HHsearch alignment for GI: 254780749 and conserved domain: PRK00376

>PRK00376 lspA lipoprotein signal peptidase; Reviewed.
Probab=100.00  E-value=1.9e-35  Score=199.77  Aligned_cols=103  Identities=32%  Similarity=0.566  Sum_probs=91.5

Q ss_pred             CCCCH---HHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHH
Q ss_conf             94520---029999999999999999999655502289999999999887999998976312757766236815408999
Q gi|254780749|r    1 MLSNV---SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQTWSFAVFNL   77 (108)
Q Consensus         1 m~s~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~l~li~gGaiGNliDR~~~G~VvDfi~~~~~~~~~pvFNv   77 (108)
T Consensus        57 l~~~~~~~~~~~~~~i~~~~~~~l~~~~~~~~~~~~~~~~~l~li~gGaiGNliDR~~~G~VvDFi~~~~~~~~~piFNv  136 (162)
T PRK00376         57 FLADAGGWQRWFFTIIAIGISVGLVYLLRRSKALQKLLAIAYALILGGALGNLIDRFFHGHVVDFIDFYWGNWHFPVFNL  136 (162)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCEEEH
T ss_conf             11466347999999999999999999999803403899999999998664228899717977658886577777760668


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             99999999999999999400043211
Q gi|254780749|r   78 ADLFISIGTCIIIYDDIILQHRQKGK  103 (108)
Q Consensus        78 AD~~I~iG~~lli~~~~~~~~~~k~~  103 (108)
T Consensus       137 AD~~I~iG~~llii~~~~~~kk~~~~  162 (162)
T PRK00376        137 ADSAICIGAILLILDGFFPKKKKKKK  162 (162)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             99999999999999999853011059