RPSBLAST alignment of GI: 254780743 and protein with PDBid: 1wyw

>1wyw_A TDG, G/T mismatch-specific thymine DNA glycosylase; hydrolase; 2.10A {Homo sapiens} SCOP: c.18.1.2 PDB: 2d07_A 2rba_A* Length = 230
 Score = 72.3 bits (177), Expect = 1e-13
 Identities = 20/111 (18%), Positives = 39/111 (35%), Gaps = 13/111 (11%)

Query: 106 EGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMR-------------TQIHI 152
              D++IIG  P       G  + G   +    +  S                    I  
Sbjct: 21  FNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGF 80

Query: 153 SMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFN 203
           + +     PG+++LS+ E      I++++++   P+I +F G      F  
Sbjct: 81  TNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSK 131