BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780749|ref|YP_003065162.1| lipoprotein signal peptidase
transmembrane [Candidatus Liberibacter asiaticus str. psy62]
         (108 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|92112615|ref|YP_572543.1| lipoprotein signal peptidase [Chromohalobacter salexigens DSM 3043]
 gi|91795705|gb|ABE57844.1| lipoprotein signal peptidase [Chromohalobacter salexigens DSM 3043]
          Length = 181

 Score =  119 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 27/106 (25%), Positives = 50/106 (47%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +     +  +I I +   +     +    + +  I  +L+  GALGN+ D  ++GYV+D+
Sbjct: 75  AGWQRWLFAAIAIGVSIGLTVWLTRLKAHERLSAIAIVLVIGGALGNLYDRLVHGYVVDF 134

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDFPQ 108
           +  H Q + F  FNLAD  I++G   +I   +    R   + + P 
Sbjct: 135 LSFHWQDYYFPAFNLADTAITLGAMGLILASLRDDRRNTTQKETPH 180


>gi|254429630|ref|ZP_05043337.1| signal peptidase II [Alcanivorax sp. DG881]
 gi|196195799|gb|EDX90758.1| signal peptidase II [Alcanivorax sp. DG881]
          Length = 181

 Score =  117 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 24/102 (23%), Positives = 45/102 (44%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   +I +     I     +    + +  +   LI  GALGN  D  + G+V+D++
Sbjct: 80  GWQRWFFTAIAVGASVMILIWLARLTAAEKLQGVALSLILAGALGNFYDRLVLGHVVDFL 139

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
             +   + F  FN+AD  I+IG  +I+ D ++   ++    D
Sbjct: 140 DFYWGDYHFPAFNIADTAITIGAGLILLDMLLGARKEPKDND 181


>gi|332992324|gb|AEF02379.1| lipoprotein signal peptidase [Alteromonas sp. SN2]
          Length = 181

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 29/103 (28%), Positives = 49/103 (47%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   +I  ++   I +  K++PK +++  + +  I  GALGNV D  ++GYVID++
Sbjct: 74  GWQRWFFTAIATVVSVVILWWLKQSPKNQTLLPVAFSFILGGALGNVYDRLVHGYVIDFL 133

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDF 106
             H     +  FN+AD  I IG  ++I D      + K     
Sbjct: 134 DFHVNNMHWPAFNIADSAIFIGAALLIIDMFKNGEKHKSADST 176


>gi|56460235|ref|YP_155516.1| lipoprotein signal peptidase [Idiomarina loihiensis L2TR]
 gi|56179245|gb|AAV81967.1| Lipoprotein signal peptidase [Idiomarina loihiensis L2TR]
          Length = 174

 Score =  117 bits (293), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 31/101 (30%), Positives = 51/101 (50%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   +I I I   +    ++NP      ++ + LI  GA+GNV D  +YGYVID+ 
Sbjct: 71  GWQRWFFTAIAIAISVVLLIWMRRNPVGLWRQNLAFSLIMAGAIGNVADRLMYGYVIDFF 130

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
            +H Q W +  FN+AD+ I+IG  +++ +      R K + 
Sbjct: 131 DVHYQGWHWPAFNVADMAITIGAALMLLEAFFDNRRDKVEN 171


>gi|90580542|ref|ZP_01236347.1| signal peptidase II [Vibrio angustum S14]
 gi|90438200|gb|EAS63386.1| signal peptidase II [Photobacterium angustum S14]
          Length = 173

 Score =  116 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 27/100 (27%), Positives = 51/100 (51%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S     +  +I   +   + +  ++ P T  I +I Y LI  GALGN+ D   +G+V+D+
Sbjct: 74  SGWQRWLFAAIAFGVCGLLMYWMRRTPATNKIANIAYALIIGGALGNLFDRMYHGFVVDF 133

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           + ++  ++ +  FN+AD  I +G  ++I D      + K 
Sbjct: 134 LDLYYGSYHWPAFNIADSAICVGAALLILDGFKSDKQAKS 173


>gi|89072555|ref|ZP_01159127.1| signal peptidase II [Photobacterium sp. SKA34]
 gi|89051659|gb|EAR57112.1| signal peptidase II [Photobacterium sp. SKA34]
          Length = 173

 Score =  115 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 27/100 (27%), Positives = 49/100 (49%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S     +  +I   +   + +  ++ P T  I +I Y LI  GALGN+ D   +G+V+D+
Sbjct: 74  SGWQRWLFAAIAFGVCGLLMYWMRRTPATNKIANIAYALIIGGALGNLFDRMYHGFVVDF 133

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           +  +   + +  FN+AD  I +G   +I D +    + K 
Sbjct: 134 LDFYYGNYHWPAFNIADSAICVGAVFLILDGLKSDKQAKS 173


>gi|209694173|ref|YP_002262101.1| lipoprotein signal peptidase [Aliivibrio salmonicida LFI1238]
 gi|208008124|emb|CAQ78266.1| lipoprotein signal peptidase [Aliivibrio salmonicida LFI1238]
          Length = 171

 Score =  115 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 30/99 (30%), Positives = 53/99 (53%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +         I I++   + +  +K P+T  + +I Y LI  GA+GNV D  ++G+V+DY
Sbjct: 73  AGWQRWFFTGIAIVVCGLLAYWMRKAPQTDKLNNIAYALIIGGAIGNVFDRLVHGFVVDY 132

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
           +  +  ++ +  FNLAD  I IG  +II D      +++
Sbjct: 133 LDFYWGSYHWPTFNLADAAICIGAGLIILDGFRSNKKEQ 171


>gi|304309976|ref|YP_003809574.1| Lipoprotein signal peptidase [gamma proteobacterium HdN1]
 gi|301795709|emb|CBL43908.1| Lipoprotein signal peptidase [gamma proteobacterium HdN1]
          Length = 182

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 24/98 (24%), Positives = 47/98 (47%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S        +I + +   +    +K P+      +   L+  GALGN++D  + GYV+D+
Sbjct: 80  SGWQRWFFAAIAVGVSVMLVQWLRKLPRDDWFMAVALSLVLGGALGNLIDRIVLGYVVDF 139

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
           +      + F  FN+AD  I++G C++  D +    ++
Sbjct: 140 LDFFWSGYHFPAFNIADSAITVGACMLGLDILRQTRKK 177


>gi|293392920|ref|ZP_06637237.1| signal peptidase II [Serratia odorifera DSM 4582]
 gi|291424454|gb|EFE97666.1| signal peptidase II [Serratia odorifera DSM 4582]
          Length = 178

 Score =  114 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 28/105 (26%), Positives = 50/105 (47%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I+  +  +  ++  T+ + +I Y  I  GALGN+ D   +G+V+D+I
Sbjct: 71  GWQRWFFAGIAIAIVVVLLVMMYRSQATQKLNNIAYAFIIGGALGNLFDRLWHGFVVDFI 130

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDFPQ 108
             +   W +  FNLAD FI +G  +I+ +  +   ++       Q
Sbjct: 131 DFYVGNWHYPTFNLADSFICVGAAMIVLEGFLPASKRASDSQNKQ 175


>gi|89093563|ref|ZP_01166511.1| Signal peptidase II [Oceanospirillum sp. MED92]
 gi|89082253|gb|EAR61477.1| Signal peptidase II [Oceanospirillum sp. MED92]
          Length = 182

 Score =  114 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 28/99 (28%), Positives = 51/99 (51%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  V I + +   +     ++P+      I    I  GA+GN+ D  ++GYV+D+I
Sbjct: 72  GWQRWFFVGIAVAVSVALIIWLARSPRKLWWLGIALASILGGAIGNLYDRAVHGYVVDFI 131

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
            +H + + F  FN+AD  I+IG  ++I D + L+ ++K 
Sbjct: 132 SVHYENYFFPAFNIADTAITIGAVVLILDMLFLEGKRKA 170


>gi|311693404|gb|ADP96277.1| lipoprotein signal peptidase [marine bacterium HP15]
          Length = 174

 Score =  114 bits (286), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 29/94 (30%), Positives = 50/94 (53%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +       V++ +++   + +  K   + ++   I  +LI  GALGNV D  ++GYV+D+
Sbjct: 69  AGWQRWFFVTLALVVSVVLIYWLKNLQRHETWTAIAIVLILGGALGNVYDRVVHGYVVDF 128

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIIL 96
           +  + Q W F  FNLAD  I+IG  ++I D    
Sbjct: 129 LHFYWQDWHFPAFNLADTAITIGAAMMILDMFRK 162


>gi|110833321|ref|YP_692180.1| signal peptidase II [Alcanivorax borkumensis SK2]
 gi|110646432|emb|CAL15908.1| signal peptidase II [Alcanivorax borkumensis SK2]
          Length = 170

 Score =  113 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 22/102 (21%), Positives = 46/102 (45%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   +I +     I     +    + +  +   LI  GALGN  D  + G+V+D++
Sbjct: 69  GWQRWFFTAIAVGASVMILIWLARLTAAEKLQGVALSLILAGALGNFYDRLVLGHVVDFL 128

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
             +   + F  FN+AD  I++G  +I+ + ++   R++   +
Sbjct: 129 DFYWGDYHFPAFNIADTAITLGAALILLEMLLSAKRERKNNE 170


>gi|59711075|ref|YP_203851.1| lipoprotein signal peptidase [Vibrio fischeri ES114]
 gi|197335951|ref|YP_002155223.1| signal peptidase II [Vibrio fischeri MJ11]
 gi|59479176|gb|AAW84963.1| prolipoprotein signal peptidase (signal peptidase II) [Vibrio
           fischeri ES114]
 gi|197317441|gb|ACH66888.1| signal peptidase II [Vibrio fischeri MJ11]
          Length = 171

 Score =  113 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 29/99 (29%), Positives = 51/99 (51%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +         I I +   + +  +K P+   + +I Y LI  GA+GNV D  ++G+V+DY
Sbjct: 73  AGWQRWFFTGIAISVCGLLVYWMRKAPQKDKLNNIAYALIIGGAIGNVFDRLVHGFVVDY 132

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
           +  +   + +  FNLAD  I IG  +II D +    +++
Sbjct: 133 LDFYWGNYHWPAFNLADAAICIGAGLIILDGLRSGKKEQ 171


>gi|290474751|ref|YP_003467631.1| prolipoprotein signal peptidase (SPase II) [Xenorhabdus bovienii
           SS-2004]
 gi|289174064|emb|CBJ80851.1| prolipoprotein signal peptidase (SPase II) [Xenorhabdus bovienii
           SS-2004]
          Length = 169

 Score =  113 bits (285), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 27/98 (27%), Positives = 48/98 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    + I+I A +  +  ++   + + +  Y L+  GALGN+ D  ++G+V+D+I
Sbjct: 66  GWQRWFFALVAIIISAVLLVMMYRSSAKQKLSNAAYALVIGGALGNLFDRLVHGFVVDFI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
             +   W +  FN+AD  I IG   II +  I    +K
Sbjct: 126 DFYVGEWHWPTFNIADSAICIGAAFIIIESFISPDDKK 163


>gi|121606120|ref|YP_983449.1| lipoprotein signal peptidase [Polaromonas naphthalenivorans CJ2]
 gi|120595089|gb|ABM38528.1| signal peptidase II, Aspartic peptidase, MEROPS family A08
           [Polaromonas naphthalenivorans CJ2]
          Length = 179

 Score =  113 bits (284), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 32/99 (32%), Positives = 51/99 (51%), Gaps = 1/99 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S         I  L   FI ++  K+   + +F +    I  GA+GNV+D  L+GYV+D+
Sbjct: 82  SGWQRWFFTGIGALAAVFIIWML-KSHPGQKLFSLAMACILGGAIGNVIDRTLHGYVVDF 140

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
           +  H   W F  FN+AD  I+IG   +I D+++   R +
Sbjct: 141 LDFHYGNWHFPAFNIADSAITIGAICLILDEVLRVRRSR 179


>gi|85712278|ref|ZP_01043329.1| Lipoprotein signal peptidase [Idiomarina baltica OS145]
 gi|85693905|gb|EAQ31852.1| Lipoprotein signal peptidase [Idiomarina baltica OS145]
          Length = 177

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 27/105 (25%), Positives = 51/105 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I + +   +    ++N  +    ++ + LI  GA+GNV D  L+GYVID++
Sbjct: 73  GWQRWFFTLIAVAVSVVLLIWLRRNDVSFWRQNLSFSLILAGAIGNVTDRFLFGYVIDFL 132

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDFPQ 108
            +H Q W +  FN+AD  I++G  +++ +  I   R   +    +
Sbjct: 133 DVHYQGWHWPAFNVADCAITLGAILMLLEAFIDNRRDPEETQGKE 177


>gi|332283968|ref|YP_004415879.1| lipoprotein signal peptidase [Pusillimonas sp. T7-7]
 gi|330427921|gb|AEC19255.1| lipoprotein signal peptidase [Pusillimonas sp. T7-7]
          Length = 182

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 29/101 (28%), Positives = 57/101 (56%), Gaps = 1/101 (0%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
                 +  +I +  I  I  + +++P+ + +F      I  GA+GNV+D   +G+VID+
Sbjct: 78  QGWQRWLFTAIALGAIGLIVHLLRRSPE-QRLFCASLTCILGGAIGNVIDRIQHGHVIDF 136

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
           ++ +  +W F  FN+AD+ I+ G  +++ D+I+   R+K K
Sbjct: 137 LLFYWDSWYFPAFNIADIAITCGAILLVLDEILRMRREKRK 177


>gi|77359866|ref|YP_339441.1| lipoprotein signal peptidase (SPase II)(prolipoprotein signal
           peptidase) [Pseudoalteromonas haloplanktis TAC125]
 gi|123587347|sp|Q3IEA1|LSPA_PSEHT RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|76874777|emb|CAI85998.1| lipoprotein signal peptidase (SPase II)(Prolipoprotein signal
           peptidase) [Pseudoalteromonas haloplanktis TAC125]
          Length = 166

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 32/101 (31%), Positives = 51/101 (50%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                 L +I I I   + +  K+ P T  +    Y L+  GA+GN+ D   YGYVID+I
Sbjct: 66  GWQRWFLSAIAIAISGLLVWWLKRLPATNKVLCAAYSLVLAGAIGNLYDRIAYGYVIDFI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
            +  +   F VFN+AD  I IG  ++++D    +  ++ K 
Sbjct: 126 HVFYKNSHFPVFNVADCAICIGAALLLFDAFTGESPKEHKA 166


>gi|170725653|ref|YP_001759679.1| lipoprotein signal peptidase [Shewanella woodyi ATCC 51908]
 gi|226801499|sp|B1KIT6|LSPA_SHEWM RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|169811000|gb|ACA85584.1| lipoprotein signal peptidase [Shewanella woodyi ATCC 51908]
          Length = 176

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 29/100 (29%), Positives = 48/100 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    + +     +    +K P+     ++ Y L+  GALGN++D   +GYV+D++
Sbjct: 66  GWQRWFFTFVAVGFSTLLTIWLRKQPRQMWRLNLAYTLVIGGALGNLIDRLQHGYVVDFL 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
             +  T  F  FN+AD  I +G  +II D II +   K K
Sbjct: 126 HFYWNTSHFPAFNIADSAICVGAALIIIDSIITERDDKKK 165


>gi|222839562|gb|EEE77899.1| predicted protein [Populus trichocarpa]
          Length = 290

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 30/98 (30%), Positives = 50/98 (51%), Gaps = 1/98 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                + V I +     I +  +K+P  + +F      I  GA+GNVVD   +GYV+D++
Sbjct: 192 GWQRWLFVGIGVAATLLIVWQLRKHP-GQKLFCFSLASILGGAIGNVVDRLQHGYVVDFL 250

