HHsearch alignment for GI: 254780749 and conserved domain: pfam01252

>pfam01252 Peptidase_A8 Signal peptidase (SPase) II.
Probab=99.97  E-value=1.3e-31  Score=180.18  Aligned_cols=94  Identities=31%  Similarity=0.584  Sum_probs=82.4

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHH
Q ss_conf             94520029999999999999999999655502289999999999887999998976312757766236815408999999
Q gi|254780749|r    1 MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQTWSFAVFNLADL   80 (108)
Q Consensus         1 m~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~l~li~gGaiGNliDR~~~G~VvDfi~~~~~~~~~pvFNvAD~   80 (108)
T Consensus        48 ~~~~~-~~~l~~~~~~~~~~i~~~~~~~~~~~~~~~~~l~li~gGaiGNliDR~~~G~VvDfi~~~~--~~~pvFNvAD~  124 (143)
T pfam01252        48 LFSGQ-RWFLSLIALLAILALLYYLLRLKKRSRLAAIALGLILGGALGNLIDRLRYGAVVDFLDFHI--WHWPVFNVADI  124 (143)
T ss_pred             CCCCC-CHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEECCC--CCCCEEEHHHH
T ss_conf             23698-4699999999999999999994243489999999999877510788876584223577057--78732159999


Q ss_pred             HHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999400
Q gi|254780749|r   81 FISIGTCIIIYDDIILQ   97 (108)
Q Consensus        81 ~I~iG~~lli~~~~~~~   97 (108)
T Consensus       125 ~I~iG~~lli~~~~~~~  141 (143)
T pfam01252       125 AITVGVILLLLDSLFKK  141 (143)
T ss_pred             HHHHHHHHHHHHHHHHC
T ss_conf             99999999999999852