRGKL----VRKDNQLYFLTIHPAATIYNQELISTLNEDIKKL 175

Query: 255 KKALKNL 261
              +  L
Sbjct: 176 FNLITEL 182


>gi|118463844|ref|YP_883243.1| uracil DNA glycosylase superfamily protein [Mycobacterium avium
           104]
 gi|118165131|gb|ABK66028.1| uracil DNA glycosylase superfamily protein [Mycobacterium avium
           104]
          Length = 221

 Score =  135 bits (339), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 41/220 (18%), Positives = 82/220 (37%), Gaps = 21/220 (9%)

Query: 59  IHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPS 118
             +     AD    +   +  LK    +   C L + +  T+      G  +M++G  P 
Sbjct: 2   TATSKAPGADRYLPEQRDIEALKHAAETCRGCSLFADATQTVFGNGHPGAPIMLVGEQPG 61

Query: 119 DSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPG--------NRNLSNIE 170
           D ++ +G PF G  G +L + L    I     + +                 ++     E
Sbjct: 62  DQEDRAGAPFVGPAGRLLARALHDAGIDPGLTYQTNAVKHFKFTRKDGKRRIHQKPGRTE 121

Query: 171 MEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIP--- 227
           +  CRP ++ +IE + P++++ +G            + + Q  G+   L     +IP   
Sbjct: 122 IVACRPWLIAEIEAVHPRVIVCLGATAAQSLLGTSFRVSAQ-RGQPLKLPASPEVIPDVA 180

Query: 228 ----TLATVHPQELIQYPLIK-----KNTWHALITLKKAL 258
                +ATVHP  +++    +     +     L + + AL
Sbjct: 181 PEPVLVATVHPSSVLRDRSERHDEVYRLFVDDLRSARSAL 220


>gi|241518598|ref|YP_002979226.1| phage SPO1 DNA polymerase-related protein [Rhizobium leguminosarum
           bv. trifolii WSM1325]
 gi|240863011|gb|ACS60675.1| phage SPO1 DNA polymerase-related protein [Rhizobium leguminosarum
           bv. trifolii WSM1325]
          Length = 220

 Score =  135 bits (339), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 37/219 (16%), Positives = 78/219 (35%), Gaps = 19/219 (8%)

Query: 57  RHIHSPLVQQADSIAQKA--CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIG 114
                P       I   A    L  L     +   C L   +  T+    +    ++++G
Sbjct: 4   ASATRPTRLPPAFIEPHAEGKDLSALHGQAETCERCDLFKNATQTVFGEGSTDARVILVG 63

Query: 115 YTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPG-------NRNLS 167
             P D ++I+G+PF G  G +LD+ L    I R+  +++                +   +
Sbjct: 64  EQPGDKEDIAGRPFVGPAGRLLDECLHEAGIDRSLCYVTNAVKHFKFEQRGKRRIHSKPN 123

Query: 168 NIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIP 227
             E++ C   +  +++ + P +++ +G              T +     SN+    +  P
Sbjct: 124 AGEIQRCAWWLGGELDFLRPSLVVALGATALYTLMGRSVGLTKER----SNILQAANATP 179

Query: 228 TLATVHPQELIQ------YPLIKKNTWHALITLKKALKN 260
            L T+HP  L++          ++     L  +   L +
Sbjct: 180 LLVTIHPSYLLRIRDHDDRANEQRRFVDDLRLIHDYLSD 218


>gi|197123093|ref|YP_002135044.1| phage SPO1 DNA polymerase-related protein [Anaeromyxobacter sp. K]
 gi|196172942|gb|ACG73915.1| phage SPO1 DNA polymerase-related protein [Anaeromyxobacter sp. K]
          Length = 224

 Score =  134 bits (338), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 34/215 (15%), Positives = 76/215 (35%), Gaps = 17/215 (7%)

Query: 58  HIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTP 117
               P    A  +     +L  L+        C L      T+      G  +M++G  P
Sbjct: 2   PRRPPPGGTAAPLVPARATLPALRRAAAGCTACPLWERGTQTVFGAGPPGATVMLVGEQP 61

Query: 118 SDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWH-------PPGNRNLSNIE 170
            + ++ +G+PF G  G +LD+ L +  + R   +++                ++  +  E
Sbjct: 62  GNDEDRAGEPFVGPAGRLLDRALAAAGLDRRDAYVTNAVKHFKWEPRGKRRIHQKPNAGE 121

Query: 171 MEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLA 230
           +  C P +  +I  + P+ ++ +G             +  +  G+             +A
Sbjct: 122 VRACLPWLEAEIAAVRPRAVVCLGATAAQALLG-RGFRLTERRGQPVPSPLAEV---VIA 177

Query: 231 TVHPQELIQYP--LIKKNTW----HALITLKKALK 259
           T+HP  +++ P    ++         L  +   L+
Sbjct: 178 TLHPSAVLRAPDDAARREALAGLVADLARVAALLR 212


>gi|126461677|ref|YP_001042791.1| phage SPO1 DNA polymerase-related protein [Rhodobacter sphaeroides
           ATCC 17029]
 gi|126103341|gb|ABN76019.1| phage SPO1 DNA polymerase-related protein [Rhodobacter sphaeroides
           ATCC 17029]
          Length = 485

 Score =  134 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 40/241 (16%), Positives = 84/241 (34%), Gaps = 17/241 (7%)