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
             +     F  FN AD+ IS+G  ++I D+++   R K
Sbjct: 251 DFYWGRSHFPAFNAADIAISVGAGLLILDEVLRARRAK 288


>gi|330447395|ref|ZP_08311044.1| signal peptidase II [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
 gi|328491586|dbj|GAA05541.1| signal peptidase II [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
          Length = 174

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 27/101 (26%), Positives = 45/101 (44%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S     +   I   +   + +  ++ P T  I +  Y LI  GA GN+ D   +G+V+D+
Sbjct: 74  SGWQRWLFAVIAFGVCGLLMYWMRRTPATNKIANCAYALIIGGAFGNLFDRMYHGFVVDF 133

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
           +      + F  FN+AD  I IG  ++I D        K +
Sbjct: 134 LDFFYGDYHFPAFNVADSAICIGAALLILDGFKSDKAAKDQ 174


>gi|148978534|ref|ZP_01814986.1| lipoprotein signal peptidase [Vibrionales bacterium SWAT-3]
 gi|145962323|gb|EDK27604.1| lipoprotein signal peptidase [Vibrionales bacterium SWAT-3]
          Length = 103

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 31/99 (31%), Positives = 50/99 (50%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S     +   I   +   + +   K P T+   +I Y +I  GA+GNV D  ++G+V+DY
Sbjct: 5   SGWQRWLFTGIAFAVTGMLTYWMSKLPATEKWNNIAYAIILGGAVGNVFDRVVHGFVVDY 64

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
           +  +  T+ +  FNLAD+ I IG  +II D    +   K
Sbjct: 65  LDFYWGTYHWPAFNLADMGICIGAAMIILDGFRKKDESK 103


>gi|84503221|ref|ZP_01001306.1| signal peptidase II [Oceanicola batsensis HTCC2597]
 gi|84388462|gb|EAQ01411.1| signal peptidase II [Oceanicola batsensis HTCC2597]
          Length = 166

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 29/105 (27%), Positives = 50/105 (47%), Gaps = 3/105 (2%)

Query: 1   MLSNVSPTI-LVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYV 59
           ML  + P   L+++  +I+A++     + P    +      LI  GALGNV+D   Y  V
Sbjct: 55  MLGGIVPWWGLIALAGVIVAWLLIWLWRAP--DRLTAAALGLIIGGALGNVLDRLRYQAV 112

Query: 60  IDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
            D++  H  T+ +  FNLAD+ I  G  ++ +D       +  + 
Sbjct: 113 PDFLDFHYGTYHWPSFNLADVAIFCGAALLFWDSFRSAQNKPERN 157


>gi|308048501|ref|YP_003912067.1| signal peptidase II [Ferrimonas balearica DSM 9799]
 gi|307630691|gb|ADN74993.1| signal peptidase II [Ferrimonas balearica DSM 9799]
          Length = 174

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 27/99 (27%), Positives = 46/99 (46%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                      + + A + F+ +         ++ Y LI  GA+GN++D  LYGYVID+I
Sbjct: 74  GWQRWGFAVFALAVSAGLLFMLRTQSAGLKRLNLSYALILGGAIGNLIDRVLYGYVIDFI 133

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
             +   W +  FN+AD  I +G  ++I D  +     + 
Sbjct: 134 DFYVGNWHWPAFNIADSAICVGAGLMILDAFLQPKHTEE 172


>gi|332762340|gb|EGJ92607.1| signal peptidase II [Shigella flexneri 2747-71]
          Length = 195

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 29/102 (28%), Positives = 47/102 (46%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I   +  +  ++  T+ + +I Y LI  GALGN+ D   +G+V+D I
Sbjct: 66  GWQRWFFAGIAIGISVLLAVMMYRSKATQKLNNIAYALIIGGALGNLFDRLWHGFVVDMI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
             +   W FA FNLAD  I +G  +I+ +  +    +     
Sbjct: 126 DFYVGDWHFATFNLADTAICVGAALIVLEGFLPSKAKNNNKS 167


>gi|221135354|ref|ZP_03561657.1| signal peptidase II [Glaciecola sp. HTCC2999]
          Length = 187

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 25/103 (24%), Positives = 53/103 (51%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   +I  ++   I +   ++P+++ +  I +  I  GA+GN+ D  ++GYV+D++
Sbjct: 83  GWQRYFFTAIAAIVSCVIVWWLYQSPRSQRLLPIAFAFILGGAIGNLYDRLVHGYVVDFL 142

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDF 106
             + +++ +  FN+AD  I IG  ++I D  I +   + K   
Sbjct: 143 HFYYESFHYPAFNIADSVIFIGAGLLILDMFINKDEDQPKESS 185


>gi|300724588|ref|YP_003713913.1| prolipoprotein signal peptidase [Xenorhabdus nematophila ATCC
           19061]
 gi|297631130|emb|CBJ91819.1| prolipoprotein signal peptidase (SPase II) [Xenorhabdus nematophila
           ATCC 19061]
          Length = 168

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 27/99 (27%), Positives = 49/99 (49%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    + I I+  +  +  ++   + + +I Y L+  GALGN+ D  ++G+V+D+I
Sbjct: 66  GWQRWFFALVAIAIVTVLLVMMYRSSARQKLSNIAYALVIGGALGNLFDRLVHGFVVDFI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
             +   W +  FN+AD  I IG  +II +  I    +K 
Sbjct: 126 DFYVGEWHWPTFNIADTAICIGAALIIIESFINPDDKKA 164


>gi|153801887|ref|ZP_01956473.1| signal peptidase II [Vibrio cholerae MZO-3]
 gi|124122598|gb|EAY41341.1| signal peptidase II [Vibrio cholerae MZO-3]
          Length = 171

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 28/95 (29%), Positives = 48/95 (50%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +   I  ++   + +  ++ P +    +I Y LI  GA+GNV D  ++G+V+DY+
Sbjct: 71  GWQRWLFTGIAFVVTGMLAYWMRRLPASDKWNNIAYALIIGGAVGNVFDRIVHGFVVDYL 130

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
             +  T+ +  FNLAD  I IG  +II D    + 
Sbjct: 131 DFYWGTYHWPAFNLADSAICIGAAMIILDGFRAKK 165


>gi|261212208|ref|ZP_05926494.1| lipoprotein signal peptidase [Vibrio sp. RC341]
 gi|260838816|gb|EEX65467.1| lipoprotein signal peptidase [Vibrio sp. RC341]
          Length = 172

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 29/95 (30%), Positives = 48/95 (50%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +   I  L+   + +  ++ P +    +I Y LI  GA+GNV D  ++G+V+DY+
Sbjct: 72  GWQRWLFTGIAFLVTGMLAYWMRRLPASDKWNNIAYALIIGGAVGNVFDRIVHGFVVDYL 131

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
             +  T+ +  FNLAD  I IG  +II D    + 
Sbjct: 132 DFYWGTYHWPAFNLADSAICIGAAMIILDGFRTKK 166


>gi|317493350|ref|ZP_07951772.1| signal peptidase II [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316918743|gb|EFV40080.1| signal peptidase II [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 166

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 29/96 (30%), Positives = 48/96 (50%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I   +  +  ++  T+ + +I Y LI  GALGN+ D   +G+V+D I
Sbjct: 70  GWQRWFFAGIAIGICVVLLVMMYRSSATQKLNNIAYALIIGGALGNLFDRLWHGFVVDMI 129

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
             +   W FA FNLAD  I +G  +I+ +  + + +
Sbjct: 130 DFYVGDWHFATFNLADSAICVGAALIVLEGFLPKKK 165


>gi|197283931|ref|YP_002149803.1| lipoprotein signal peptidase [Proteus mirabilis HI4320]
 gi|194681418|emb|CAR40256.1| lipoprotein signal peptidase [Proteus mirabilis HI4320]
          Length = 172

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 28/105 (26%), Positives = 48/105 (45%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I + I   +  +  KN  +  + +I Y LI  GALGN+ D  ++G+VID++
Sbjct: 67  GWQRWFFALIALAICIVLVVMMYKNKASTKLSNIAYALIIGGALGNLSDRLIHGFVIDFL 126

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDFPQ 108
             +   W +  FN+AD+ I +G  +II +          +    Q
Sbjct: 127 DFYVGDWHWPTFNIADVSICLGAGLIIIESFFPDKNASPQEANKQ 171


>gi|220936374|ref|YP_002515273.1| lipoprotein signal peptidase [Thioalkalivibrio sp. HL-EbGR7]
 gi|219997684|gb|ACL74286.1| lipoprotein signal peptidase [Thioalkalivibrio sp. HL-EbGR7]
          Length = 163

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 23/100 (23%), Positives = 44/100 (44%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S       V++      FI +  +     +        LI  GA+GNV+D   +G+VID+
Sbjct: 57  SGWQRWFFVAVAFGASIFILWWLRNLRADERWTAASLALILGGAIGNVIDRLWHGHVIDF 116

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           +  H   + +  FN+AD  I++G  +++   ++       
Sbjct: 117 LDFHYAGYHWPAFNVADAAITVGAVVLVGYSLMFARESDA 156


>gi|258620351|ref|ZP_05715389.1| Lipoprotein signal peptidase [Vibrio mimicus VM573]
 gi|258624723|ref|ZP_05719657.1| Lipoprotein signal peptidase [Vibrio mimicus VM603]
 gi|262172240|ref|ZP_06039918.1| lipoprotein signal peptidase [Vibrio mimicus MB-451]
 gi|262401618|ref|ZP_06078184.1| lipoprotein signal peptidase [Vibrio sp. RC586]
 gi|258583010|gb|EEW07825.1| Lipoprotein signal peptidase [Vibrio mimicus VM603]
 gi|258587230|gb|EEW11941.1| Lipoprotein signal peptidase [Vibrio mimicus VM573]
 gi|261893316|gb|EEY39302.1| lipoprotein signal peptidase [Vibrio mimicus MB-451]
 gi|262352035|gb|EEZ01165.1| lipoprotein signal peptidase [Vibrio sp. RC586]
          Length = 171

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 29/95 (30%), Positives = 49/95 (51%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +   I  ++   + +  ++ P T    +I Y LI  GA+GNV D  ++G+V+DY+
Sbjct: 71  GWQRWLFTGIAFVVTGMLAYWMRRLPATDKWNNIAYALIIGGAVGNVFDRIVHGFVVDYL 130

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
             +  T+ +  FNLAD  I IG  +II D  + + 
Sbjct: 131 DFYWGTYHWPAFNLADSAICIGAAMIILDGFLAKK 165


>gi|227358200|ref|ZP_03842541.1| lipoprotein signal peptidase [Proteus mirabilis ATCC 29906]
 gi|227161536|gb|EEI46573.1| lipoprotein signal peptidase [Proteus mirabilis ATCC 29906]
          Length = 171

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 28/105 (26%), Positives = 48/105 (45%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I + I   +  +  KN  +  + +I Y LI  GALGN+ D  ++G+VID++
Sbjct: 66  GWQRWFFALIALAICIVLVVMMYKNKASAKLSNIAYALIIGGALGNLSDRLIHGFVIDFL 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDFPQ 108
             +   W +  FN+AD+ I +G  +II +          +    Q
Sbjct: 126 DFYVGDWHWPTFNIADVSICLGAGLIIIESFFPDKNASPQETNKQ 170


>gi|88858002|ref|ZP_01132644.1| lipoprotein signal peptidase (SPase II)(Prolipoprotein signal
           peptidase) [Pseudoalteromonas tunicata D2]
 gi|88819619|gb|EAR29432.1| lipoprotein signal peptidase (SPase II)(Prolipoprotein signal
           peptidase) [Pseudoalteromonas tunicata D2]
          Length = 165

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 33/102 (32%), Positives = 48/102 (47%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I + I   + +  KK P    +    Y L+  GALGN+ D   YGYVID+I
Sbjct: 64  GWQRWFFSIIALSISVLLTWWLKKLPAKNIVLCSAYSLVLAGALGNLYDRLTYGYVIDFI 123

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
            ++   W F  FN+AD  I IG  +++ D    Q  ++ K D
Sbjct: 124 HVYYDNWHFPAFNIADSAICIGAGLLLLDAFRDQKSEELKHD 165


>gi|315126085|ref|YP_004068088.1| lipoprotein signal peptidase (SPase II)(prolipoprotein signal
           peptidase) [Pseudoalteromonas sp. SM9913]
 gi|315014599|gb|ADT67937.1| lipoprotein signal peptidase (SPase II)(prolipoprotein signal
           peptidase) [Pseudoalteromonas sp. SM9913]
          Length = 166

 Score =  110 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 30/101 (29%), Positives = 52/101 (51%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                 L +I I I   + +  K+ P +  +    Y L+  GA+GN+ D   YGYVID++
Sbjct: 66  GWQRWFLSAIAIAISCLLVWWLKRLPASNKVLCGAYSLVLAGAIGNLYDRIAYGYVIDFL 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
            +  +   F VFN+AD  I IG  ++++D    ++ ++ K 
Sbjct: 126 HVFYEDSHFPVFNIADCAICIGAALLLFDAFTGENPKEHKA 166


>gi|332532158|ref|ZP_08408041.1| lipoprotein signal peptidase [Pseudoalteromonas haloplanktis
           ANT/505]
 gi|332038499|gb|EGI74943.1| lipoprotein signal peptidase [Pseudoalteromonas haloplanktis
           ANT/505]
          Length = 166

 Score =  110 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 32/101 (31%), Positives = 52/101 (51%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                 L +I + I A + +  K+ P T  +    Y L+  GA+GN+ D   YGYVID+I
Sbjct: 66  GWQRWFLSAIAVAISALLVWWLKRLPATNKVLCGAYALVLAGAIGNLYDRIAYGYVIDFI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
            +  +   F VFN+AD  I IG  ++++D    +  ++ K 
Sbjct: 126 HVFYKDSHFPVFNIADCAICIGAALLLFDAFTGESPKEHKA 166


>gi|153826771|ref|ZP_01979438.1| signal peptidase II [Vibrio cholerae MZO-2]
 gi|229519957|ref|ZP_04409387.1| lipoprotein signal peptidase [Vibrio cholerae TM 11079-80]
 gi|149739422|gb|EDM53662.1| signal peptidase II [Vibrio cholerae MZO-2]
 gi|229343009|gb|EEO07997.1| lipoprotein signal peptidase [Vibrio cholerae TM 11079-80]
          Length = 171

 Score =  110 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 28/95 (29%), Positives = 48/95 (50%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +   I  ++   + +  ++ P +    +I Y LI  GA+GNV D  ++G+V+DY+
Sbjct: 71  GWQRWLFTGIAFVVTGMLAYWMRRLPASDKWNNIAYALIIGGAVGNVFDRIVHGFVVDYL 130

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
             +  T+ +  FNLAD  I IG  +II D    + 
Sbjct: 131 DFYWGTYHWPAFNLADSAICIGAAMIILDGFRAKK 165


>gi|89900224|ref|YP_522695.1| lipoprotein signal peptidase [Rhodoferax ferrireducens T118]
 gi|89344961|gb|ABD69164.1| signal peptidase II. Aspartic peptidase. MEROPS family A08
           [Rhodoferax ferrireducens T118]
          Length = 169

 Score =  110 bits (276), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 48/97 (49%), Gaps = 1/97 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S         I +L    I ++  K+   + +F      I  GA+GNV+D   +GYV+D+
Sbjct: 72  SGWQRWFFTVIGVLAAGLILWLL-KSHAGQRLFAFSMACILGGAIGNVIDRVRFGYVVDF 130

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
           +  H   W F  FN+AD  I++G   +I D+++   R
Sbjct: 131 LDFHWHGWHFPAFNVADSAITVGAACLILDELLRVRR 167


