RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780743|ref|YP_003065156.1| putative uracil-DNA glycosylase [Candidatus Liberibacter asiaticus str. psy62] (261 letters) >gnl|CDD|31761 COG1573, COG1573, Uracil-DNA glycosylase [DNA replication, recombination, and repair]. Length = 202 Score = 101 bits (253), Expect = 2e-22 Identities = 53/199 (26%), Positives = 91/199 (45%), Gaps = 8/199 (4%) Query: 71 AQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSG 130 A+ A L EL+ + + C L + ++I+G P ++ +G+PF G Sbjct: 4 AEAAELLEELREEIEACRRCPLLKDRTPVVPGGGNPTARILIVGEAPGAGEDRTGRPFVG 63 Query: 131 KTGNMLDKMLQSIEIMRTQ-IHISMISPW-HPPGNR---NLSNIEMEICRPIIMRQIELI 185 K G++LD++L +I +R + ++I+ + +PPGNR + + E++ CRP + +I LI Sbjct: 64 KAGDLLDRILGAIGGLRYEDVYITNVVKCRYPPGNRPPGDPTPEEIKACRPFLEAEIALI 123 Query: 186 SPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCT-PHSIIPTLATVHPQELIQYPL-- 242 PK++L +G + + G+W I T HP L + P Sbjct: 124 RPKVILLLGEYAAKSLLGLKGEPITELRGRWGAYRPKGGGGIRVFPTYHPSPLNRNPGKL 183 Query: 243 IKKNTWHALITLKKALKNL 261 K W L LK L+ L Sbjct: 184 NKWFFWEDLKKLKALLRQL 202 >gnl|CDD|146005 pfam03167, UDG, Uracil DNA glycosylase superfamily. Length = 147 Score = 94.3 bits (235), Expect = 3e-20 Identities = 28/126 (22%), Positives = 59/126 (46%), Gaps = 10/126 (7%) Query: 109 DLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSN 168 ++I+G P ++ +G PF+G+ GN+L ++L + R ++++ + P R + Sbjct: 9 KVLIVGEAPGPGEDATGLPFAGRAGNLLWRILAEAGLAREGVYLTNVVKCPRPVGRKPTR 68 Query: 169 IEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPT 228 E+ C P ++ ++ L+ PK+++ +G F +++ G IP Sbjct: 69 SEIAACWPYLLEELALLRPKVVVLLGKTAAKAFLGLGKKESLFEGGG----------IPV 118 Query: 229 LATVHP 234 L HP Sbjct: 119 LPLPHP 124 >gnl|CDD|39323 KOG4120, KOG4120, KOG4120, G/T mismatch-specific thymine DNA glycosylase [Replication, recombination and repair]. Length = 426 Score = 27.8 bits (61), Expect = 3.0 Identities = 21/103 (20%), Positives = 41/103 (39%), Gaps = 14/103 (13%) Query: 105 TEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ-------------IH 151 E D++I+G P + G ++G GN K L ++ Q I Sbjct: 146 CENLDIVIVGINPGLTAAYKGHHYAGP-GNHFWKCLNKSGLLEAQFTYLNDHDLPKHGIG 204 Query: 152 ISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIG 194 + + G+ +L EM+ I+ +++ P++ +F G Sbjct: 205 FTNMVARPTSGSADLRKKEMQEGARILYEKLQRYRPQVAVFNG 247 >gnl|CDD|163644 cd07401, MPP_TMEM62_N, Homo sapiens TMEM62, N-terminal metallophosphatase domain. TMEM62 (transmembrane protein 62) is an uncharacterized Homo sapiens transmembrane protein with an N-terminal metallophosphatase domain. TMEM62 belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination. Length = 256 Score = 27.3 bits (61), Expect = 4.4 Identities = 14/57 (24%), Positives = 22/57 (38%), Gaps = 11/57 (19%) Query: 148 TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNN 204 + IH+S +HPP I++I P ++L G+ T N N Sbjct: 6 SDIHVS---SFHPPNRAQDETFCSNF--------IDVIKPALVLATGDLTDNKTGNK 51 >gnl|CDD|38559 KOG3349, KOG3349, KOG3349, Predicted glycosyltransferase [General function prediction only]. Length = 170 Score = 27.2 bits (60), Expect = 4.7 Identities = 7/33 (21%), Positives = 14/33 (42%) Query: 220 CTPHSIIPTLATVHPQELIQYPLIKKNTWHALI 252 CTP ++ LA + + L +P + + Sbjct: 132 CTPSTLPAGLAKLDLESLKPFPPSDPENFSKFL 164 >gnl|CDD|36410 KOG1196, KOG1196, KOG1196, Predicted NAD-dependent oxidoreductase [General function prediction only]. Length = 343 Score = 27.1 bits (60), Expect = 4.8 Identities = 21/71 (29%), Positives = 31/71 (43%), Gaps = 13/71 (18%) Query: 133 GNMLDKMLQSIEIMRTQIHI---SMISPWH---PPGNRNLSNI---EMEICRPIIMRQIE 183 G MLD +L + M I MIS ++ P G NLS I + I ++ ++ Sbjct: 233 GKMLDAVLLN---MNLHGRIAVCGMISQYNLENPEGLHNLSTIIYKRIRIQGFLVSDYLD 289 Query: 184 LISPKILLFIG 194 PK L F+ Sbjct: 290 KY-PKFLDFLL 299 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.319 0.133 0.397 Gapped Lambda K H 0.267 0.0714 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 3,081,520 Number of extensions: 152839 Number of successful extensions: 320 Number of sequences better than 10.0: 1 Number of HSP's gapped: 319 Number of HSP's successfully gapped: 14 Length of query: 261 Length of database: 6,263,737 Length adjustment: 92 Effective length of query: 169 Effective length of database: 4,275,709 Effective search space: 722594821 Effective search space used: 722594821 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 56 (25.4 bits)