Query: 34  EATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLC 93
           E   E Q    +   A       +   +     A S      SL E K+       C L 
Sbjct: 248 ERAAEMQAAAPTEPPARTAAVARQRAAAAGGPPAASDGSAPGSLAEAKTAAEGCRRCGLW 307

Query: 94  STSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHIS 153
           + +   +         +M++G  P D ++++G+PF G  G + D+   +  + R  ++++
Sbjct: 308 ANATQVVFGEGPATARMMVVGEQPGDREDLAGRPFVGPAGQLFDEEAAAAGLDRGSVYVT 367

Query: 154 MISPWHPPG-------NRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDA 206
                           ++     E+  CR  +  + +L+ P++++ +G            
Sbjct: 368 NAVKHFKFTPRGKRRIHQKPDAGEVTACRWWLDLERDLVRPRLIVAMGATALASLTG-SG 426

Query: 207 QKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPL------IKKNTWHALITLKKALKN 260
               +  G    L       P   TVHP  +++ P        ++     L   ++ L+ 
Sbjct: 427 AGILKRRGSLERL---DDGTPLFVTVHPSYILRLPDEAARAEERRRFRADLEEARQLLER 483

Query: 261 L 261
           L
Sbjct: 484 L 484


>gi|332701477|ref|ZP_08421565.1| phage SPO1 DNA polymerase-related protein [Desulfovibrio africanus
           str. Walvis Bay]
 gi|332551626|gb|EGJ48670.1| phage SPO1 DNA polymerase-related protein [Desulfovibrio africanus
           str. Walvis Bay]
          Length = 219

 Score =  134 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 35/171 (20%), Positives = 70/171 (40%), Gaps = 11/171 (6%)

Query: 80  LKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKM 139
           L         C L   +  T+         LM++G  P D ++  G+PF G  G +LD+ 
Sbjct: 32  LVREAAHCTRCDLYKAATRTVFGEGPVEARLMLVGEIPGDMEDRRGRPFVGPAGRLLDRA 91

Query: 140 LQSIEIMRTQIHISMISPW-------HPPGNRNLSNIEMEICRPIIMRQIELISPKILLF 192
           L+   + R+ ++++                +R  S  E+  C   + R++ L+ P+ ++ 
Sbjct: 92  LEEAGVDRSTVYLTNSVKHFKFELTGRRRQHRAPSVSEINACHYWLDRELALVKPRTVVA 151

Query: 193 IGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLI 243
           +G       F     +  Q  GK+++L         + T+HP  +++ P  
Sbjct: 152 LGGTAARAVFG-KPVRVLQVRGKFADLEP---GRQAMVTIHPSAILRMPEE 198


>gi|121533311|ref|ZP_01665139.1| phage SPO1 DNA polymerase-related protein [Thermosinus
           carboxydivorans Nor1]
 gi|121307870|gb|EAX48784.1| phage SPO1 DNA polymerase-related protein [Thermosinus
           carboxydivorans Nor1]
          Length = 231

 Score =  134 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 48/191 (25%), Positives = 88/191 (46%), Gaps = 11/191 (5%)

Query: 78  HELKSLLRSFHDCHLC-STSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
            EL++ L + + C LC   +        T    LM++G  P   ++  G P  G +G +L
Sbjct: 12  AELEAALLACNQCALCREGNRGPTSYNGTPDSPLMLVGEGPGGVEDEYGVPLVGPSGQLL 71

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEIC-RPIIMRQIELISPKILLFIGN 195
           D+ L S+ I R +I+ + +    P GNR  +  E ++C    +  +I L+ PKI++ +G+
Sbjct: 72  DRALASVGITRDRIYTTNVVKCRPRGNRTPTVEEGQVCASRWLDAEITLVKPKIIIALGS 131

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLI-----KKNTWHA 250
               + +  +A +  ++ G+W         IP +AT HP  L++         K   ++ 
Sbjct: 132 VALKYLYEPNA-RITKDRGRWFMTKY---GIPAIATYHPAYLLRLTGQDLVRAKWEVYYD 187

Query: 251 LITLKKALKNL 261
           L    + L  L
Sbjct: 188 LKAAVERLAEL 198


>gi|182680237|ref|YP_001834383.1| phage SPO1 DNA polymerase-related protein [Beijerinckia indica
           subsp. indica ATCC 9039]
 gi|182636120|gb|ACB96894.1| phage SPO1 DNA polymerase-related protein [Beijerinckia indica
           subsp. indica ATCC 9039]
          Length = 211

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 38/199 (19%), Positives = 78/199 (39%), Gaps = 16/199 (8%)

Query: 74  ACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTG 133
             SL  L+   R+   C L   +  T+     +   L+I+G  P D +++ G PF G  G
Sbjct: 17  PKSLEALREAARTCQRCPLWKHATQTVFGEGPKDARLLIVGEQPGDKEDLQGHPFVGPAG 76

Query: 134 NMLDKMLQSIEIMRTQIHISMISPWHPPG-------NRNLSNIEMEICRPIIMRQIELIS 186
            +LDK L  + I R +++++                ++  +  E++ CR  +  +  L+ 
Sbjct: 77  LLLDKALGEVGIDRRRVYVTNAVKHFKFEPRGKRRMHKTPTTTEIKACRFWLEGEFALLE 136

Query: 187 PKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ-----YP 241
           PK++L +G    +    +   +  +  G+             L T HP  +++       
Sbjct: 137 PKLVLALGATALHGLLGH-VARIGEMRGEPIPF---GDNAKLLVTTHPSAILRMKEPMRA 192