>gi|225077388|ref|ZP_03720587.1| hypothetical protein NEIFLAOT_02449 [Neisseria flavescens
           NRL30031/H210]
 gi|224951272|gb|EEG32481.1| hypothetical protein NEIFLAOT_02449 [Neisseria flavescens
           NRL30031/H210]
          Length = 495

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 23/95 (24%), Positives = 51/95 (53%), Gaps = 1/95 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + + ++I  ++     ++   +    +G  +I  GA+GNVVD  ++G+V+D++
Sbjct: 66  GWQKFFFLGLAVVISLYLARAILRDEFGRW-GKLGAAMIIGGAIGNVVDRLIHGHVVDFL 124

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
           + + Q W +  FN+AD FI +G   ++ D ++ + 
Sbjct: 125 LFYWQNWFYPAFNIADSFICVGAVCLVLDGLLHKK 159


>gi|148653690|ref|YP_001280783.1| lipoprotein signal peptidase [Psychrobacter sp. PRwf-1]
 gi|148572774|gb|ABQ94833.1| lipoprotein signal peptidase [Psychrobacter sp. PRwf-1]
          Length = 202

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 27/101 (26%), Positives = 52/101 (51%), Gaps = 1/101 (0%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    + + +  F+     + P+   + ++G  LI  GA+GN++D    G VID+I
Sbjct: 99  GWQKWFFAGLSLAMSVFLVVYLTRAPRQAKLLNVGLALILGGAIGNLIDRVRIGKVIDFI 158

Query: 64  MIHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
            +H    W + +FN+AD+ I +G  I++ D + L+ ++  K
Sbjct: 159 HVHYADVWHYPIFNIADIAICVGVAIVVIDMLFLEGKRNAK 199


>gi|332140402|ref|YP_004426140.1| lipoprotein signal peptidase [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|332141927|ref|YP_004427665.1| lipoprotein signal peptidase [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|238058041|sp|B4RVP1|LSPA_ALTMD RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|327550424|gb|AEA97142.1| lipoprotein signal peptidase [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327551949|gb|AEA98667.1| lipoprotein signal peptidase [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 182

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 26/101 (25%), Positives = 52/101 (51%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   +I +++   I +  K++P+++ +  + +  I  GALGNV D  ++GYVID++
Sbjct: 66  GWQRWFFTAIAVVVSVVILWWLKQSPRSQKMLPVAFAFILGGALGNVYDRLVHGYVIDFL 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
             +   + +  FN+AD  I IG  ++I D      ++  + 
Sbjct: 126 DFYVNNYHWPAFNIADSAIFIGAALLIIDMFKNGDKKSEEN 166


>gi|289209714|ref|YP_003461780.1| lipoprotein signal peptidase [Thioalkalivibrio sp. K90mix]
 gi|288945345|gb|ADC73044.1| lipoprotein signal peptidase [Thioalkalivibrio sp. K90mix]
          Length = 169

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 24/105 (22%), Positives = 45/105 (42%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
           +     L  + ++I   I +   + P+          L+  GA+GN++D   +G VID++
Sbjct: 65  DWGRWFLSGVAVVIGLLILWWLARLPRQARWSVAALGLVLGGAIGNLIDRIAHGRVIDFL 124

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDFPQ 108
             H   + +  FN+AD+ I +G   +I    I         D  +
Sbjct: 125 DFHWAGYHWPAFNVADMAIVVGAITLIVATFIEGDHSGSPTDSRE 169


>gi|307543907|ref|YP_003896386.1| lipoprotein signal peptidase [Halomonas elongata DSM 2581]
 gi|307215931|emb|CBV41201.1| lipoprotein signal peptidase [Halomonas elongata DSM 2581]
          Length = 207

 Score =  110 bits (275), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 44/94 (46%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   +I +     +    ++    + I      L+  GALGN+ D  ++GYV+D++
Sbjct: 106 GWQRWFFAAIAVAASVGLTIWMRRLHSDEKILGASLALVIGGALGNLYDRLVHGYVVDFL 165

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQ 97
             H   W +  FN+AD+ I++G   +I + +  +
Sbjct: 166 SFHLAGWYYPAFNVADIGITLGAIGLIVESLFGE 199


>gi|320157348|ref|YP_004189727.1| lipoprotein signal peptidase [Vibrio vulnificus MO6-24/O]
 gi|319932660|gb|ADV87524.1| lipoprotein signal peptidase [Vibrio vulnificus MO6-24/O]
          Length = 168

 Score =  110 bits (275), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 27/99 (27%), Positives = 50/99 (50%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +     +   I  ++   + +   K P  +   ++ Y +I  GA+GNV D  ++G+V+DY
Sbjct: 70  AGWQRWLFTGIAFVVTGLLTYWMSKLPAAEKWNNVAYAMIIGGAIGNVFDRMVHGFVVDY 129

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
           +  +  T+ +  FNLAD  I +G  +II D    +  +K
Sbjct: 130 LDFYWGTYHWPAFNLADTAICLGAAMIILDGFRKKEEEK 168


>gi|27363970|ref|NP_759498.1| lipoprotein signal peptidase [Vibrio vulnificus CMCP6]
 gi|37678872|ref|NP_933481.1| lipoprotein signal peptidase [Vibrio vulnificus YJ016]
 gi|31076770|sp|Q8DES8|LSPA_VIBVU RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|52000818|sp|Q7MNM7|LSPA_VIBVY RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|27360087|gb|AAO09025.1| signal peptidase II [Vibrio vulnificus CMCP6]
 gi|37197613|dbj|BAC93452.1| lipoprotein signal peptidase [Vibrio vulnificus YJ016]
          Length = 168

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 27/99 (27%), Positives = 50/99 (50%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +     +   I  ++   + +   K P  +   ++ Y +I  GA+GNV D  ++G+V+DY
Sbjct: 70  AGWQRWLFTGIAFVVTGLLTYWMSKLPAAEKWNNVAYAMIIGGAIGNVFDRMVHGFVVDY 129

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
           +  +  T+ +  FNLAD  I +G  +II D    +  +K
Sbjct: 130 LDFYWGTYHWPAFNLADTAICLGAAMIILDGFRKKEEEK 168


>gi|94501194|ref|ZP_01307716.1| signal peptidase II [Oceanobacter sp. RED65]
 gi|94426621|gb|EAT11607.1| signal peptidase II [Oceanobacter sp. RED65]
          Length = 171

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 28/100 (28%), Positives = 45/100 (45%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S         I I +   +     K    +        L+  GA+GN+ D  +YG+VID+
Sbjct: 72  SGWQRWFFTIIAIGVSTVLCIWLMKLKPEEKWLSAALCLVIGGAIGNLYDRLVYGHVIDF 131

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           I +H     F  FN+AD  I+IG  ++I D +  Q  ++ 
Sbjct: 132 IHVHWDKHYFPAFNIADSAITIGAIMLIIDSLFFQQDKRK 171


>gi|332970223|gb|EGK09216.1| signal peptidase II [Psychrobacter sp. 1501(2011)]
          Length = 197

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 27/101 (26%), Positives = 51/101 (50%), Gaps = 1/101 (0%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    + + +  F+     + P+   + ++G  LI  GA+GN++D    G VID+I
Sbjct: 94  GWQKWFFAGLSLAMSIFLVIYLTRAPRQAKLLNVGLALILGGAIGNLIDRVRIGKVIDFI 153

Query: 64  MIHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
            +H    W + +FN+AD+ I IG  I++ D +  + ++  K
Sbjct: 154 HVHYADVWHYPIFNIADIAICIGVAIVVIDMLFFESKRNAK 194


>gi|294139774|ref|YP_003555752.1| lipoprotein signal peptidase [Shewanella violacea DSS12]
 gi|293326243|dbj|BAJ00974.1| lipoprotein signal peptidase [Shewanella violacea DSS12]
          Length = 167

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 30/100 (30%), Positives = 49/100 (49%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +   I +   A + F  +K P+     ++ Y L+  GALGN++D   +GYV+D++
Sbjct: 57  GWQKWLFTFIAVGFSALLTFWLRKQPRQMWRLNLAYTLVIGGALGNLIDRLQHGYVVDFL 116

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
             +     F  FN+AD  I +G  +II D  I    +K K
Sbjct: 117 DFYWDKSHFPAFNIADSAICVGAVLIILDSFISDRLEKQK 156


>gi|194290607|ref|YP_002006514.1| lipoprotein signal peptidase [Cupriavidus taiwanensis LMG 19424]
 gi|238692770|sp|B3R6E9|LSPA_CUPTR RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|193224442|emb|CAQ70453.1| prolipoprotein signal peptidase (SPase II) [Cupriavidus taiwanensis
           LMG 19424]
          Length = 176

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 52/97 (53%), Gaps = 1/97 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    + +++ AFI ++  ++   + +F     LI  GA+GNVVD  +YG+VID++
Sbjct: 81  GWQRWFFTGLGVVVGAFIVWLLYRH-TGQRLFCFAVSLILGGAVGNVVDRVIYGHVIDFL 139

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
             +   + +  FN+AD  I++G  ++I D++    + 
Sbjct: 140 DFYVGRYHWPAFNVADCAITVGAVLLIVDELRRVRKH 176


>gi|221068811|ref|ZP_03544916.1| lipoprotein signal peptidase [Comamonas testosteroni KF-1]
 gi|220713834|gb|EED69202.1| lipoprotein signal peptidase [Comamonas testosteroni KF-1]
          Length = 171

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 30/103 (29%), Positives = 57/103 (55%), Gaps = 1/103 (0%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S     + V+I ++    I +  +K+P  + +F +    I  GA+GNVVD   +GYV+D+
Sbjct: 70  SGWQRWLFVAIGVIATVLIVWQLRKHP-GEKMFCLSLSSILGGAIGNVVDRLQHGYVVDF 128

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
           +  +  +  F  FN+AD+ I++G  ++I D+++   R K +  
Sbjct: 129 LDFYWGSSHFPAFNVADMGITLGAILLILDELLRARRAKARTS 171


>gi|113869001|ref|YP_727490.1| lipoprotein signal peptidase [Ralstonia eutropha H16]
 gi|123133655|sp|Q0K799|LSPA_RALEH RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|113527777|emb|CAJ94122.1| lipoprotein signal peptidase II [Ralstonia eutropha H16]
          Length = 175

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 53/97 (54%), Gaps = 1/97 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    + I++ AFI ++  ++   + +F     LI  GA+GNV+D  +YG+V+D++
Sbjct: 80  GWQRWFFTGLGIVVGAFIVWLLYRH-TGQRLFCFAVSLILGGAVGNVIDRVVYGHVVDFL 138

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
             + + + +  FN+AD  I++G  ++I D++    R 
Sbjct: 139 DFYVRNYHWPAFNVADCAITVGAVLLIVDELRRVRRH 175


>gi|88707060|ref|ZP_01104756.1| Lipoprotein signal peptidase [Congregibacter litoralis KT71]
 gi|88698710|gb|EAQ95833.1| Lipoprotein signal peptidase [Congregibacter litoralis KT71]
          Length = 154

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 29/94 (30%), Positives = 48/94 (51%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   ++ + + A I +  K+    +    +   L+  GALGN+VD    GYV+D+I
Sbjct: 49  GWQRWFFATLALAVSAMIVYWLKELKPRQWQLSLALALVLGGALGNLVDRIHLGYVVDFI 108

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQ 97
            +H + W F  FN+AD  IS+G  +II D ++  
Sbjct: 109 SVHYRDWYFPTFNVADAAISVGAFLIILDSLVNS 142


>gi|145297755|ref|YP_001140596.1| lipoprotein signal peptidase [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142850527|gb|ABO88848.1| lipoprotein signal peptidase [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 170

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 28/99 (28%), Positives = 46/99 (46%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    +   I   +    +K   T+    I Y LI  GALGNV D  + G+V+D++
Sbjct: 71  GWQRWFFAVLAFAICGLLIHWLRKQSVTQRWSGIAYSLIIGGALGNVFDRLVLGHVVDFL 130

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
             + Q   +  FNLAD FI IG  +I+ +    + +++ 
Sbjct: 131 DFYWQRSHWPAFNLADSFIFIGAVMIVLEGFRSEKKKEA 169


>gi|163750659|ref|ZP_02157896.1| lipoprotein signal peptidase [Shewanella benthica KT99]
 gi|161329654|gb|EDQ00645.1| lipoprotein signal peptidase [Shewanella benthica KT99]
          Length = 176

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 29/100 (29%), Positives = 47/100 (47%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +   I +     + F  +K P      ++ Y L+  GALGN++D   +GYV+D++
Sbjct: 66  GWQKWLFTFIAVGFSVLLTFWLRKQPAQMWRLNLAYTLVIAGALGNLIDRLQHGYVVDFL 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
             +     F  FN+AD  I +G  +II D  I    +K K
Sbjct: 126 DFYWNKSHFPAFNIADSAICVGAALIIVDSFISDRLEKQK 165


>gi|171464054|ref|YP_001798167.1| lipoprotein signal peptidase [Polynucleobacter necessarius subsp.
           necessarius STIR1]
 gi|238058060|sp|B1XW26|LSPA_POLNS RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|171193592|gb|ACB44553.1| lipoprotein signal peptidase [Polynucleobacter necessarius subsp.
           necessarius STIR1]
          Length = 163

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 28/95 (29%), Positives = 47/95 (49%), Gaps = 1/95 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S         + +    +I ++  K+     +  I   LI  GALGNV+D  +YG V+D+
Sbjct: 62  SGWQRWFFTVLGLAASIYIIWMLYKSQSD-KLLCIALSLILGGALGNVLDRVMYGAVVDF 120

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQ 97
           I +H   W +  FN+AD  I +G  +II+ ++   
Sbjct: 121 IDLHYANWHWPAFNIADSAICVGAALIIWGELRKS 155


>gi|77165739|ref|YP_344264.1| Signal peptidase II [Nitrosococcus oceani ATCC 19707]
 gi|254433235|ref|ZP_05046743.1| signal peptidase II [Nitrosococcus oceani AFC27]
 gi|76884053|gb|ABA58734.1| signal peptidase II, Aspartic peptidase, MEROPS family A08
           [Nitrosococcus oceani ATCC 19707]
 gi|207089568|gb|EDZ66839.1| signal peptidase II [Nitrosococcus oceani AFC27]
          Length = 154

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 24/95 (25%), Positives = 44/95 (46%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  V + + +   +     +         +   LI  GALGNV+D   +G+VID+I
Sbjct: 58  GWQRWFFVGLALTVSVGLVVWLYRLGTHALWEGMAVALILGGALGNVIDRLWHGHVIDFI 117

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
            ++ Q W +  FN+AD  I++G  ++I   +  + 
Sbjct: 118 DLYYQGWHWPAFNIADSAITVGAAVLIIQSLFSKP 152


>gi|260775151|ref|ZP_05884049.1| lipoprotein signal peptidase [Vibrio coralliilyticus ATCC BAA-450]
 gi|260608852|gb|EEX35014.1| lipoprotein signal peptidase [Vibrio coralliilyticus ATCC BAA-450]
          Length = 170

 Score =  108 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 29/100 (29%), Positives = 48/100 (48%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +     +   I   + A + +   K P  +   ++ Y +I  GA+GNV D  ++GYV+DY
Sbjct: 70  AGWQRWLFTGIAFAVTAMLTYWMSKLPAKEKWNNVAYAMIIGGAVGNVFDRVVHGYVVDY 129

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           +      + +  FNLAD  I IG  +II D    +  +K 
Sbjct: 130 LDFFWGDYHWPAFNLADSTICIGAAMIILDGFRKKDAEKK 169


