BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780745|ref|YP_003065158.1| OstA family protein [Candidatus Liberibacter asiaticus str. psy62] (181 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780745|ref|YP_003065158.1| OstA family protein [Candidatus Liberibacter asiaticus str. psy62] Length = 181 Score = 369 bits (946), Expect = e-104, Method: Compositional matrix adjust. Identities = 181/181 (100%), Positives = 181/181 (100%) Query: 1 MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60 MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK Sbjct: 1 MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60 Query: 61 AFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGY 120 AFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGY Sbjct: 61 AFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGY 120 Query: 121 VDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180 VDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR Sbjct: 121 VDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180 Query: 181 P 181 P Sbjct: 181 P 181 >gi|254781158|ref|YP_003065571.1| peptidyl prolyl cis-trans isomerase D signal peptide protein [Candidatus Liberibacter asiaticus str. psy62] Length = 631 Score = 26.2 bits (56), Expect = 0.35, Method: Compositional matrix adjust. Identities = 22/76 (28%), Positives = 36/76 (47%), Gaps = 15/76 (19%) Query: 70 TQEDFSLQADKMTIDYNNTN---RDV----------SNKINRMDVERNIFIQSGEINVIA 116 T E+ S +A+++ ++Y+ RD+ +N+INRMD E F G V + Sbjct: 495 TAEEVSSKANQLVLEYSKEGKNFRDIGKNLGASLLTTNQINRMDNENKFFGYDGISQVFS 554 Query: 117 SNGYVDFQKRILVLNG 132 G V+ K + NG Sbjct: 555 --GPVEMVKCFPIENG 568 >gi|254780264|ref|YP_003064677.1| elongation factor G [Candidatus Liberibacter asiaticus str. psy62] Length = 701 Score = 25.0 bits (53), Expect = 0.79, Method: Composition-based stats. Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 2/49 (4%) Query: 99 MDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDR--ADKVILKEKLN 145 M+VER+I + G I ++ SN V+ Q + D+ +VI K++ Sbjct: 95 MEVERSIRVTDGAIALLDSNAGVEPQTETVWRQADKYSVPRVIFCNKMD 143 >gi|254780295|ref|YP_003064708.1| tRNA pseudouridine synthase A [Candidatus Liberibacter asiaticus str. psy62] Length = 247 Score = 25.0 bits (53), Expect = 0.91, Method: Compositional matrix adjust. Identities = 14/47 (29%), Positives = 23/47 (48%), Gaps = 5/47 (10%) Query: 81 MTIDYNNTN-----RDVSNKINRMDVERNIFIQSGEINVIASNGYVD 122 M I+YN + R + + +E+ IF+ +GEI V+ G D Sbjct: 6 MIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTD 52 >gi|254780234|ref|YP_003064647.1| argininosuccinate synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 404 Score = 23.9 bits (50), Expect = 2.0, Method: Compositional matrix adjust. Identities = 13/38 (34%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Query: 121 VDFQKR-ILVLNGDRADKVILKEKLNTFLGCKLIVNID 157 +DFQ+ + +NG +L E+LN + C I ID Sbjct: 225 IDFQRGDPIAINGQVMSPEVLLEQLNQYGRCNGIGRID 262 >gi|254780916|ref|YP_003065329.1| putative sigma-54-dependent transcription regulator protein [Candidatus Liberibacter asiaticus str. psy62] Length = 482 Score = 21.9 bits (45), Expect = 6.2, Method: Compositional matrix adjust. Identities = 16/61 (26%), Positives = 29/61 (47%), Gaps = 11/61 (18%) Query: 121 VDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVN-----------IDTSFASLQGCESD 169 +D KR+L+++ D I+K+ + ++ IVN ++ F SL CE D Sbjct: 7 LDRHKRVLIIDKDDEQIKIIKDHVESYGYDVFIVNVSDLSTISKIQVNVIFLSLINCEDD 66 Query: 170 Q 170 + Sbjct: 67 K 67 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.323 0.137 0.378 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 106,554 Number of Sequences: 1233 Number of extensions: 4021 Number of successful extensions: 13 Number of sequences better than 100.0: 7 Number of HSP's better than 100.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 9 Number of HSP's gapped (non-prelim): 7 length of query: 181 length of database: 328,796 effective HSP length: 69 effective length of query: 112 effective length of database: 243,719 effective search space: 27296528 effective search space used: 27296528 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 35 (18.1 bits)