Query: 242 LIKKNTWHALITLKKALKN 260
               +  + L  +   L+ 
Sbjct: 193 QNYADFLNDLKRIPALLEE 211


>gi|254822543|ref|ZP_05227544.1| hypothetical protein MintA_21619 [Mycobacterium intracellulare ATCC
           13950]
          Length = 219

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 39/219 (17%), Positives = 81/219 (36%), Gaps = 19/219 (8%)

Query: 59  IHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPS 118
             +     AD    +   +  L+S   + H C L   +  T+      G  +M++G  P 
Sbjct: 2   TATAKAPGADRYLPEERDIDALRSAAETCHGCALFEDATQTVFGNGHPGAPIMLVGEQPG 61

Query: 119 DSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPG--------NRNLSNIE 170
           D ++ +G+PF G  G +L + L+   I     + +                 ++     E
Sbjct: 62  DQEDRAGEPFVGPAGRLLARALEDAGIDPVLTYQTNAVKHFKFTRKGGKRRIHQKPGRTE 121

Query: 171 MEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIP--- 227
           +  CRP ++ +IE + P++++ +G            +   +  G+   L     I     
Sbjct: 122 VVACRPWLIAEIEAVQPEVIVCLGATAAQSLLGTTFRV-SEQRGRELKLPESVDIARTPE 180

Query: 228 --TLATVHPQELIQYPLIKKN-----TWHALITLKKALK 259
              +ATVHP  +++    +++         L   +  L 
Sbjct: 181 PIVVATVHPSSVLRDRSDRRDEVYQSFVDDLRIARSGLA 219


>gi|193084356|gb|ACF10013.1| phage SPO1 DNA polymerase-related protein [uncultured marine
           crenarchaeote SAT1000-49-D2]
          Length = 180

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 41/178 (23%), Positives = 79/178 (44%), Gaps = 6/178 (3%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L  ++  +++   C LC T  + +     +  D++ IG  P  ++++ G+PF G  G  L
Sbjct: 7   LEIIQEKVKTCEKCDLCITRKNAVPGKGNQNADIIFIGEAPGKNEDLHGEPFIGTAGKKL 66

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNK 196
           D  L++  + R  ++I+ I    PP NR  +++E   C   +  +I +I+PKI+  +GN 
Sbjct: 67  DDALKNAGLTRNSVYITNIVKCRPPKNRIPNDVEKSTCNEYLKAEIAIINPKIICLLGNT 126

Query: 197 TKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITL 254
                     ++  +N GK+ +            T HP   I    +     + +  L
Sbjct: 127 PYYSILG--GKEISKNHGKFISKDNRMY----FVTFHPAATIYNQKLVNVFKNDISKL 178


>gi|159903330|ref|YP_001550674.1| Uracil-DNA glycosylase [Prochlorococcus marinus str. MIT 9211]
 gi|159888506|gb|ABX08720.1| Uracil-DNA glycosylase [Prochlorococcus marinus str. MIT 9211]
          Length = 191

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 41/176 (23%), Positives = 72/176 (40%), Gaps = 11/176 (6%)

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C+        +         LM++G  P   + + GKPF G++G +LD +L+ + I   +
Sbjct: 16  CNCLEPCSKVVVGRGNPSAHLMLVGEAPGAKEELLGKPFVGRSGKVLDNLLEVVGIDHQK 75

Query: 150 I-HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQK 208
             +I  +    PP NR  +  E+    P ++ QI+L+ P +++  G      F      K
Sbjct: 76  DIYICNVMKSRPPNNRRPTRAEIAKHLPWLVHQIKLVKPFVIVLAGATALETFLEIKT-K 134

Query: 209 TYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKK-----NTWHALITLKKALK 259
                G W N       I  +   HP  L++ P   K      T   L  ++K ++
Sbjct: 135 ITVLRGTWQNW----RGIAVMPIFHPSYLLRNPSNAKGSPLELTRSDLFEVRKRME 186


>gi|157737025|ref|YP_001489708.1| hypothetical protein Abu_0774 [Arcobacter butzleri RM4018]
 gi|157698879|gb|ABV67039.1| conserved hypothetical protein [Arcobacter butzleri RM4018]
          Length = 222

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 43/189 (22%), Positives = 89/189 (47%), Gaps = 8/189 (4%)

Query: 74  ACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTG 133
              + ELK+ +   + C LC    + +         +M I   P+ S++  G  + G +G
Sbjct: 40  PNDIKELKNSVEHCYLCELCKVRKNVLFGYGNINSKIMFICDEPTKSEDELGSFYVGNSG 99

Query: 134 NMLDKMLQSI-EIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLF 192
            +L KM++++  I +  ++I+ +           S+   + C   +++QIELI PK+++ 
Sbjct: 100 ELLSKMIENVLNIKKEDVYITTLVKCKSLNGATNSS--FDTCNDYLLKQIELIKPKLIVS 157

Query: 193 IGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALI 252
           +G KT   +   +    +Q  GK  N       I  +A   P  L++ P +KK+ ++ ++
Sbjct: 158 LGEKT-YSYLMKNGDNFFQIRGKMLNFN----SIALIAVYSPTFLLRNPSLKKDAYYDML 212