>gi|260771133|ref|ZP_05880060.1| lipoprotein signal peptidase [Vibrio furnissii CIP 102972]
 gi|260613730|gb|EEX38922.1| lipoprotein signal peptidase [Vibrio furnissii CIP 102972]
 gi|315179261|gb|ADT86175.1| signal peptidase II [Vibrio furnissii NCTC 11218]
          Length = 168

 Score =  108 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 49/97 (50%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +     +   I   ++  + F  ++ P +    ++ Y  I  GA+GNV D  ++G+V+DY
Sbjct: 70  AGWQRWLFTGIAFAVVGLLAFWMRRLPSSDKWNNMAYAFIIGGAVGNVFDRVVHGFVVDY 129

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
           +  +  T+ +  FNLAD  I IG  +II D    + +
Sbjct: 130 LDFYWGTYHWPAFNLADSAICIGAAMIILDGFRGKKQ 166


>gi|121730025|ref|ZP_01682437.1| signal peptidase II [Vibrio cholerae V52]
 gi|147674341|ref|YP_001216178.1| lipoprotein signal peptidase [Vibrio cholerae O395]
 gi|153215131|ref|ZP_01949838.1| signal peptidase II [Vibrio cholerae 1587]
 gi|153829379|ref|ZP_01982046.1| signal peptidase II [Vibrio cholerae 623-39]
 gi|229512426|ref|ZP_04401900.1| lipoprotein signal peptidase [Vibrio cholerae TMA 21]
 gi|229525335|ref|ZP_04414740.1| lipoprotein signal peptidase [Vibrio cholerae bv. albensis VL426]
 gi|229530489|ref|ZP_04419877.1| lipoprotein signal peptidase [Vibrio cholerae 12129(1)]
 gi|254291961|ref|ZP_04962741.1| signal peptidase II [Vibrio cholerae AM-19226]
 gi|262169982|ref|ZP_06037672.1| lipoprotein signal peptidase [Vibrio cholerae RC27]
 gi|262191828|ref|ZP_06049999.1| lipoprotein signal peptidase [Vibrio cholerae CT 5369-93]
 gi|297580807|ref|ZP_06942733.1| signal peptidase II [Vibrio cholerae RC385]
 gi|172047696|sp|A5F8Z4|LSPA_VIBC3 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|121628229|gb|EAX60748.1| signal peptidase II [Vibrio cholerae V52]
 gi|124114922|gb|EAY33742.1| signal peptidase II [Vibrio cholerae 1587]
 gi|146316224|gb|ABQ20763.1| signal peptidase II [Vibrio cholerae O395]
 gi|148875162|gb|EDL73297.1| signal peptidase II [Vibrio cholerae 623-39]
 gi|150422100|gb|EDN14067.1| signal peptidase II [Vibrio cholerae AM-19226]
 gi|227012508|gb|ACP08718.1| signal peptidase II [Vibrio cholerae O395]
 gi|229332262|gb|EEN97750.1| lipoprotein signal peptidase [Vibrio cholerae 12129(1)]
 gi|229338916|gb|EEO03933.1| lipoprotein signal peptidase [Vibrio cholerae bv. albensis VL426]
 gi|229350576|gb|EEO15522.1| lipoprotein signal peptidase [Vibrio cholerae TMA 21]
 gi|262021716|gb|EEY40427.1| lipoprotein signal peptidase [Vibrio cholerae RC27]
 gi|262032315|gb|EEY50882.1| lipoprotein signal peptidase [Vibrio cholerae CT 5369-93]
 gi|297535223|gb|EFH74058.1| signal peptidase II [Vibrio cholerae RC385]
 gi|327483483|gb|AEA77890.1| Lipoprotein signal peptidase [Vibrio cholerae LMA3894-4]
          Length = 171

 Score =  108 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 28/95 (29%), Positives = 48/95 (50%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +   I  ++   + +  ++ P +    +I Y LI  GA+GNV D  ++G+V+DY+
Sbjct: 71  GWQRWLFTGIAFVVTGMLAYWMRRLPASDKWNNIAYALIIGGAVGNVFDRIVHGFVVDYL 130

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
             +  T+ +  FNLAD  I IG  +II D    + 
Sbjct: 131 DFYWGTYHWPAFNLADSTICIGAAMIILDGFRAKK 165


>gi|169632047|ref|YP_001705783.1| lipoprotein signal peptidase [Acinetobacter baumannii SDF]
 gi|238688136|sp|B0VMM0|LSPA_ACIBS RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|169150839|emb|CAO99442.1| prolipoprotein signal peptidase (Signal peptidase II.)
           [Acinetobacter baumannii]
          Length = 176

 Score =  108 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 30/102 (29%), Positives = 50/102 (49%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   S+  L+     F   + PK   +  +   LI  GALGN++D    GYV+D+I
Sbjct: 74  GWQRYFFTSLAGLVSILFVFWLLRMPKKMVVLPVAIALILGGALGNLIDRITLGYVVDFI 133

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
            ++ Q   F  FN+AD  I++GT +++ D   L+ ++    D
Sbjct: 134 HVYYQNHHFPAFNIADSAITLGTILLLIDTFFLEKQRPKNSD 175


>gi|56477954|ref|YP_159543.1| lipoprotein signal peptidase [Aromatoleum aromaticum EbN1]
 gi|56313997|emb|CAI08642.1| lipoprotein signal peptidase [Aromatoleum aromaticum EbN1]
          Length = 183

 Score =  108 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 19/106 (17%), Positives = 50/106 (47%), Gaps = 1/106 (0%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S       +++ +++  ++  +  ++ + +    + + LI  GA+GNV+D  ++G V+D+
Sbjct: 76  SGWQRWFFIALALVVCGWLLAML-RHHQHERALPLAFSLIIGGAVGNVIDRIVHGAVVDF 134

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDFPQ 108
           +  H     +  FN+AD  I++G  ++++                +
Sbjct: 135 LYFHIGRHGWPAFNVADSAITVGVAVMLWAQFRSPRDASRDSSTSE 180


>gi|73542431|ref|YP_296951.1| signal peptidase II [Ralstonia eutropha JMP134]
 gi|123624193|sp|Q46XM6|LSPA_RALEJ RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|72119844|gb|AAZ62107.1| signal peptidase II. Aspartic peptidase. MEROPS family A08
           [Ralstonia eutropha JMP134]
          Length = 176

 Score =  108 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 53/97 (54%), Gaps = 1/97 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    + +++ AFI ++  ++   + +F     LI  GA+GNVVD  +YG+VID++
Sbjct: 81  GWQRWFFTGLGLVVGAFIVWLLYRH-TGQKLFCFAVSLILGGAVGNVVDRVVYGHVIDFL 139

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
             + + + +  FN+AD  I++G  ++I D++    + 
Sbjct: 140 DFYVRNYHWPAFNVADCAITVGAVLLIVDELRRVRKH 176


>gi|91789694|ref|YP_550646.1| lipoprotein signal peptidase [Polaromonas sp. JS666]
 gi|122967428|sp|Q125P4|LSPA_POLSJ RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|91698919|gb|ABE45748.1| signal peptidase II, Aspartic peptidase, MEROPS family A08
           [Polaromonas sp. JS666]
          Length = 164

 Score =  108 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 48/97 (49%), Gaps = 1/97 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S         + I    FI ++  ++   + +F      I  GA+GNV+D  L+GYV+D+
Sbjct: 68  SGWQRWFFTGLGIAAAVFIVWLL-RSHAGQKLFSFALACILGGAVGNVIDRTLHGYVVDF 126

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
           +  H   W F  FN+AD  I+IG   ++ D++    R
Sbjct: 127 LDFHYGNWHFPAFNIADSAITIGAIFLVLDELRRVRR 163


>gi|121998614|ref|YP_001003401.1| lipoprotein signal peptidase [Halorhodospira halophila SL1]
 gi|121590019|gb|ABM62599.1| signal peptidase II, Aspartic peptidase, MEROPS family A08
           [Halorhodospira halophila SL1]
          Length = 157

 Score =  108 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 23/95 (24%), Positives = 47/95 (49%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +L  +   +  ++ +  ++   ++     G  LI  GALGN+VD    G V+D+I
Sbjct: 60  GWQRWLLAGVAAAVGVYLAYWLRRIGASQPWLSAGLALILAGALGNLVDRLRLGQVVDFI 119

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
            +H   + + +FN+AD+ I++G  ++I   +    
Sbjct: 120 HLHYAGFHWPIFNVADIAITVGAGLVIVILLFFDR 154


>gi|293611284|ref|ZP_06693582.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292826535|gb|EFF84902.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 176

 Score =  108 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 30/102 (29%), Positives = 50/102 (49%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   S+  L+     F   + PK   +  +   LI  GALGN++D    GYV+D+I
Sbjct: 74  GWQRYFFTSLAGLVSVLFVFWLMRMPKKMVVLPVAIALILGGALGNLIDRITLGYVVDFI 133

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
            ++ Q   F  FN+AD  I++GT +++ D   L+ ++    D
Sbjct: 134 HVYYQNHHFPAFNIADSAITLGTILLLIDTFFLEKQRNQNSD 175


>gi|292491027|ref|YP_003526466.1| lipoprotein signal peptidase [Nitrosococcus halophilus Nc4]
 gi|291579622|gb|ADE14079.1| lipoprotein signal peptidase [Nitrosococcus halophilus Nc4]
          Length = 158

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 25/95 (26%), Positives = 45/95 (47%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  V + + +   + F   +         +   LI  GALGNV+D   +G+VID+I
Sbjct: 62  GWQRWFFVGLALTVSIGLVFWLYRLGSNALWEAVAVALILGGALGNVIDRLWHGHVIDFI 121

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
            ++ Q W +  FN+AD  I++G  ++I   +  + 
Sbjct: 122 DLYYQGWHWPAFNIADSAITVGAALLIIQSVFGKP 156


>gi|187477908|ref|YP_785932.1| lipoprotein signal peptidase [Bordetella avium 197N]
 gi|115422494|emb|CAJ49019.1| lipoprotein signal peptidase [Bordetella avium 197N]
          Length = 171

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 23/97 (23%), Positives = 51/97 (52%), Gaps = 1/97 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   ++ ++  A I ++ ++ P           LI  GA+GNV+D  +YG+V+D++
Sbjct: 69  GWQRWFFTALGVVAAAVILWLLRRTPDQPRF-RAALTLILGGAIGNVIDRLVYGHVVDFL 127

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
           + + + W +  FN+AD+ I+ G  +++ D++     +
Sbjct: 128 LFYWKDWYYPAFNIADVAITCGAVLLVLDELFRGRGK 164


>gi|157368944|ref|YP_001476933.1| lipoprotein signal peptidase [Serratia proteamaculans 568]
 gi|167008962|sp|A8G9L5|LSPA_SERP5 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|157320708|gb|ABV39805.1| lipoprotein signal peptidase [Serratia proteamaculans 568]
          Length = 169

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 27/100 (27%), Positives = 49/100 (49%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I + I+A +  +  ++   + + +I Y  I  GALGN+ D   +G+V+D+I
Sbjct: 66  GWQRWFFAGIAVAIVAVLLVMMYRSSAQQKLNNIAYAFIIGGALGNLFDRLWHGFVVDFI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
             +   W +  FNLAD FI +G  +I+ +  +    +  K
Sbjct: 126 DFYVGNWHYPTFNLADSFICVGAAMIVLEGFLSPANKSAK 165


>gi|15640702|ref|NP_230332.1| lipoprotein signal peptidase [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121587765|ref|ZP_01677525.1| signal peptidase II [Vibrio cholerae 2740-80]
 gi|153818715|ref|ZP_01971382.1| signal peptidase II [Vibrio cholerae NCTC 8457]
 gi|227080864|ref|YP_002809415.1| signal peptidase II [Vibrio cholerae M66-2]
 gi|229505696|ref|ZP_04395206.1| lipoprotein signal peptidase [Vibrio cholerae BX 330286]
 gi|229508730|ref|ZP_04398223.1| lipoprotein signal peptidase [Vibrio cholerae B33]
 gi|229519520|ref|ZP_04408963.1| lipoprotein signal peptidase [Vibrio cholerae RC9]
 gi|229608715|ref|YP_002879363.1| lipoprotein signal peptidase [Vibrio cholerae MJ-1236]
 gi|254851015|ref|ZP_05240365.1| lipoprotein signal peptidase [Vibrio cholerae MO10]
 gi|255743858|ref|ZP_05417814.1| lipoprotein signal peptidase [Vibrio cholera CIRS 101]
 gi|262156077|ref|ZP_06029196.1| lipoprotein signal peptidase [Vibrio cholerae INDRE 91/1]
 gi|298500797|ref|ZP_07010600.1| signal peptidase (SPase) II [Vibrio cholerae MAK 757]
 gi|31076775|sp|Q9KU46|LSPA_VIBCH RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|254810455|sp|C3LST8|LSPA_VIBCM RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|9655122|gb|AAF93848.1| lipoprotein signal peptidase [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121547992|gb|EAX58072.1| signal peptidase II [Vibrio cholerae 2740-80]
 gi|126510737|gb|EAZ73331.1| signal peptidase II [Vibrio cholerae NCTC 8457]
 gi|227008752|gb|ACP04964.1| signal peptidase II [Vibrio cholerae M66-2]
 gi|229344209|gb|EEO09184.1| lipoprotein signal peptidase [Vibrio cholerae RC9]
 gi|229354254|gb|EEO19184.1| lipoprotein signal peptidase [Vibrio cholerae B33]
 gi|229357919|gb|EEO22836.1| lipoprotein signal peptidase [Vibrio cholerae BX 330286]
 gi|229371370|gb|ACQ61793.1| lipoprotein signal peptidase [Vibrio cholerae MJ-1236]
 gi|254846720|gb|EET25134.1| lipoprotein signal peptidase [Vibrio cholerae MO10]
 gi|255738489|gb|EET93878.1| lipoprotein signal peptidase [Vibrio cholera CIRS 101]
 gi|262030113|gb|EEY48758.1| lipoprotein signal peptidase [Vibrio cholerae INDRE 91/1]
 gi|297540578|gb|EFH76636.1| signal peptidase (SPase) II [Vibrio cholerae MAK 757]
          Length = 171

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 28/95 (29%), Positives = 48/95 (50%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +   I  ++   + +  ++ P +    +I Y LI  GA+GNV D  ++G+V+DY+
Sbjct: 71  GWQRWLFTGIAFVVTGMLAYWMRRLPASDKWNNIAYALIIGGAVGNVFDRIVHGFVVDYL 130

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
             +  T+ +  FNLAD  I IG  +II D    + 
Sbjct: 131 DFYWGTYHWPAFNLADSTICIGAAMIILDGFRAKK 165


