RPSBLAST alignment of GI: 254780743 and SCOP domain: d1vk2a_

Alignment
>d1vk2a_ c.18.1.2 (A:) Thermophilic uracil-DNA glycosylase {Thermotoga maritima [TaxId: 2336]} Length = 191
 Score = 74.6 bits (182), Expect = 7e-15
 Identities = 35/190 (18%), Positives = 79/190 (41%), Gaps = 5/190 (2%)

Query: 73  KACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKT 132
           +   +  +   ++    C L     + +         ++ +G  P + ++ +G+PF G+ 
Sbjct: 4   REELMEIVSERVKKCTACPLHLNRTNVVVGEGNLDTRIVFVGEGPGEEEDKTGRPFVGRA 63

Query: 133 GNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLF 192
           G +L ++L+   I R  ++I  +    PP NR  +  E   C   ++ QIE+I+P +++ 
Sbjct: 64  GMLLTELLRESGIRREDVYICNVVKCRPPNNRTPTPEEQAACGHFLLAQIEIINPDVIVA 123

Query: 193 IGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP--LIKKNTWHA 250
           +G    +FF +       +  G   +          + T HP  L++     +++     
Sbjct: 124 LGATALSFFVDGKKVSITKVRGNPIDW---LGGKKVIPTFHPSYLLRNRSNELRRIVLED 180

Query: 251 LITLKKALKN 260
           +   K  +K 
Sbjct: 181 IEKAKSFIKK 190

SCOP domain information

class: Alpha and beta proteins (a/b)
fold: Uracil-DNA glycosylase-like
superfamily: Uracil-DNA glycosylase-like
family: Mug-like
domain: Thermophilic uracil-DNA glycosylase
species: Thermotoga maritima [TaxId: 2336]