Query: 253 TLKKALKNL 261
            +K  ++ L
Sbjct: 213 KIKSFMEEL 221


>gi|197104365|ref|YP_002129742.1| phage SPO1 DNA polymerase-related protein [Phenylobacterium
           zucineum HLK1]
 gi|196477785|gb|ACG77313.1| phage SPO1 DNA polymerase-related protein [Phenylobacterium
           zucineum HLK1]
          Length = 477

 Score =  134 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 38/222 (17%), Positives = 78/222 (35%), Gaps = 15/222 (6%)

Query: 47  DSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTE 106
            +  +P   I    +   + A    Q   +L E+ + ++    C L   +   +      
Sbjct: 256 QAPTEPDRRIVRAAARASRDAPYDGQPPATLEEVAAGVQVCRRCDLYRDATQGVPGEGPR 315

Query: 107 GQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPG---- 162
              LM +G  P D ++++G+PF G  G +LDK L    I R +  ++             
Sbjct: 316 QARLMFVGEQPGDQEDLAGRPFVGPAGGVLDKALAEAGIPRAETFVTNAVKHFKHEPRGK 375

Query: 163 ---NRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNL 219
              ++     E+  CR  +  +  ++ P++++ +G       F        +   +   L
Sbjct: 376 RRLHKTPDAGEVSACRWWLDAERRIVQPRVVVALGATAALAVFG-KPTPIGKFRQQAIQL 434

Query: 220 CTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL 261
                    + T HP  L++ P  +             L +L
Sbjct: 435 PDQAQG---VVTYHPSYLLRVPDAEAKA----KAYAMFLDDL 469


>gi|219849325|ref|YP_002463758.1| phage SPO1 DNA polymerase-related protein [Chloroflexus aggregans
           DSM 9485]
 gi|219543584|gb|ACL25322.1| phage SPO1 DNA polymerase-related protein [Chloroflexus aggregans
           DSM 9485]
          Length = 210

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 35/185 (18%), Positives = 73/185 (39%), Gaps = 7/185 (3%)

Query: 77  LHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNML 136
           L  +   ++    C+L       +         +M IG  P   ++  G+PF G +G  L
Sbjct: 7   LFTIAEEVQRCTACNLHRGRTRAVPGEGPANARVMFIGEGPGYHEDRQGRPFVGPSGQFL 66

Query: 137 DKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRP-IIMRQIELISPKILLFIGN 195
           + +L    + R +++I+ +    PP NR+    E+  C    +MRQI  I P +++ +G 
Sbjct: 67  NDLLALAGLRRDEVYIANVVKCRPPQNRDPEPDEIATCTRLFLMRQIAAIDPIVIVTLGR 126

Query: 196 KTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLK 255
            +   F     ++  +  G+  ++         +  +HP   +  P  +         L 
Sbjct: 127 FSMGLFL--PGERISRIHGQPRSVN----GRLIVPMIHPAAALHQPQNRPLLEEDFRRLP 180

Query: 256 KALKN 260
             + +
Sbjct: 181 AIIAD 185


>gi|168700619|ref|ZP_02732896.1| DNA polymerase, bacteriophage-type [Gemmata obscuriglobus UQM 2246]
          Length = 253

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 51/262 (19%), Positives = 92/262 (35%), Gaps = 22/262 (8%)

Query: 2   TSKRILSQ-EQILTIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIH 60
            S   +   +Q+         +GV +            + R E      + P  +     
Sbjct: 1   MSDGPIDLVQQLRAHLHSLGAAGVLFAPRGEPLVIARPAPRAEVVPAEEVAPAEDPLETR 60

Query: 61  SPLVQQADSIAQKACSLHELKSLLRSFHDC-HLCSTSLSTICATQTEGQDLMIIGYTPSD 119
                           L  L + + +   C  L ST L  +  T     ++  +G  P  
Sbjct: 61  RRA-------------LATLAAEVSNCDKCSELFSTRLRAVFGTGPLDPEVAFVGEAPGY 107

Query: 120 SDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIM 179
            ++  G+PF GK G +L +++ + ++   Q ++  I    PP  R  +  E   CR I  
Sbjct: 108 EEDAQGEPFVGKGGQLLRRIIAACQLPSAQEYLLNIIKCRPPRTRPPTMAECGNCRDIFR 167

Query: 180 RQIELISPKILLFIGNKTKNFFFNN-DAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELI 238
           RQ EL+ PK L+ +G            A       G+          +P + T HP ++ 
Sbjct: 168 RQFELVRPKYLVALGLTASRLLSGKVSATALGALRGQVHQY----RGVPLICTHHPNDID 223

Query: 239 QY--PLIKKNTWHALITLKKAL 258
                 +K+ TW  +  L + +
Sbjct: 224 ADGTGRLKRETWDDMKLLLRTM 245


>gi|227819345|ref|YP_002823316.1| DNA-directed DNA polymerase [Sinorhizobium fredii NGR234]
 gi|227338344|gb|ACP22563.1| putative DNA-directed DNA polymerase protein [Sinorhizobium fredii
           NGR234]
          Length = 232

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 32/175 (18%), Positives = 73/175 (41%), Gaps = 11/175 (6%)

Query: 72  QKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGK 131
            +A S+  L+        C L   +   +         ++++G  P D ++++G+PF G 
Sbjct: 36  AEAPSIAALRKQAEGCERCDLYKNATQLVFGEGPGKARVVLVGEQPGDREDLAGRPFVGP 95