>gi|169797773|ref|YP_001715566.1| lipoprotein signal peptidase [Acinetobacter baumannii AYE]
 gi|184156361|ref|YP_001844700.1| lipoprotein signal peptidase [Acinetobacter baumannii ACICU]
 gi|213155429|ref|YP_002317474.1| signal peptidase II [Acinetobacter baumannii AB0057]
 gi|215485122|ref|YP_002327363.1| signal peptidase II [Acinetobacter baumannii AB307-0294]
 gi|239503747|ref|ZP_04663057.1| lipoprotein signal peptidase [Acinetobacter baumannii AB900]
 gi|260553016|ref|ZP_05825931.1| signal peptidase II [Acinetobacter sp. RUH2624]
 gi|260557772|ref|ZP_05829986.1| signal peptidase II [Acinetobacter baumannii ATCC 19606]
 gi|301347570|ref|ZP_07228311.1| lipoprotein signal peptidase [Acinetobacter baumannii AB056]
 gi|301510771|ref|ZP_07236008.1| lipoprotein signal peptidase [Acinetobacter baumannii AB058]
 gi|301596561|ref|ZP_07241569.1| lipoprotein signal peptidase [Acinetobacter baumannii AB059]
 gi|332855724|ref|ZP_08436020.1| signal peptidase II [Acinetobacter baumannii 6013150]
 gi|332866677|ref|ZP_08437139.1| signal peptidase II [Acinetobacter baumannii 6013113]
 gi|332873531|ref|ZP_08441480.1| signal peptidase II [Acinetobacter baumannii 6014059]
 gi|226740860|sp|B7H305|LSPA_ACIB3 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|238058084|sp|A3M0S2|LSPA_ACIBT RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|169150700|emb|CAM88610.1| prolipoprotein signal peptidase (Signal peptidase II.)
           [Acinetobacter baumannii AYE]
 gi|183207955|gb|ACC55353.1| Lipoprotein signal peptidase [Acinetobacter baumannii ACICU]
 gi|193075937|gb|ABO10516.2| Signal peptidase II [Acinetobacter baumannii ATCC 17978]
 gi|213054589|gb|ACJ39491.1| signal peptidase II [Acinetobacter baumannii AB0057]
 gi|213988228|gb|ACJ58527.1| signal peptidase II [Acinetobacter baumannii AB307-0294]
 gi|260405258|gb|EEW98755.1| signal peptidase II [Acinetobacter sp. RUH2624]
 gi|260408945|gb|EEX02249.1| signal peptidase II [Acinetobacter baumannii ATCC 19606]
 gi|322506231|gb|ADX01685.1| Prolipoprotein signal peptidase [Acinetobacter baumannii 1656-2]
 gi|323516107|gb|ADX90488.1| lipoprotein signal peptidase [Acinetobacter baumannii TCDC-AB0715]
 gi|332727310|gb|EGJ58750.1| signal peptidase II [Acinetobacter baumannii 6013150]
 gi|332734446|gb|EGJ65561.1| signal peptidase II [Acinetobacter baumannii 6013113]
 gi|332738228|gb|EGJ69106.1| signal peptidase II [Acinetobacter baumannii 6014059]
          Length = 176

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 30/102 (29%), Positives = 50/102 (49%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   S+  L+     F   + PK   +  +   LI  GALGN++D    GYV+D+I
Sbjct: 74  GWQRYFFTSLAGLVSILFVFWLLRMPKKMVVLPVAIALILGGALGNLIDRITLGYVVDFI 133

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
            ++ Q   F  FN+AD  I++GT +++ D   L+ ++    D
Sbjct: 134 HVYYQNHHFPAFNIADSAITLGTILLLIDTFFLEKQRPKNSD 175


>gi|71282159|ref|YP_267926.1| signal peptidase II [Colwellia psychrerythraea 34H]
 gi|71147899|gb|AAZ28372.1| signal peptidase II [Colwellia psychrerythraea 34H]
          Length = 180

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 32/104 (30%), Positives = 49/104 (47%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I  +          K PK + +  I + LI +GA+GN++D  L+GYVID++
Sbjct: 71  GWQRWFFTGIASIASIVFLVWMAKTPKQQRLLSIAFALILSGAVGNLIDRALFGYVIDFL 130

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDFP 107
             H   + FA FN+AD  I IG  ++I++    Q   K     P
Sbjct: 131 DFHWAGYHFAAFNIADSVIFIGAALMIFESFSNQGNNKEANKEP 174


>gi|217970194|ref|YP_002355428.1| lipoprotein signal peptidase [Thauera sp. MZ1T]
 gi|217507521|gb|ACK54532.1| lipoprotein signal peptidase [Thauera sp. MZ1T]
          Length = 178

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 25/96 (26%), Positives = 46/96 (47%), Gaps = 1/96 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S         +   I A++  +   + + + +    + LI  GALGNV D  ++G V+D+
Sbjct: 73  SGWQRWFFTILAFGISAWLLTLMH-HHRHEKLLPTAFALIIGGALGNVYDRLVHGAVVDF 131

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
           +  H   WS+  FNLAD  I++G  ++++       
Sbjct: 132 LHFHYAGWSWPAFNLADSAITVGVAMMLWGQFFGPK 167


>gi|149928080|ref|ZP_01916327.1| lipoprotein signal peptidase [Limnobacter sp. MED105]
 gi|149823166|gb|EDM82403.1| lipoprotein signal peptidase [Limnobacter sp. MED105]
          Length = 186

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 23/100 (23%), Positives = 47/100 (47%), Gaps = 1/100 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +      L  + ++    I F+  ++   +         I  GA+GN++D   +G VID+
Sbjct: 81  AGWQRHFLSGVAVVASIVILFMM-RSSSHRKFAMFCLACILGGAIGNLIDRLAHGAVIDF 139

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           +  +  T+ +  FN+AD+ I++G   +I D++      K 
Sbjct: 140 LDFYVGTYHWPAFNVADVAITMGAIGLIIDELFFNKEHKA 179


>gi|300114687|ref|YP_003761262.1| lipoprotein signal peptidase [Nitrosococcus watsonii C-113]
 gi|299540624|gb|ADJ28941.1| lipoprotein signal peptidase [Nitrosococcus watsonii C-113]
          Length = 154

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 25/95 (26%), Positives = 44/95 (46%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  V +   +   + F   +         +   LI  GALGNV+D   +G+VID+I
Sbjct: 58  GWQRWFFVGLAFTVSIGLVFWLYRLGSNALWEAVAVALILGGALGNVLDRLWHGHVIDFI 117

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
            ++ Q W +  FN+AD  I++G  ++I   +  + 
Sbjct: 118 DLYYQGWHWPAFNIADSAITVGAAVLILQSLFGKP 152


>gi|325124000|gb|ADY83523.1| prolipoprotein signal peptidase (signal peptidase II)
           [Acinetobacter calcoaceticus PHEA-2]
          Length = 176

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 30/102 (29%), Positives = 50/102 (49%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   S+  L+     F   + PK   +  +   LI  GALGN++D    GYV+D+I
Sbjct: 74  GWQRYFFTSLAGLVSILFVFWLMRMPKKMVVLPVAIALILGGALGNLIDRITLGYVVDFI 133

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
            ++ Q   F  FN+AD  I++GT +++ D   L+ ++    D
Sbjct: 134 HVYYQNHHFPAFNIADSAITLGTILLLIDTFFLEKQRNQNSD 175


>gi|123440981|ref|YP_001004970.1| lipoprotein signal peptidase [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|332160246|ref|YP_004296823.1| lipoprotein signal peptidase [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|152032580|sp|A1JJE2|LSPA_YERE8 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|122087942|emb|CAL10730.1| lipoprotein signal peptidase [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|318607184|emb|CBY28682.1| lipoprotein signal peptidase [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325664476|gb|ADZ41120.1| lipoprotein signal peptidase [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330863045|emb|CBX73177.1| lipoprotein signal peptidase [Yersinia enterocolitica W22703]
          Length = 169

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 30/98 (30%), Positives = 47/98 (47%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S         I I I   +  +  ++   + + +  Y LI  GALGN+ D  ++G VID+
Sbjct: 65  SGWQRWFFAGIAIGISVLLMVLMYRSTAKQRLLNCAYALIIGGALGNLFDRMVHGAVIDF 124

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
           I  H   W F  FN+AD  I IG  ++I++  I    +
Sbjct: 125 IDFHVNNWHFPTFNIADTAICIGAALVIFEGFISPAEK 162


>gi|127512033|ref|YP_001093230.1| lipoprotein signal peptidase [Shewanella loihica PV-4]
 gi|166232878|sp|A3QBX3|LSPA_SHELP RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|126637328|gb|ABO22971.1| lipoprotein signal peptidase [Shewanella loihica PV-4]
          Length = 170

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 27/100 (27%), Positives = 50/100 (50%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +   + +     +    +K PK     ++ Y L+  GALGN++D   +G+V+D++
Sbjct: 66  GWQRWLFTLVAVGFSTLLTVWLRKQPKGLWRLNLAYTLVIGGALGNLIDRLQHGFVVDFL 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
             + +T  F  FN+AD  I +G  +II D  I + +  G+
Sbjct: 126 DFYWKTSHFPAFNIADSAICVGAGLIILDSFISERKPNGE 165


>gi|28897309|ref|NP_796914.1| lipoprotein signal peptidase [Vibrio parahaemolyticus RIMD 2210633]
 gi|153838779|ref|ZP_01991446.1| signal peptidase II [Vibrio parahaemolyticus AQ3810]
 gi|260363891|ref|ZP_05776639.1| signal peptidase II [Vibrio parahaemolyticus K5030]
 gi|260876272|ref|ZP_05888627.1| signal peptidase II [Vibrio parahaemolyticus AN-5034]
 gi|260895079|ref|ZP_05903575.1| signal peptidase II [Vibrio parahaemolyticus Peru-466]
 gi|260903300|ref|ZP_05911695.1| signal peptidase II [Vibrio parahaemolyticus AQ4037]
 gi|31076758|sp|Q87S89|LSPA_VIBPA RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|28805518|dbj|BAC58798.1| lipoprotein signal peptidase [Vibrio parahaemolyticus RIMD 2210633]
 gi|149747811|gb|EDM58701.1| signal peptidase II [Vibrio parahaemolyticus AQ3810]
 gi|308088903|gb|EFO38598.1| signal peptidase II [Vibrio parahaemolyticus Peru-466]
 gi|308093005|gb|EFO42700.1| signal peptidase II [Vibrio parahaemolyticus AN-5034]
 gi|308107975|gb|EFO45515.1| signal peptidase II [Vibrio parahaemolyticus AQ4037]
 gi|308112975|gb|EFO50515.1| signal peptidase II [Vibrio parahaemolyticus K5030]
 gi|328472071|gb|EGF42948.1| lipoprotein signal peptidase [Vibrio parahaemolyticus 10329]
          Length = 169

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 27/100 (27%), Positives = 49/100 (49%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +     +   I  ++   + +   K P  +   +I Y +I  GA+GNV D  ++G+V+DY
Sbjct: 70  AGWQRWLFTGIAFVVTGLLTYWMSKLPAKEKWNNIAYAMIIGGAVGNVFDRVIHGFVVDY 129

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           +  +   + +  FNLAD+ I +G  +II D    +   K 
Sbjct: 130 LDFYWGNYHWPAFNLADMAICLGAAMIILDGFRKKDTAKA 169


>gi|262281445|ref|ZP_06059226.1| signal peptidase II [Acinetobacter calcoaceticus RUH2202]
 gi|299772090|ref|YP_003734116.1| lipoprotein signal peptidase [Acinetobacter sp. DR1]
 gi|262257271|gb|EEY76008.1| signal peptidase II [Acinetobacter calcoaceticus RUH2202]
 gi|298702178|gb|ADI92743.1| lipoprotein signal peptidase [Acinetobacter sp. DR1]
          Length = 176

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 30/102 (29%), Positives = 50/102 (49%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   S+  L+     F   + PK   +  +   LI  GALGN++D    GYV+D+I
Sbjct: 74  GWQRYFFTSLAGLVSILFVFWLLRMPKKMVVLPVAIALILGGALGNLIDRITLGYVVDFI 133

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
            ++ Q   F  FN+AD  I++GT +++ D   L+ ++    D
Sbjct: 134 HVYYQNHHFPAFNIADSAITLGTILLLIDTFFLEKQRNQNSD 175


>gi|119897495|ref|YP_932708.1| lipoprotein signal peptidase [Azoarcus sp. BH72]
 gi|166232852|sp|A1K4R6|LSPA_AZOSB RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|119669908|emb|CAL93821.1| probable signal peptidase II [Azoarcus sp. BH72]
          Length = 176

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 23/98 (23%), Positives = 49/98 (50%), Gaps = 1/98 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S         + ++I  ++  +  ++ +   +    + LI  GA+GNVVD  L+G V+D+
Sbjct: 71  SGWQRWFFTGLAVVICGWLLALMHQHREE-RLLPAAFALIIGGAIGNVVDRLLHGAVVDF 129

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
           +  H   + +  FNLAD  I++G  ++++  +     +
Sbjct: 130 LYFHAGRYGWPAFNLADSAITLGVGLMLWAQLRAGKHK 167


>gi|238918623|ref|YP_002932137.1| signal peptidase II, [Edwardsiella ictaluri 93-146]
 gi|238868191|gb|ACR67902.1| signal peptidase II, putative [Edwardsiella ictaluri 93-146]
          Length = 166

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 30/100 (30%), Positives = 50/100 (50%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I   +  +  ++  ++ + +I Y LI  GALGN+ D   +G+V+D I
Sbjct: 67  GWQRWFFAGIAIAICVALLVMMYRSAASQRLSNIAYALIIGGALGNLFDRLWHGFVVDMI 126

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
             +   W FA FNLAD  I IG  +++ +  + Q  ++ K
Sbjct: 127 DFYVGNWHFATFNLADTAICIGAALVVVEGFLPQRDKENK 166


>gi|126640134|ref|YP_001083118.1| lipoprotein signal peptidase [Acinetobacter baumannii ATCC 17978]
          Length = 148

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 30/102 (29%), Positives = 50/102 (49%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   S+  L+     F   + PK   +  +   LI  GALGN++D    GYV+D+I
Sbjct: 46  GWQRYFFTSLAGLVSILFVFWLLRMPKKMVVLPVAIALILGGALGNLIDRITLGYVVDFI 105

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
            ++ Q   F  FN+AD  I++GT +++ D   L+ ++    D
Sbjct: 106 HVYYQNHHFPAFNIADSAITLGTILLLIDTFFLEKQRPKNSD 147


>gi|119470027|ref|ZP_01612832.1| lipoprotein signal peptidase (SPase II)(Prolipoprotein signal
           peptidase) [Alteromonadales bacterium TW-7]
 gi|119446737|gb|EAW28010.1| lipoprotein signal peptidase (SPase II)(Prolipoprotein signal
           peptidase) [Alteromonadales bacterium TW-7]
          Length = 169

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 32/101 (31%), Positives = 51/101 (50%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                 L +I I I A + +  K+ P T  +    Y L+  GA+GN+ D   YGYVID+I
Sbjct: 69  GWQRWFLSAIAIAISALLVWWLKRLPATNKVLCGAYSLVLAGAIGNLYDRIAYGYVIDFI 128

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
            +  +   F VFN AD  I +G  ++++D    +  ++ K 
Sbjct: 129 HVFYEDSHFPVFNFADCAICVGAALLLFDAFTGESPKEHKA 169


>gi|156935452|ref|YP_001439368.1| lipoprotein signal peptidase [Cronobacter sakazakii ATCC BAA-894]
 gi|166232865|sp|A7MIM2|LSPA_ENTS8 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|156533706|gb|ABU78532.1| hypothetical protein ESA_03311 [Cronobacter sakazakii ATCC BAA-894]
          Length = 165

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 47/97 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I   +  +  +   ++ + +I Y LI  GALGN+ D   +G+V+D I
Sbjct: 66  GWQRWFFAGIAIGICVLLVVMMYRAKASQKLNNIAYALIIGGALGNLFDRLWHGFVVDMI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
             +   W FA FNLAD  I IG  +++ +  +   ++
Sbjct: 126 DFYVGDWHFATFNLADTAICIGAALVVLEGFLPSKQK 162


>gi|307132646|ref|YP_003884662.1| prolipoprotein signal peptidase (signal peptidase II) [Dickeya
           dadantii 3937]
 gi|306530175|gb|ADN00106.1| prolipoprotein signal peptidase (signal peptidase II) [Dickeya
           dadantii 3937]
          Length = 168

