RPSBLAST alignment of GI: 254780743 and MMDB domain: 1wyw_A_1-199

>1wyw_A (A:1-199) TDG, G/T mismatch-specific thymine DNA glycosylase; hydrolase; 2.10A {Homo sapiens}Length = 199
 Score = 89.0 bits (220), Expect = 6e-19
 Identities = 27/193 (13%), Positives = 54/193 (27%), Gaps = 19/193 (9%)

Query: 87  FHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIM 146
            +          T+    T   D++IIG  P       G  + G   +    +  S    
Sbjct: 2   SNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSE 61

Query: 147 R-------------TQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFI 193
                           I  + +     PG+++LS+ E      I++++++   P+I +F 
Sbjct: 62  VQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFN 121

Query: 194 GNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSI--IPTLATVHPQELIQYPLI---KKNTW 248
           G      F             ++                                K + +
Sbjct: 122 GKCIYEIFSKEVFGVK-VKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFPRAQDKVHYY 180

Query: 249 HALITLKKALKNL 261
             L  L+  LK +
Sbjct: 181 IKLKDLRDQLKGI 193