Query: 132 TGNMLDKMLQSIEIMRTQIHISMISPWHPPG-------NRNLSNIEMEICRPIIMRQIEL 184
            G +LD+ L    I R+  +++                +   +  E++ C   +  +++ 
Sbjct: 96  AGRILDECLHEAGIDRSSCYLTNAVKHFKFEQRGKRRLHSRPNAGEVQRCSWWLGAELDK 155

Query: 185 ISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ 239
           + PK+++ +G    +      A+   +N G   +L    +    L T+HP  L++
Sbjct: 156 LHPKVVVALGATALSSLLGRRARVM-KNRG---DLIPTPAGYSVLITIHPSYLLR 206


>gi|296272664|ref|YP_003655295.1| uracil-DNA glycosylase superfamily [Arcobacter nitrofigilis DSM
           7299]
 gi|296096838|gb|ADG92788.1| Uracil-DNA glycosylase superfamily [Arcobacter nitrofigilis DSM
           7299]
          Length = 222

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 37/189 (19%), Positives = 87/189 (46%), Gaps = 7/189 (3%)

Query: 74  ACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTG 133
              + +L+ L+++ H C L     + +  +     ++M +  +P+ S++     + GK+G
Sbjct: 40  PDDIKQLEELVKNCHLCQLSKYRENVLFGSGNINSNIMFLKESPTISEDEVDAFYVGKSG 99

Query: 134 NMLDKMLQSI-EIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLF 192
            +L  M++ + ++    ++I+ I       N  +    +  C+  + +QIEL+ PK+L+ 
Sbjct: 100 ELLKNMIEKVLKVPCETVYITNIVKC-ISPNSEIKAEHVNNCKAYLDKQIELVKPKLLVI 158

Query: 193 IGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALI 252
           +G      F  +D     +  GK      P++ +  + T  P  L++ P  K   +  L+
Sbjct: 159 LGESVYRHF-TSDNTAFSEIRGKV----IPNNDLDIICTYEPSFLLRNPSSKGEAYEDLL 213

Query: 253 TLKKALKNL 261
            +K  ++ +
Sbjct: 214 KIKAIMEQM 222


>gi|254486783|ref|ZP_05099988.1| putative DNA polymerase related protein [Roseobacter sp. GAI101]
 gi|214043652|gb|EEB84290.1| putative DNA polymerase related protein [Roseobacter sp. GAI101]
          Length = 473

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 38/203 (18%), Positives = 77/203 (37%), Gaps = 14/203 (6%)

Query: 52  PITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLM 111
           P   +  + +   Q A   +        L + + +   C L  T+   +        DLM
Sbjct: 260 PPARMAQVQA---QLAAHHSAWDGPSDALPAAIAACTRCPLHCTATQAVVGEGPMDADLM 316

Query: 112 IIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPG-------NR 164
           I+G  P D +++SG+PF G  G + D++     + R++ +++                ++
Sbjct: 317 IVGEQPGDQEDLSGRPFVGPAGQLFDQIAVQAGLDRSRAYVTNAVKHFKFTPRGKKRIHQ 376

Query: 165 NLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHS 224
             +  E++ CR  +  ++  + PK++L +G                +  GK         
Sbjct: 377 RPNTSEIDHCRWWLDAEVAQVKPKLILGMGATAAEGLTGRRDAILAR-RGKVEEAP---D 432

Query: 225 IIPTLATVHPQELIQYPLIKKNT 247
             P L T+HP  L++ P      
Sbjct: 433 GTPVLLTLHPSYLLRLPDRAAKA 455


>gi|114328194|ref|YP_745351.1| uracil DNA glycosylase superfamily protein [Granulibacter
           bethesdensis CGDNIH1]
 gi|114316368|gb|ABI62428.1| uracil DNA glycosylase superfamily protein [Granulibacter
           bethesdensis CGDNIH1]
          Length = 488

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 39/236 (16%), Positives = 82/236 (34%), Gaps = 18/236 (7%)

Query: 31  PNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQ-KACSLHELKSLLRSFHD 89
           P+  A  E++ +         P      I +          +    +L E +        
Sbjct: 238 PDMLADAEARVQRMHQAGTTAPRPGAAAISARYRASMPVATEVSPETLDEARQAALQCRR 297

Query: 90  CHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ 149
           C LC  +  T+      G  LMI+G  P D +++ G+PF G  G +L  ++  + +   +
Sbjct: 298 CSLCEAATRTVWGEGDVGASLMIVGEQPGDREDLEGRPFVGPAGQVLRDLMGKVGMAAAE 357

Query: 150 IHISMISPW-------HPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFF 202
           + ++                +++    E+E CR  +  ++ L+ P++ L +G        
Sbjct: 358 VWLTNAVKHFKFLPRGRHRLHQSPDRKEIEACRWWLDLELSLVRPRLTLALGASATFALT 417

Query: 203 NNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPL------IKKNTWHALI 252
             +     +  G            P L + HP  +++ P        ++     L 
Sbjct: 418 G-NRAAMTRRRGMV---EQGLHGGPVLISWHPSFILRLPNPQESEKARRELEQDLR 469


>gi|120404181|ref|YP_954010.1| phage SPO1 DNA polymerase--like protein [Mycobacterium vanbaalenii
           PYR-1]
 gi|119956999|gb|ABM14004.1| phage SPO1 DNA polymerase-related protein [Mycobacterium
           vanbaalenii PYR-1]
          Length = 217