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 27/98 (27%), Positives = 53/98 (54%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +   I ++II  +  +  ++  ++ + +I Y LI  GA+GN+ D  ++GYVID++
Sbjct: 66  GWQRWLFAVIALVIIVALLAMMHRSSASQKLNNIAYSLIIGGAIGNLADRLVHGYVIDFL 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
             +   W +  FNLAD  I +G  +I+ +  +   ++K
Sbjct: 126 DFYVGNWHYPTFNLADSAIVVGALLIVLEGFLASPQKK 163


>gi|299065944|emb|CBJ37125.1| prolipoprotein signal peptidase (SPase II) [Ralstonia solanacearum
           CMR15]
          Length = 173

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 50/96 (52%), Gaps = 1/96 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    + +    FI ++ K++   + +F     LI  GALGNV+D  +YG+V+D++
Sbjct: 79  GWQRWFFTGLGVAAALFIVWLLKRH-SGQKLFCFALALILGGALGNVIDRLVYGHVVDFL 137

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
             H + + +  FN+AD  I IG  ++I D++    R
Sbjct: 138 DFHLRGYHWPAFNVADCGICIGAVLLIIDELRRVRR 173


>gi|304396522|ref|ZP_07378403.1| lipoprotein signal peptidase [Pantoea sp. aB]
 gi|304356031|gb|EFM20397.1| lipoprotein signal peptidase [Pantoea sp. aB]
          Length = 168

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 27/101 (26%), Positives = 51/101 (50%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I + I+  +  +  +N  ++ + +I Y LI  GA+GN+ D   +G+V+D+I
Sbjct: 66  GWQRWFFAGIALAIVISLVVMMYRNHASQKMANIAYALIIGGAIGNLFDRSYHGFVVDFI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
             +   W FA FN+AD  I IG  +++ +     + ++ K 
Sbjct: 126 DFYVGNWHFATFNIADCGICIGAALVVLEGFFSPNGKQAKQ 166


>gi|270263903|ref|ZP_06192171.1| lipoprotein signal peptidase [Serratia odorifera 4Rx13]
 gi|270042096|gb|EFA15192.1| lipoprotein signal peptidase [Serratia odorifera 4Rx13]
          Length = 169

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 27/100 (27%), Positives = 49/100 (49%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I + I+A +  +  ++   + + +I Y  I  GALGN+ D   +G+V+D+I
Sbjct: 66  GWQRWFFAGIAVAIVAVLLVMMYRSQAQQKLNNIAYAFIIGGALGNLFDRLWHGFVVDFI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
             +   W +  FNLAD FI +G  +I+ +  +    +  K
Sbjct: 126 DFYVGNWHYPTFNLADSFICVGAAMIVLEGFLSPASKGAK 165


>gi|37524596|ref|NP_927940.1| lipoprotein signal peptidase [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|81834082|sp|Q7N8X1|LSPA_PHOLL RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|36784020|emb|CAE12887.1| Lipoprotein signal peptidase (Prolipoprotein signal peptidase)
           (Signal peptidase II) (SPase II) [Photorhabdus
           luminescens subsp. laumondii TTO1]
          Length = 167

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 30/101 (29%), Positives = 49/101 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I + I   +  +  +    K + +I Y LI  GALGN+ D  ++G+VID+I
Sbjct: 66  GWQRWFFAFIAVAISVVLMVMMYRASAKKKLSNIAYALIIGGALGNLFDRLVHGFVIDFI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
             +   W F  FN+AD+ I IG  ++I D  +    +  K+
Sbjct: 126 DFYVGDWHFPTFNIADMAICIGAGLVIIDSFLSPDEKTIKV 166


>gi|253988037|ref|YP_003039393.1| lipoprotein signal peptidase [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253779487|emb|CAQ82648.1| lipoprotein signal peptidase [Photorhabdus asymbiotica]
          Length = 167

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 48/97 (49%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    + + I   +  +  ++   K + +I Y LI  GALGN+ D  ++G+VID+I
Sbjct: 66  GWQRWFFALVAVGISIVLTVMMYRSSAKKKLSNIAYALIVGGALGNLFDRLVHGFVIDFI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
             +   W +  FN+AD+ I IG  ++I +    Q  +
Sbjct: 126 DFYVGDWHWPTFNIADMAICIGAALVIIESFFSQDEK 162


>gi|222084675|ref|YP_002543204.1| signal peptidase II [Agrobacterium radiobacter K84]
 gi|221722123|gb|ACM25279.1| signal peptidase II [Agrobacterium radiobacter K84]
          Length = 172

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 46/101 (45%), Positives = 72/101 (71%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           MLS +    +V +R++I+AF+ ++W++ P  + I  +G+ LI  GALGN++D  LYG+VI
Sbjct: 71  MLSGMDGWFIVGMRLVIVAFVIWLWRRTPDHRWIAHLGFALIIAGALGNLIDRFLYGHVI 130

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
           DY++ HT+TWSFAVFNLAD FI+IG   +I D+++   +  
Sbjct: 131 DYVLFHTETWSFAVFNLADSFITIGAGCVILDELLSPKKAN 171


>gi|264676996|ref|YP_003276902.1| lipoprotein signal peptidase [Comamonas testosteroni CNB-2]
 gi|262207508|gb|ACY31606.1| lipoprotein signal peptidase [Comamonas testosteroni CNB-2]
          Length = 171

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 30/101 (29%), Positives = 57/101 (56%), Gaps = 1/101 (0%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S     + V+I ++    I +  +K+P  + +F +    I  GA+GNVVD   +GYV+D+
Sbjct: 70  SGWQRWLFVAIGVIATVLIVWQLRKHP-GEKMFCLSLSSILGGAIGNVVDRLQHGYVVDF 128

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
           +  +  +  F  FN+AD+ I++G  ++I D+++   R K +
Sbjct: 129 LDFYWGSSHFPAFNVADMGITLGAILLILDEVLRAKRAKNQ 169


>gi|226952306|ref|ZP_03822770.1| prolipoprotein signal peptidase (signal peptidase II)
           [Acinetobacter sp. ATCC 27244]
 gi|294648747|ref|ZP_06726206.1| signal peptidase II [Acinetobacter haemolyticus ATCC 19194]
 gi|226836972|gb|EEH69355.1| prolipoprotein signal peptidase (signal peptidase II)
           [Acinetobacter sp. ATCC 27244]
 gi|292825361|gb|EFF84105.1| signal peptidase II [Acinetobacter haemolyticus ATCC 19194]
          Length = 176

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 31/102 (30%), Positives = 51/102 (50%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   S+  ++     F   + PK   I  +   LI  GA+GN++D    GYV+D+I
Sbjct: 74  GWQRYFFTSLAAIVSIIFVFWLMRMPKKMIILPMAIALILGGAVGNLIDRVSLGYVVDFI 133

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
            ++ Q   F  FNLAD  I++GT +++ D   L+ ++  K D
Sbjct: 134 HVYYQNSHFPAFNLADSAITLGTILLLIDTFFLEKKRNQKAD 175


>gi|17547178|ref|NP_520580.1| lipoprotein signal peptidase [Ralstonia solanacearum GMI1000]
 gi|81849524|sp|Q8XWL5|LSPA_RALSO RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|17429480|emb|CAD16166.1| probable lipoprotein signal peptidase [Ralstonia solanacearum
           GMI1000]
          Length = 173

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 50/96 (52%), Gaps = 1/96 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    + +    FI ++ K++   + +F     LI  GALGNV+D  +YG+V+D++
Sbjct: 79  GWQRWFFTGLGVAAALFIVWLLKRH-SGQKLFCFALALILGGALGNVIDRLVYGHVVDFL 137

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
             H + + +  FN+AD  I IG  ++I D++    R
Sbjct: 138 DFHLRGYHWPAFNVADCGICIGAVLLIIDELRRVRR 173


>gi|237729321|ref|ZP_04559802.1| lipoprotein signal peptidase [Citrobacter sp. 30_2]
 gi|283835087|ref|ZP_06354828.1| signal peptidase II [Citrobacter youngae ATCC 29220]
 gi|226909050|gb|EEH94968.1| lipoprotein signal peptidase [Citrobacter sp. 30_2]
 gi|291069381|gb|EFE07490.1| signal peptidase II [Citrobacter youngae ATCC 29220]
          Length = 165

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 31/99 (31%), Positives = 48/99 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I   +  +  ++  T+ + +I Y LI  GALGN+ D   +G+V+D I
Sbjct: 66  GWQRWFFAGIAIGICVILMVMMYRSKATQKLNNIAYALIIGGALGNLFDRLWHGFVVDMI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
             +   W FA FNLAD  I IG  +I+ +  +    +K 
Sbjct: 126 DFYVGDWHFATFNLADTAICIGAALIVLEGFLPSKEKKA 164


>gi|284006375|emb|CBA71611.1| lipoprotein signal peptidase [Arsenophonus nasoniae]
          Length = 149

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 49/97 (50%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    + I+I   +  +  +    K + +I Y L+  GALGN+ D  ++G+V+D+I
Sbjct: 49  GWQRWFFAFVAIVICVVLIVMMYRQSVNKKLSNIAYALVIGGALGNLCDRLVHGFVVDFI 108

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
             +   W +  FN+AD+ I +G  +II D  I   ++
Sbjct: 109 DFYVGDWHWPTFNIADMAICVGAALIILDSCINTDKK 145


>gi|299531568|ref|ZP_07044974.1| lipoprotein signal peptidase [Comamonas testosteroni S44]
 gi|298720531|gb|EFI61482.1| lipoprotein signal peptidase [Comamonas testosteroni S44]
          Length = 171

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 30/101 (29%), Positives = 57/101 (56%), Gaps = 1/101 (0%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S     + V+I ++    I +  +K+P  + +F +    I  GA+GNVVD   +GYV+D+
Sbjct: 70  SGWQRWLFVAIGVIATVLIVWQLRKHP-GEKMFCLSLSSILGGAIGNVVDRLQHGYVVDF 128

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
           +  +  +  F  FN+AD+ I++G  ++I D+++   R K +
Sbjct: 129 LDFYWGSSHFPAFNVADMGITLGAILLILDEVLRAKRAKNQ 169


>gi|312881897|ref|ZP_07741660.1| lipoprotein signal peptidase [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309370415|gb|EFP97904.1| lipoprotein signal peptidase [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 177

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 27/99 (27%), Positives = 47/99 (47%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   +I +L+   + +   K P  +   +I Y +I  GA+GN+ D  ++G V+DY+
Sbjct: 79  GWQRWFFTTIAVLVTGMLTYWMSKLPAQEKWNNIAYAMIIGGAVGNLFDRIVHGSVVDYL 138

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
             +  T+ +  FNLAD  I +G  +II D    +     
Sbjct: 139 DFYWGTYHWPAFNLADSTICVGAVMIILDGFRKKKDDNE 177


>gi|254517165|ref|ZP_05129223.1| signal peptidase II [gamma proteobacterium NOR5-3]
 gi|219674670|gb|EED31038.1| signal peptidase II [gamma proteobacterium NOR5-3]
          Length = 172

 Score =  107 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 29/94 (30%), Positives = 46/94 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   ++   + A I F  +     +S   +   L+  GALGN+VD    GYV+D+I
Sbjct: 67  GWQRWFFAALAFAVSAVIVFWLRDLKPNQSRLSLALALVLGGALGNLVDRVHLGYVVDFI 126

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQ 97
            +H + W F  FN+AD  IS+G  +I+ D +   
Sbjct: 127 SVHYRGWYFPTFNVADAAISLGAFLIVVDSLFSS 160


>gi|90412467|ref|ZP_01220470.1| signal peptidase II [Photobacterium profundum 3TCK]
 gi|90326504|gb|EAS42910.1| signal peptidase II [Photobacterium profundum 3TCK]
          Length = 174

 Score =  107 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 49/97 (50%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +  +I + +   + F  ++ P    + +  Y LI  GALGN+ D   +G+V+D++
Sbjct: 75  GWQRWLFAAIALGVSGLLAFWMRRTPLQNRLANSAYALIIGGALGNLFDRLYHGFVVDFL 134

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
             +  T+ +  FN+AD  I IG  +II +  I   ++
Sbjct: 135 DFYAGTYHWPAFNIADTAICIGAALIIIEGFIADKKE 171


>gi|330831172|ref|YP_004394124.1| lipoprotein signal peptidase [Aeromonas veronii B565]
 gi|328806308|gb|AEB51507.1| Lipoprotein signal peptidase [Aeromonas veronii B565]
          Length = 165

 Score =  107 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 29/99 (29%), Positives = 46/99 (46%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    +   I   +    +K   T+    I Y LI  GALGNV D  + G+V+D++
Sbjct: 67  GWQRWFFAVLAFAICGLLIHWLRKQSVTQRWSGIAYSLIIGGALGNVFDRLVLGHVVDFL 126

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
             + Q   +  FNLAD FI IG  +I+ D    + +++ 
Sbjct: 127 DFYWQRAHWPAFNLADSFIFIGAAMIVLDGFRGEKKEQA 165


>gi|268592112|ref|ZP_06126333.1| signal peptidase II [Providencia rettgeri DSM 1131]
 gi|291312508|gb|EFE52961.1| signal peptidase II [Providencia rettgeri DSM 1131]
          Length = 167

 Score =  107 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 29/101 (28%), Positives = 50/101 (49%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I   +  +  +    K + +I Y LI  GA+GN+ D  ++G+VIDY+
Sbjct: 66  GWQRWFFAGIAIGISVILMVMMYRQSAQKRLSNIAYALIIGGAIGNLSDRLVHGFVIDYL 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
             +   W +  FNLAD+ I IG  ++I++  +    ++ K 
Sbjct: 126 DFYVGNWHWPTFNLADMAICIGAALVIFEGFLPDKSKQEKA 166


>gi|239993316|ref|ZP_04713840.1| signal peptidase II [Alteromonas macleodii ATCC 27126]
          Length = 182

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 51/97 (52%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   +I +++   I +  K++P+++ +  + +  I  GALGNV D  ++GYVID++
Sbjct: 66  GWQRWFFTAIAVVVSVVILWWLKQSPRSQKMLPVAFAFILGGALGNVYDRLVHGYVIDFL 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
             +   + +  FN+AD  I IG  ++I D      ++
Sbjct: 126 DFYVNNYHWPAFNIADSAIFIGAALLIIDMFKNGDKK 162


>gi|260596445|ref|YP_003209016.1| lipoprotein signal peptidase [Cronobacter turicensis z3032]
 gi|260215622|emb|CBA27888.1| Lipoprotein signal peptidase [Cronobacter turicensis z3032]
          Length = 165

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 47/97 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I   +  +  +   ++ + +I Y LI  GALGN+ D   +G+V+D I
Sbjct: 66  GWQRWFFAGIAIGICVLLAVMMYRAKASQKLNNIAYALIIGGALGNLFDRLWHGFVVDMI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
             +   W FA FNLAD  I IG  +++ +  +   ++
Sbjct: 126 DFYVGDWHFATFNLADTAICIGAALVVLEGFLPSKQK 162


>gi|149374348|ref|ZP_01892122.1| Lipoprotein signal peptidase [Marinobacter algicola DG893]
 gi|149361051|gb|EDM49501.1| Lipoprotein signal peptidase [Marinobacter algicola DG893]
          Length = 178

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 27/103 (26%), Positives = 49/103 (47%), Gaps = 2/103 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S       ++I I++   +  +       +    +   ++  GALGNV+D    GYV+DY
Sbjct: 66  SGWQRYFFIAIAIVVSVVLVKLI--QDSRQRAEALACAMVLGGALGNVIDRVFRGYVVDY 123

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
           +  H Q+W +  FNLAD+FI +G  +I+            +++
Sbjct: 124 LDFHWQSWHWPAFNLADVFIVLGMIMILAMSFRANKSPNKQVE 166