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 39/216 (18%), Positives = 82/216 (37%), Gaps = 20/216 (9%)

Query: 64  VQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNI 123
           +  A     +   L  L +  +S   C L   +   +  +   G  +M++G  P D +++
Sbjct: 3   IVGAAEFVPQTRELSTLAAAAQSCRGCDLFENASRAVFGSGPVGARMMLVGEQPGDREDV 62

Query: 124 SGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPP---------GNRNLSNIEMEIC 174
           +G+PF G  G +LDK L    + R  ++++                  ++  S  E+  C
Sbjct: 63  AGEPFVGPAGRLLDKALDEAGLPRAPVYLTNAVKHFKFVPAERGTRRIHKTPSRTEVVAC 122

Query: 175 RPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNL-----CTPHSIIPTL 229
           RP ++ +++ + P +++ +G         N  + T    G+  +L              +
Sbjct: 123 RPWLIAEMQAVEPAVVVLLGATAAKSLLGNAFRLTAH-RGEVLSLPAETKPVGGRDAKVV 181

Query: 230 ATVHPQELIQYPLIKKN-----TWHALITLKKALKN 260
            TVHP  +++ P   +          L    + L  
Sbjct: 182 VTVHPSSVLRGPSQAREESFRSLVSDLRFAGELLDA 217


>gi|254477893|ref|ZP_05091278.1| putative DNA polymerase related protein [Ruegeria sp. R11]
 gi|214028478|gb|EEB69314.1| putative DNA polymerase related protein [Ruegeria sp. R11]
          Length = 474

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 31/191 (16%), Positives = 71/191 (37%), Gaps = 13/191 (6%)

Query: 79  ELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDK 138
           +L S + +   C L   +   +     +  +LM +G  P D +++ G+PF G  G + D 
Sbjct: 284 DLPSAISACTRCPLHKPATQAVAGEGPQSAELMFVGEQPGDHEDLVGRPFVGPAGQLFDL 343

Query: 139 MLQSIEIMRTQIHISMISPW-------HPPGNRNLSNIEMEICRPIIMRQIELISPKILL 191
           ++    + R +  ++                ++  S  E+  C P +  +I  + P++++
Sbjct: 344 LMAEAGLKREEAFVTNAVKHFKFLPRGRKRLHQKPSQDEIATCNPWLRAEIAQVQPRLIV 403

Query: 192 FIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ--YPLIKKNTWH 249
            +G            +      G+          +P L T+HP  L++       K    
Sbjct: 404 AMGASAAQALLG-SGKAITDRRGRV---EWRADGLPVLITLHPSFLLRLSDAAAVKQARA 459

Query: 250 ALITLKKALKN 260
            ++   +   +
Sbjct: 460 DMLADLRRAAD 470


>gi|221638650|ref|YP_002524912.1| Phage SPO1 DNA polymerase-related protein [Rhodobacter sphaeroides
           KD131]
 gi|221159431|gb|ACM00411.1| Phage SPO1 DNA polymerase-related protein [Rhodobacter sphaeroides
           KD131]
          Length = 485

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 40/241 (16%), Positives = 83/241 (34%), Gaps = 17/241 (7%)

Query: 34  EATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLC 93
           E   E Q    +   A       +   +     A        SL E K+       C L 
Sbjct: 248 ERAAEMQAAALTEPPARTAAVARQRAAAAGGPVAAGDGSAPGSLAEAKTAAEGCRRCGLW 307

Query: 94  STSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHIS 153
           + +   +         +MI+G  P D ++++G+PF G  G + D+   +  + R  ++++
Sbjct: 308 ANATQVVFGEGPATARMMIVGEQPGDREDLAGRPFVGPAGQLFDEEAAAAGLDRQAVYVT 367

Query: 154 MISPWHPPG-------NRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDA 206
                           ++     E+  CR  +  + +L+ P++++ +G            
Sbjct: 368 NAVKHFKFAPRGKRRIHQKPDAGEVTACRWWLDLERDLVRPRLIVAMGATALASLTG-SG 426

Query: 207 QKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPL------IKKNTWHALITLKKALKN 260
               +  G    L       P   TVHP  +++ P        ++     L   ++ L+ 
Sbjct: 427 AGILKRRGSVERL---DDGTPLFVTVHPSYILRLPDEAARAEERRRFRADLEAARQLLER 483

Query: 261 L 261
           L
Sbjct: 484 L 484


>gi|307328601|ref|ZP_07607774.1| phage SPO1 DNA polymerase-related protein [Streptomyces
           violaceusniger Tu 4113]
 gi|306885713|gb|EFN16726.1| phage SPO1 DNA polymerase-related protein [Streptomyces
           violaceusniger Tu 4113]
          Length = 219

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 39/217 (17%), Positives = 74/217 (34%), Gaps = 17/217 (7%)

Query: 57  RHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYT 116
                     A  +   A  L  L+        C L   +  T+          M++G  
Sbjct: 4   TKSPEDAYTAAPFVPDGA-DLGALREAAAGCRGCPLHRDATQTVFGAGDPDARAMLVGEQ 62

Query: 117 PSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSN-------- 168
           P D ++  GKPF G  G +LD+ L    I   + +I+                       
Sbjct: 63  PGDQEDRQGKPFVGPAGKVLDRALDEAGIDPDETYITNAVKHFKFTYVPERGKRRIHKPP 122

Query: 169 --IEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWS-NLCTPHSI 225
              E+  C P +  ++ELI P++++ +G         +  + T Q   +   +   P   
Sbjct: 123 SLRELAACGPWLAAEVELIGPEVIVALGATAGKALLGSSFRVTQQRGTRLEGDASGPARG 182

Query: 226 IPTLATVHPQELIQYPLIKKNTWH----ALITLKKAL 258
              + T+HP  +++    ++  +      L    +AL
Sbjct: 183 ALIVPTIHPSAVLRA-DDREAAYEGLVADLRVAAEAL 218


>gi|302553346|ref|ZP_07305688.1| uracil DNA glycosylase superfamily protein [Streptomyces
           viridochromogenes DSM 40736]
 gi|302470964|gb|EFL34057.1| uracil DNA glycosylase superfamily protein [Streptomyces
           viridochromogenes DSM 40736]
          Length = 216

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 37/216 (17%), Positives = 77/216 (35%), Gaps = 13/216 (6%)

Query: 56  IRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGY 115
           +R   S     A+        L  L+        C L   +  T+  +      +M++G 
Sbjct: 2   VRAQASEDAYTAEPFVPGGGGLSALRRAAAECRGCPLHRDATQTVFGSGDADARVMLVGE 61

Query: 116 TPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPG---------NRNL 166
            P D ++  G+PF G  G +LD+ L+   I   + +++                  ++  
Sbjct: 62  QPGDQEDRQGEPFVGPAGRVLDRALEEAGIDPAEAYVTNAVKHFKFTQAEPRKRRIHKAP 121

Query: 167 SNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSII 226
           S  EM  C P +  ++ ++ P++++ +G         +  +   Q  G            
Sbjct: 122 SLREMTACGPWLAAELAVVEPELIVVLGATAGKALLGSSFRV-TQVRGTVLEEEIHGRAE 180

Query: 227 PTLATVHPQELIQYPLIKKNTW---HALITLKKALK 259
             + TVHP  +++    +         L    +AL+
Sbjct: 181 RLVPTVHPSSVLRADDREAAYRGLVSDLRVAAQALR 216


>gi|300114529|ref|YP_003761104.1| phage SPO1 DNA polymerase-like protein [Nitrosococcus watsonii
           C-113]
 gi|299540466|gb|ADJ28783.1| phage SPO1 DNA polymerase-related protein [Nitrosococcus watsonii
           C-113]
          Length = 189

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 55/193 (28%), Positives = 92/193 (47%), Gaps = 6/193 (3%)

Query: 68  DSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKP 127
           D + +KA +LHEL      +   ++       +         +MIIG  P   +  +G+P
Sbjct: 2   DDLLKKAATLHELAQYCNRYLGPNVVKGEK-LVFGEGPSSAKIMIIGEAPGVQEAKTGQP 60

Query: 128 FSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISP 187
           F G +G +L K+L  I + R QI+IS I   HPPGNR     E++   P ++RQIEL+ P
Sbjct: 61  FVGSSGQLLTKLLHQIGLKREQIYISNILKTHPPGNRKPHRSEIKRELPFLLRQIELLQP 120

Query: 188 KILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNT 247
           ++L+ +G        + +A K  +  G+W  +      +PT  T HP   ++    K   
Sbjct: 121 QLLVLLGATALQALLDPNA-KITKLRGQWLEI----KNLPTFVTYHPAAALRDETKKAAL 175

Query: 248 WHALITLKKALKN 260
                +L+  L++
Sbjct: 176 AQDFASLQGYLES 188


>gi|241205676|ref|YP_002976772.1| phage SPO1 DNA polymerase-related protein [Rhizobium leguminosarum
           bv. trifolii WSM1325]
 gi|240859566|gb|ACS57233.1| phage SPO1 DNA polymerase-related protein [Rhizobium leguminosarum
           bv. trifolii WSM1325]
          Length = 484

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 43/237 (18%), Positives = 96/237 (40%), Gaps = 17/237 (7%)

Query: 35  ATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCS 94
           A+ ES+ +  +   A Q +     +              A +L  L +   +   C L +
Sbjct: 248 ASAESKVRAMAAREATQSLPFHDRLQEAARSIPAEPEAPAGTLEALGAEAAACTRCPLHA 307

Query: 95  TSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISM 154
            +  T+        ++M +G  P D ++ISG+PF G  G +LD+++    I R+ ++++ 
Sbjct: 308 KATQTVFGEGPRDAEVMFVGEQPGDQEDISGRPFVGPAGRLLDQVISEAGIDRSTLYVTN 367

Query: 155 ISPWHPPG-------NRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQ 207
                          ++  +  E++ CR  +  ++ LI PK+++ +G    +   +   +
Sbjct: 368 AVKHFKYEPRGKRRIHQKPNMGEVKHCRWWLNLEMALIKPKLVVAMGATALSALTDTKQR 427

Query: 208 KTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIK------KNTWHALITLKKAL 258
                 GK   +    +      TVHP  L++ P  +            ++T+++ +
Sbjct: 428 LQ-DVRGKAIAIDERRT---LFVTVHPSYLLRIPDERLKAEELARFREDMLTVQRLM 480


>gi|119898540|ref|YP_933753.1| putative DNA polymerase related protein [Azoarcus sp. BH72]
 gi|119670953|emb|CAL94866.1| putative DNA polymerase related protein [Azoarcus sp. BH72]
          Length = 216