>gi|145589921|ref|YP_001156518.1| lipoprotein signal peptidase [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
 gi|145048327|gb|ABP34954.1| signal peptidase II, Aspartic peptidase, MEROPS family A08
           [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
          Length = 162

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 30/92 (32%), Positives = 49/92 (53%), Gaps = 1/92 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S         + +L   +I  + +KN +   +  +   LI  GALGNV+D  +YG V+D+
Sbjct: 61  SGWQRWFFTFLGVLASIYIVVMLRKNQQDG-LLCVALSLILGGALGNVLDRLMYGAVVDF 119

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDI 94
           I +H   W +  FN+AD  I IG  +II+ ++
Sbjct: 120 IDLHYANWHWPAFNVADSAICIGAVLIIFGEL 151


>gi|251788189|ref|YP_003002910.1| lipoprotein signal peptidase [Dickeya zeae Ech1591]
 gi|247536810|gb|ACT05431.1| lipoprotein signal peptidase [Dickeya zeae Ech1591]
          Length = 170

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 27/98 (27%), Positives = 54/98 (55%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +  +I ++II  +  +  ++  ++ + +I Y LI  GA+GN+ D  ++GYVID++
Sbjct: 68  GWQRWLFAAIALVIIVALLAMMYRSSASQKLNNIAYSLIIGGAIGNLADRLVHGYVIDFL 127

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
             +   W +  FNLAD  I +G  +I+ +  +   ++K
Sbjct: 128 DFYAGGWHYPTFNLADSAIVVGALLIVLEGFLASPQKK 165


>gi|124268231|ref|YP_001022235.1| signal peptidase II [Methylibium petroleiphilum PM1]
 gi|166232870|sp|A2SKB1|LSPA_METPP RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|124261006|gb|ABM96000.1| signal peptidase II [Methylibium petroleiphilum PM1]
          Length = 164

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 30/97 (30%), Positives = 53/97 (54%), Gaps = 1/97 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S       V + ++   FI ++  ++   + +F     LI  GA+GNV+D  L+GYV+D+
Sbjct: 68  SGWQRWFFVGLGLVAAGFIVWML-RSQGHQRLFAWALSLILGGAIGNVIDRLLHGYVVDF 126

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
           + +H   W F  FN+AD  I++G  ++I D++    R
Sbjct: 127 LDVHWAGWHFPAFNIADSAITVGAALLILDELRRVRR 163


>gi|308185616|ref|YP_003929747.1| prolipoprotein signal peptidase (SPase II) [Pantoea vagans C9-1]
 gi|308056126|gb|ADO08298.1| prolipoprotein signal peptidase (SPase II) [Pantoea vagans C9-1]
          Length = 168

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 28/101 (27%), Positives = 51/101 (50%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I + I+  +  +  +N  ++ I +I Y LI  GA+GN+ D   +G+V+D+I
Sbjct: 66  GWQRWFFAGIALAIVISLMVMMYRNQASQKIANIAYALIIGGAIGNLFDRSYHGFVVDFI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
             +   W FA FN+AD  I IG  +++ +     + ++ K 
Sbjct: 126 DFYVGNWHFATFNIADCGICIGAALVVLEGFFSPNGKQAKQ 166


>gi|269137941|ref|YP_003294641.1| lipoprotein signal peptidase [Edwardsiella tarda EIB202]
 gi|267983601|gb|ACY83430.1| lipoprotein signal peptidase [Edwardsiella tarda EIB202]
 gi|304557991|gb|ADM40655.1| Lipoprotein signal peptidase [Edwardsiella tarda FL6-60]
          Length = 166

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 29/99 (29%), Positives = 50/99 (50%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I   +  +  ++  ++ + +I Y LI  GALGN+ D   +G+V+D I
Sbjct: 67  GWQRWFFAGIAIAICVALLVMMYRSAASQRLNNIAYALIIGGALGNLFDRLWHGFVVDMI 126

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
             +  +W FA FNLAD  I IG  +++ +  + Q  ++ 
Sbjct: 127 DFYVGSWHFATFNLADTAICIGAALVVLEGFLPQRDKEK 165


>gi|117618899|ref|YP_855225.1| lipoprotein signal peptidase [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|166232851|sp|A0KG40|LSPA_AERHH RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|117560306|gb|ABK37254.1| signal peptidase II [Aeromonas hydrophila subsp. hydrophila ATCC
           7966]
          Length = 167

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 44/97 (45%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    +   I   +    +K    +    I Y LI  GALGNV D  + G+V+D++
Sbjct: 67  GWQRWFFAVLAFAICGLLIHWLRKQSVAQRWSGIAYSLIIGGALGNVFDRLVLGHVVDFL 126

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
             + Q   +  FNLAD FI IG  +I+ D    + ++
Sbjct: 127 DFYWQRAHWPAFNLADSFIFIGAAMIVLDGFRSEKKK 163


>gi|271502097|ref|YP_003335123.1| lipoprotein signal peptidase [Dickeya dadantii Ech586]
 gi|270345652|gb|ACZ78417.1| lipoprotein signal peptidase [Dickeya dadantii Ech586]
          Length = 168

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 26/98 (26%), Positives = 53/98 (54%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +   I ++II  +  +  ++  ++ + +I Y +I  GA+GN+ D  ++GYVID++
Sbjct: 66  GWQRWLFAVIALVIIVALLAMMLRSSASQKLNNIAYAMIIGGAIGNLADRLVHGYVIDFL 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
             +   W +  FNLAD  I +G  +I+ +  +   ++K
Sbjct: 126 DFYVNNWHYPTFNLADSAIVVGALLIVLEGFLASPQKK 163


>gi|157960912|ref|YP_001500946.1| lipoprotein signal peptidase [Shewanella pealeana ATCC 700345]
 gi|189028667|sp|A8H1H4|LSPA_SHEPA RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|157845912|gb|ABV86411.1| lipoprotein signal peptidase [Shewanella pealeana ATCC 700345]
          Length = 170

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 25/99 (25%), Positives = 45/99 (45%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +   + +     +    ++ P      ++ Y L+  GALGN++D   +GYV+D++
Sbjct: 66  GWQRWLFTFVAVGFSVLLSVWLRQQPSKMWRLNLAYTLVIGGALGNLIDRLQHGYVVDFL 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
             +  T  F  FN+AD  I +G  +II D  +     K 
Sbjct: 126 DFYWNTSHFPAFNIADSAICVGAGLIILDSFVAGKDDKK 164


>gi|84393573|ref|ZP_00992326.1| signal peptidase II [Vibrio splendidus 12B01]
 gi|218708571|ref|YP_002416192.1| lipoprotein signal peptidase [Vibrio splendidus LGP32]
 gi|84375782|gb|EAP92676.1| signal peptidase II [Vibrio splendidus 12B01]
 gi|218321590|emb|CAV17542.1| Lipoprotein signal peptidase [Vibrio splendidus LGP32]
          Length = 166

 Score =  107 bits (267), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 30/99 (30%), Positives = 49/99 (49%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S     +   I   +   + +   K P  +   +I Y +I  GA+GNV D  ++G+V+DY
Sbjct: 68  SGWQRWLFTGIAFAVTGMLTYWMSKLPAAEKWNNIAYAIIIGGAVGNVFDRVVHGFVVDY 127

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
           +  +  T+ +  FNLAD+ I IG  +II D    +   K
Sbjct: 128 LDFYWGTYHWPAFNLADMGICIGAAMIILDGFRKKDESK 166


>gi|238758980|ref|ZP_04620151.1| Lipoprotein signal peptidase [Yersinia aldovae ATCC 35236]
 gi|238702791|gb|EEP95337.1| Lipoprotein signal peptidase [Yersinia aldovae ATCC 35236]
          Length = 169

 Score =  107 bits (267), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 28/98 (28%), Positives = 48/98 (48%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S         + I I   +  +  ++   + + +  Y LI  GALGN+ D  ++G VID+
Sbjct: 65  SGWQRWFFAGVAIGISIVLMVLMYRSTAKQRLLNCAYALIIGGALGNLFDRMVHGAVIDF 124

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
           I  H   W F  FN+AD+ I IG  ++I++  +    +
Sbjct: 125 IDFHVNGWHFPTFNIADIAICIGAALVIFEGFLSPAEK 162


>gi|108757607|ref|YP_628642.1| lipoprotein signal peptidase [Myxococcus xanthus DK 1622]
 gi|108461487|gb|ABF86672.1| signal peptidase II [Myxococcus xanthus DK 1622]
          Length = 198

 Score =  107 bits (267), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 31/101 (30%), Positives = 53/101 (52%), Gaps = 3/101 (2%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           M   V     + + +  + FIF ++++ P  + +  +   L+T GALGN VD  L GYVI
Sbjct: 94  MPEGVRRLFFLVVSLAAMGFIFVMYRRTPMEQRLARVALALVTGGALGNFVDRLLRGYVI 153

Query: 61  DYIMIHTQT---WSFAVFNLADLFISIGTCIIIYDDIILQH 98
           D+I  H +      +  FN+AD+ IS+G  +++ D +    
Sbjct: 154 DFIDWHWRNQPGMRWPTFNVADVAISVGVGLMLLDSLRAPK 194


>gi|152979532|ref|YP_001345161.1| lipoprotein signal peptidase [Actinobacillus succinogenes 130Z]
 gi|171704349|sp|A6VQH9|LSPA_ACTSZ RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|150841255|gb|ABR75226.1| lipoprotein signal peptidase [Actinobacillus succinogenes 130Z]
          Length = 163

 Score =  107 bits (267), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 25/101 (24%), Positives = 53/101 (52%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  +++ ++I A + ++ +KN   + + +  Y LI  GAL N+ D   +G+V+D+ 
Sbjct: 63  GWQKYFFIALALIISAVLVYLLRKNSARQKLQNSAYALIIGGALANMADRAYHGFVVDFF 122

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
             + + W + VFN+AD+ I +G  ++I D      ++  + 
Sbjct: 123 DFYWREWHYPVFNVADIAICVGVGLLILDSFKNGEKKANEQ 163


>gi|187929797|ref|YP_001900284.1| lipoprotein signal peptidase [Ralstonia pickettii 12J]
 gi|187726687|gb|ACD27852.1| lipoprotein signal peptidase [Ralstonia pickettii 12J]
          Length = 174

 Score =  107 bits (267), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 50/96 (52%), Gaps = 1/96 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    + +    FI ++ K++   + +F     LI  GALGNV+D  +YG+V+D++
Sbjct: 80  GWQRWFFTGLGVAAALFIVWLLKRH-SGQKMFCFALALILGGALGNVIDRVIYGHVVDFL 138

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
             +   + +  FN+AD  I+IG  ++I D++    R
Sbjct: 139 DFYLHNYHWPAFNVADCGITIGAVLLIVDELRRVRR 174


>gi|33592820|ref|NP_880464.1| lipoprotein signal peptidase [Bordetella pertussis Tohama I]
 gi|33572468|emb|CAE42038.1| lipoprotein signal peptidase [Bordetella pertussis Tohama I]
 gi|332382233|gb|AEE67080.1| lipoprotein signal peptidase [Bordetella pertussis CS]
          Length = 168

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 24/102 (23%), Positives = 51/102 (50%), Gaps = 1/102 (0%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   ++ +     I ++ ++         +   LI  GALGNV+D   YG+V+D++
Sbjct: 68  GWQRWFFTALGVGASIVIVWLLRRTAGQPRF-SLALTLIMGGALGNVIDRVAYGHVVDFL 126

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
           + + + W +  FNLAD+ I+ G  +++ D+++   ++    D
Sbjct: 127 LFYWRDWHYPAFNLADVAITCGAVLLVVDELLRARKRPTAQD 168


>gi|309781487|ref|ZP_07676223.1| signal peptidase II [Ralstonia sp. 5_7_47FAA]
 gi|308919900|gb|EFP65561.1| signal peptidase II [Ralstonia sp. 5_7_47FAA]
          Length = 174

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 50/96 (52%), Gaps = 1/96 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    + +    FI ++ K++   + +F     LI  GALGNV+D  +YG+V+D++
Sbjct: 80  GWQRWFFTGLGVAAALFIVWLLKRH-SGQKMFCFALALILGGALGNVIDRVIYGHVVDFL 138

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
             +   + +  FN+AD  I+IG  ++I D++    R
Sbjct: 139 DFYLHNYHWPAFNVADCGITIGAVLLIVDELRRVRR 174


>gi|91227669|ref|ZP_01261946.1| signal peptidase II [Vibrio alginolyticus 12G01]
 gi|91188448|gb|EAS74742.1| signal peptidase II [Vibrio alginolyticus 12G01]
          Length = 168

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 29/99 (29%), Positives = 48/99 (48%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +     +   I  ++   + +   K P  +   +I Y LI  GA+GNV D  ++G+V+DY
Sbjct: 70  AGWQRWLFTGIAFVVTGLLTYWMSKLPAKEKWNNIAYALIIGGAVGNVFDRVVHGFVVDY 129

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
           +      + +  FNLAD+ I IG  +II D    +   K
Sbjct: 130 LDFFWGNYHWPAFNLADMAICIGAAMIILDGFRKKDANK 168


>gi|16763437|ref|NP_459052.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|62178611|ref|YP_215028.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|167989900|ref|ZP_02571000.1| signal peptidase II [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|168230305|ref|ZP_02655363.1| signal peptidase II [Salmonella enterica subsp. enterica serovar
           Kentucky str. CDC 191]
 gi|168243562|ref|ZP_02668494.1| signal peptidase II [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|168464422|ref|ZP_02698325.1| signal peptidase II [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|194446803|ref|YP_002039277.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194449317|ref|YP_002044013.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194471479|ref|ZP_03077463.1| signal peptidase II [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|197264431|ref|ZP_03164505.1| signal peptidase II [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|205351390|ref|YP_002225191.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|207855563|ref|YP_002242214.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|224581884|ref|YP_002635682.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|238910801|ref|ZP_04654638.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
 gi|34222683|sp|Q8ZRY9|LSPA_SALTY RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|81309806|sp|Q57TL4|LSPA_SALCH RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|226801497|sp|B5R1N7|LSPA_SALEP RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|226801498|sp|B5RG82|LSPA_SALG2 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|238058062|sp|B4TIE6|LSPA_SALHS RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|238058063|sp|B4T6H3|LSPA_SALNS RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|254810453|sp|C0Q4I6|LSPA_SALPC RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|16418542|gb|AAL19011.1| prolipoprotein signal peptidase (SPase II) [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|62126244|gb|AAX63947.1| prolipoprotein signal peptidase (SPase II) [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. SC-B67]
 gi|194405466|gb|ACF65688.1| signal peptidase II [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|194407621|gb|ACF67840.1| signal peptidase II [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|194457843|gb|EDX46682.1| signal peptidase II [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|195632597|gb|EDX51051.1| signal peptidase II [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|197242686|gb|EDY25306.1| signal peptidase II [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|205271171|emb|CAR35958.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205331305|gb|EDZ18069.1| signal peptidase II [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|205335152|gb|EDZ21916.1| signal peptidase II [Salmonella enterica subsp. enterica serovar
           Kentucky str. CDC 191]
 gi|205337430|gb|EDZ24194.1| signal peptidase II [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|206707366|emb|CAR31638.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|224466411|gb|ACN44241.1| signal peptidase II [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
 gi|261245281|emb|CBG23066.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267991708|gb|ACY86593.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|301156679|emb|CBW16149.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312911017|dbj|BAJ34991.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|321222383|gb|EFX47455.1| Lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
 gi|322713062|gb|EFZ04633.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
 gi|323128365|gb|ADX15795.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|326626410|gb|EGE32753.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
 gi|332986999|gb|AEF05982.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 166