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 36/209 (17%), Positives = 76/209 (36%), Gaps = 18/209 (8%)

Query: 59  IHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPS 118
             +     A    Q   +L EL++   +   C L   +  T+     +   +M++G  P 
Sbjct: 2   PPAQPKPTAAPFVQPDATLAELRAAAGACTGCDLYRDATQTVFGEGPDDAPVMLVGEQPG 61

Query: 119 DSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISM------ISPWHPPGNRNLSNI--E 170
           D+++  G PF G  G +LD+ L    I R++ +++                 + +    E
Sbjct: 62  DAEDRQGHPFVGPAGKLLDRALTDAGIDRSRSYVTNAVKHFKWIFTRGHKRLHQTPRTVE 121

Query: 171 MEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLA 230
           ++ C P +  +I  + P++L+ +G             +     G              +A
Sbjct: 122 VQACAPWLEAEIARVKPQVLILLGATAAKSLLG-SGFRVTAQRGVPQPSPLAP---RVVA 177

Query: 231 TVHPQELIQ--YPLIKKNTW----HALIT 253
           T+HP  L++      ++  +      L  
Sbjct: 178 TIHPSALLRMANAEQRERAYAAFVADLRA 206


>gi|307721220|ref|YP_003892360.1| Uracil-DNA glycosylase superfamily [Sulfurimonas autotrophica DSM
           16294]
 gi|306979313|gb|ADN09348.1| Uracil-DNA glycosylase superfamily [Sulfurimonas autotrophica DSM
           16294]
          Length = 223

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 40/190 (21%), Positives = 82/190 (43%), Gaps = 7/190 (3%)

Query: 72  QKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGK 131
           +K  +L  L   + S H C L  +   ++    ++   L+II Y+ S + + S   ++G+
Sbjct: 40  EKPNTLEALAQNIASCHLCDLSKSRTQSMSGYGSKDAKLVIIDYSVSQAQDSSNSYYAGR 99

Query: 132 TGNMLDKMLQSI-EIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKIL 190
           +G  L  M++ +  +    I+++      P  +   S  E   C+  +  Q++ I PK++
Sbjct: 100 SGETLKNMIEKVLHLSIDDIYLTHAVKCKPLQSNKPSPSEYNSCKNYLFSQLDFIKPKVI 159

Query: 191 LFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHA 250
           + +G         +         G   +          +   HPQ L++ P +KK T + 
Sbjct: 160 VTLGEDAYTHITGDT--NFENVRGHVIDY----KEYKLIPIYHPQYLLRNPHLKKITLND 213

Query: 251 LITLKKALKN 260
           L T+K  L++
Sbjct: 214 LKTIKSCLQD 223


>gi|78777161|ref|YP_393476.1| uracil-DNA glycosylase superfamily protein [Sulfurimonas
           denitrificans DSM 1251]
 gi|78497701|gb|ABB44241.1| Uracil-DNA glycosylase superfamily [Sulfurimonas denitrificans DSM
           1251]
          Length = 219

 Score =  132 bits (333), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 38/188 (20%), Positives = 84/188 (44%), Gaps = 6/188 (3%)

Query: 73  KACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKT 132
           K  +++EL   + + + C L  +   ++        D+MII Y+ S  ++ +   + G++
Sbjct: 37  KPLTINELSKEVSTCYLCDLSKSRTQSMSGYGNSNADVMIIDYSVSLGEDNTNSYYCGRS 96

Query: 133 GNMLDKMLQSI-EIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILL 191
           G++L  M++++ E+    ++ +      P  ++  S  E + C+  +  QIE + PK+++
Sbjct: 97  GDILKNMIENVLELKIEDVYFTHAIKCKPLNSKTPSESEWDSCKNYLFSQIEFVKPKVVV 156

Query: 192 FIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHAL 251
            +G         ++        G   +          +   HP  L++ P  KK  ++ L
Sbjct: 157 TLGKDA-YAKVTSENDNFQNVRGHVIDF----KSYKLVPIYHPNYLLRNPDDKKIAFNDL 211

Query: 252 ITLKKALK 259
            T+K  LK
Sbjct: 212 KTIKSLLK 219


>gi|222102769|ref|YP_002539808.1| hypothetical protein Avi_7466 [Agrobacterium vitis S4]
 gi|221739370|gb|ACM40103.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 492

 Score =  132 bits (333), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 39/235 (16%), Positives = 94/235 (40%), Gaps = 14/235 (5%)

Query: 35  ATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCS 94
           A  E++  + +   A +P+     +     +   +   +A ++  L+   R  + C L  
Sbjct: 259 AGAEAKLIDMAQRQASEPLPFHHRLQDAAARVPAAPVAEADTIDALRQEARRCNRCDLSC 318

Query: 95  TSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISM 154
            +  T+         +M++G  P D ++++G+PF G  G + D+ L    + R  ++++ 
Sbjct: 319 RATQTVFGEGPVDAKIMVVGEQPGDQEDLAGRPFVGPAGRVFDEALAQAGMDRRALYVTN 378

Query: 155 ISPWHPPG-------NRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQ 207
                          ++  +  E++ CR  + ++IE++ PK+++ +G         +   
Sbjct: 379 AVKHFKYEPRGKRRIHQRPNIAEVQQCRWWLTQEIEMVKPKLIVAMGAIALFS-LTDRKD 437

Query: 208 KTYQNLGKWSNLCTPHSIIPTLATVHPQELIQY