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 31/101 (30%), Positives = 49/101 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I   +  +  ++  T+ + +I Y LI  GALGN+ D   +G+V+D I
Sbjct: 66  GWQRWFFAGIAIGICVILLVMMYRSKATQKLNNIAYALIIGGALGNLFDRLWHGFVVDMI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
             +   W FA FNLAD  I IG  +I+ +  + +   K + 
Sbjct: 126 DFYVGNWHFATFNLADSAICIGAALIVLEGFLPKPTAKEQA 166


>gi|269966607|ref|ZP_06180688.1| Lipoprotein signal peptidase [Vibrio alginolyticus 40B]
 gi|269828792|gb|EEZ83045.1| Lipoprotein signal peptidase [Vibrio alginolyticus 40B]
          Length = 168

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 29/99 (29%), Positives = 48/99 (48%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +     +   I  ++   + +   K P  +   +I Y LI  GA+GNV D  ++G+V+DY
Sbjct: 70  AGWQRWLFTGIAFVVTGLLTYWMSKLPAKEKWNNIAYALIIGGAVGNVFDRVVHGFVVDY 129

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
           +      + +  FNLAD+ I IG  +II D    +   K
Sbjct: 130 LDFFWGNYHWPAFNLADMAICIGAAMIILDGFRKKDADK 168


>gi|83746252|ref|ZP_00943305.1| Lipoprotein signal peptidase [Ralstonia solanacearum UW551]
 gi|207742564|ref|YP_002258956.1| lipoprotein signal peptidase [Ralstonia solanacearum IPO1609]
 gi|83727002|gb|EAP74127.1| Lipoprotein signal peptidase [Ralstonia solanacearum UW551]
 gi|206593957|emb|CAQ60884.1| lipoprotein signal peptidase [Ralstonia solanacearum IPO1609]
          Length = 174

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 49/96 (51%), Gaps = 1/96 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    + +    FI ++ +++   + +F     LI  GALGNV+D  ++G+V+D++
Sbjct: 80  GWQRWFFTGLGVAAALFIVWLLRRH-SGQKLFCFALALILGGALGNVIDRVIHGHVVDFL 138

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
             H   + +  FN+AD  I IG  ++I D++    R
Sbjct: 139 DFHLHGYHWPAFNVADCGICIGAVLLIIDELRRVRR 174


>gi|114331427|ref|YP_747649.1| lipoprotein signal peptidase [Nitrosomonas eutropha C91]
 gi|114308441|gb|ABI59684.1| signal peptidase II, Aspartic peptidase, MEROPS family A08
           [Nitrosomonas eutropha C91]
          Length = 160

 Score =  106 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 51/97 (52%), Gaps = 1/97 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S      L +I +L+ A I ++  KN  T  +F I    I  GALGN+ D  + G+V+D+
Sbjct: 59  SGWQRWFLSAIALLVSALIIYLLYKN-TTNRLFCIALSFILGGALGNLWDRIMLGHVVDF 117

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
           +  H   + +  FNLAD  I  G C++I D I+ +  
Sbjct: 118 LDFHVSGYHWPAFNLADSAIVCGACLLILDGILNRQN 154


>gi|320540429|ref|ZP_08040079.1| prolipoprotein signal peptidase (signal peptidase II) [Serratia
           symbiotica str. Tucson]
 gi|320029360|gb|EFW11389.1| prolipoprotein signal peptidase (signal peptidase II) [Serratia
           symbiotica str. Tucson]
          Length = 169

 Score =  106 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 29/101 (28%), Positives = 48/101 (47%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I+A +  +  ++   + + +I Y  I  GALGN+ D    G+V+D+I
Sbjct: 66  GWQRWFFAGIAIAIVAVLLVMMYRSSAQQKLNNIAYAFIIGGALGNLFDRLWDGFVVDFI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
             +   W +  FNLAD FI +G  +I+ +  +    Q  K 
Sbjct: 126 DFYIGNWHYPTFNLADSFICVGAAMIMLEGFLSPANQGAKN 166


>gi|300690676|ref|YP_003751671.1| prolipoprotein signal peptidase (SPase II) [Ralstonia solanacearum
           PSI07]
 gi|299077736|emb|CBJ50374.1| prolipoprotein signal peptidase (SPase II) [Ralstonia solanacearum
           PSI07]
          Length = 172

 Score =  106 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 49/96 (51%), Gaps = 1/96 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    + +    FI ++ K++   + +F     LI  GALGNV+D  +YG+V+D++
Sbjct: 78  GWQRWFFTGLGMAAALFIVWLLKRH-SGQKLFCFALALILGGALGNVIDRLVYGHVVDFL 136

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
             H   + +  FN+AD  I IG  ++I D++    R
Sbjct: 137 DFHLHGYHWPAFNVADCGICIGAVLLIIDELRRVRR 172


>gi|206576291|ref|YP_002240525.1| signal peptidase II [Klebsiella pneumoniae 342]
 gi|288937223|ref|YP_003441282.1| lipoprotein signal peptidase [Klebsiella variicola At-22]
 gi|290512628|ref|ZP_06551994.1| signal peptidase II [Klebsiella sp. 1_1_55]
 gi|226801493|sp|B5Y234|LSPA_KLEP3 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|206565349|gb|ACI07125.1| signal peptidase II [Klebsiella pneumoniae 342]
 gi|288891932|gb|ADC60250.1| lipoprotein signal peptidase [Klebsiella variicola At-22]
 gi|289774969|gb|EFD82971.1| signal peptidase II [Klebsiella sp. 1_1_55]
          Length = 166

 Score =  106 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 31/101 (30%), Positives = 49/101 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I   +  +  ++  T+ + +I Y LI  GALGN+ D   +G+V+D I
Sbjct: 66  GWQRWFFSGIAIGICVVLTVLMYRSKATQKLNNIAYALIIGGALGNLFDRLWHGFVVDMI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
             +   W FA FNLAD  I IG  +I+ +  + +   K + 
Sbjct: 126 DFYVGDWHFATFNLADSAICIGAALIVLEGFLPKPTAKEQA 166


>gi|168262288|ref|ZP_02684261.1| signal peptidase II [Salmonella enterica subsp. enterica serovar
           Hadar str. RI_05P066]
 gi|205348900|gb|EDZ35531.1| signal peptidase II [Salmonella enterica subsp. enterica serovar
           Hadar str. RI_05P066]
          Length = 166

 Score =  106 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 31/101 (30%), Positives = 49/101 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I   +  +  ++  T+ + +I Y LI  GALGN+ D   +G+V+D I
Sbjct: 66  GWQRWFFAGIAIGICVILLVMMYRSKATQRLNNIAYALIIGGALGNLFDRLWHGFVVDMI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
             +   W FA FNLAD  I IG  +I+ +  + +   K + 
Sbjct: 126 DFYVGDWHFATFNLADSAICIGAALIVLEGFLPKPTAKEQA 166


>gi|152988587|ref|YP_001350531.1| lipoprotein signal peptidase [Pseudomonas aeruginosa PA7]
 gi|167008960|sp|A6VBU6|LSPA_PSEA7 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|150963745|gb|ABR85770.1| signal peptidase II [Pseudomonas aeruginosa PA7]
          Length = 169

 Score =  106 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 50/97 (51%), Gaps = 1/97 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S     +   I I++ A +    K+  K ++   +   L+  GALGN+ D  + G+V+D+
Sbjct: 66  SGWQRWLFALIAIVVSAILVVWLKRLKKGETWLAVALALVLGGALGNLYDRMVLGHVVDF 125

Query: 63  IMIHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQH 98
           I++H Q  W F  FNLAD  I++G  ++  D    + 
Sbjct: 126 ILVHWQNRWYFPAFNLADSAITVGAVMLALDMFRSKK 162


>gi|241663924|ref|YP_002982284.1| lipoprotein signal peptidase [Ralstonia pickettii 12D]
 gi|240865951|gb|ACS63612.1| lipoprotein signal peptidase [Ralstonia pickettii 12D]
          Length = 174

 Score =  106 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 50/96 (52%), Gaps = 1/96 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    + +    FI ++ K++   + +F     LI  GALGNV+D  +YG+V+D++
Sbjct: 80  GWQRWFFTGLGVAAALFIVWLLKRH-SGQKMFCFALALILGGALGNVIDRVIYGHVVDFL 138

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
             +   + +  FN+AD  I+IG  ++I D++    R
Sbjct: 139 DFYLHNYHWPAFNVADCGITIGAVLLIVDELRRVRR 174


>gi|86148417|ref|ZP_01066708.1| signal peptidase II [Vibrio sp. MED222]
 gi|85833771|gb|EAQ51938.1| signal peptidase II [Vibrio sp. MED222]
          Length = 166

 Score =  106 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 30/99 (30%), Positives = 49/99 (49%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S     +   I   +   + +   K P T    +I Y +I  GA+GNV D  ++G+V+DY
Sbjct: 68  SGWQRWLFTGIAFAVTGMLTYWMSKLPATDKWNNIAYAIIIGGAVGNVFDRVVHGFVVDY 127

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
           +  +  T+ +  FNLAD+ I IG  +II D    +   +
Sbjct: 128 LDFYWGTYHWPAFNLADMGICIGAAMIILDGFRKKDESQ 166


>gi|167550781|ref|ZP_02344538.1| signal peptidase II [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA29]
 gi|168234790|ref|ZP_02659848.1| signal peptidase II [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|168820986|ref|ZP_02832986.1| signal peptidase II [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|194735705|ref|YP_002113058.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197247967|ref|YP_002145028.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|198246069|ref|YP_002214001.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|200386845|ref|ZP_03213457.1| signal peptidase II [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
 gi|204926719|ref|ZP_03217921.1| signal peptidase II [Salmonella enterica subsp. enterica serovar
           Javiana str. GA_MM04042433]
 gi|226801495|sp|B5F725|LSPA_SALA4 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|226801496|sp|B5FHE1|LSPA_SALDC RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|238058065|sp|B4TWN7|LSPA_SALSV RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|194711207|gb|ACF90428.1| signal peptidase II [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|197211670|gb|ACH49067.1| signal peptidase II [Salmonella enterica subsp. enterica serovar
           Agona str. SL483]
 gi|197292022|gb|EDY31372.1| signal peptidase II [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|197940585|gb|ACH77918.1| signal peptidase II [Salmonella enterica subsp. enterica serovar
           Dublin str. CT_02021853]
 gi|199603943|gb|EDZ02488.1| signal peptidase II [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
 gi|204323384|gb|EDZ08579.1| signal peptidase II [Salmonella enterica subsp. enterica serovar
           Javiana str. GA_MM04042433]
 gi|205324301|gb|EDZ12140.1| signal peptidase II [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA29]
 gi|205342369|gb|EDZ29133.1| signal peptidase II [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|320089079|emb|CBY98835.1| Lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
 gi|322615805|gb|EFY12725.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322620653|gb|EFY17513.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322621718|gb|EFY18568.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322627444|gb|EFY24235.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322630750|gb|EFY27514.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322638030|gb|EFY34731.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322641319|gb|EFY37959.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322647654|gb|EFY44139.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322651486|gb|EFY47863.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322655027|gb|EFY51339.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322658784|gb|EFY55041.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322661773|gb|EFY57989.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322666480|gb|EFY62658.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322672361|gb|EFY68473.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322676327|gb|EFY72398.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322679580|gb|EFY75625.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322684291|gb|EFY80295.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|323191774|gb|EFZ77023.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323198957|gb|EFZ84055.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323201023|gb|EFZ86092.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323209420|gb|EFZ94353.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323212890|gb|EFZ97692.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323216635|gb|EGA01360.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323219867|gb|EGA04346.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323223515|gb|EGA07840.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323228720|gb|EGA12849.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323236666|gb|EGA20742.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323239833|gb|EGA23880.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323242119|gb|EGA26148.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323247440|gb|EGA31395.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323250541|gb|EGA34423.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323259271|gb|EGA42913.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323263850|gb|EGA47371.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323265554|gb|EGA49050.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323270000|gb|EGA53448.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
 gi|326621744|gb|EGE28089.1| signal peptidase II [Salmonella enterica subsp. enterica serovar
           Dublin str. 3246]
          Length = 166

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 31/101 (30%), Positives = 49/101 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I   +  +  ++  T+ + +I Y LI  GALGN+ D   +G+V+D I
Sbjct: 66  GWQRWFFAGIAIGICVILLVMMYRSKATQKLNNIAYALIIGGALGNLFDRLWHGFVVDMI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
             +   W FA FNLAD  I IG  +I+ +  + +   K + 
Sbjct: 126 DFYVGDWHFATFNLADSAICIGAALIVLEGFLPKPTAKEQA 166


>gi|319761888|ref|YP_004125825.1| lipoprotein signal peptidase [Alicycliphilus denitrificans BC]
 gi|330826260|ref|YP_004389563.1| lipoprotein signal peptidase [Alicycliphilus denitrificans K601]
 gi|317116449|gb|ADU98937.1| lipoprotein signal peptidase [Alicycliphilus denitrificans BC]
 gi|329311632|gb|AEB86047.1| lipoprotein signal peptidase [Alicycliphilus denitrificans K601]
          Length = 165

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 30/98 (30%), Positives = 52/98 (53%), Gaps = 1/98 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +   I +   AFI +  + +P  + +F      I  GA+GNVVD   +GYV+D++
Sbjct: 69  GWQRWLFTGIAVATAAFILWQLRAHP-GQKLFCFALSSILGGAIGNVVDRLQHGYVVDFL 127

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
             H + W F  FN+AD  I++G   +I D+++   R++
Sbjct: 128 DFHLRGWHFPAFNVADAAITVGAACLILDELLRVRRER 165


>gi|317046856|ref|YP_004114504.1| lipoprotein signal peptidase [Pantoea sp. At-9b]
 gi|316948473|gb|ADU67948.1| lipoprotein signal peptidase [Pantoea sp. At-9b]
          Length = 166

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 30/100 (30%), Positives = 50/100 (50%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I+  +  +  +NP    + +I Y LI  GALGN+ D   +G+V+D+I
Sbjct: 66  GWQRWFFAGIAIAIVVALLVMMYRNPARNKLTNIAYALIIGGALGNLFDRAYHGFVVDFI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
             +   W FA FN+AD  I IG  +++ +  +    ++ K
Sbjct: 126 DFYIGDWHFATFNIADCGICIGAALVVLEGFLSPKGKQVK 165


>gi|167623066|ref|YP_001673360.1| lipoprotein signal peptidase [Shewanella halifaxensis HAW-EB4]
 gi|189028666|sp|B0TJB0|LSPA_SHEHH RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|167353088|gb|ABZ75701.1| lipoprotein signal peptidase [Shewanella halifaxensis HAW-EB4]
          Length = 170

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 24/99 (24%), Positives = 45/99 (45%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +   + +     +    ++ P      ++ Y L+  GALGN++D   +G+V+D++
Sbjct: 66  GWQRWLFTFVAVGFSVVLSVWLRQQPSKMWRLNLAYTLVIGGALGNLIDRLQHGFVVDFL 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
             +  T  F  FN+AD  I +G  +II D  +     K 
Sbjct: 126 DFYWNTSHFPAFNIADSAICVGAALIILDSFVTGKDDKK 164


>gi|254785208|ref|YP_003072636.1| lipoprotein signal peptidase [Teredinibacter turnerae T7901]
 gi|259495135|sp|C5BQX3|LSPA_TERTT RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|237685391|gb|ACR12655.1| signal peptidase II [Teredinibacter turnerae T7901]
          Length = 168

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 29/98 (29%), Positives = 48/98 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                 L  +   +   + F   K PK K +  +   L+  GALGN+ D  L GYV+D+I
Sbjct: 66  GWQRWFLALLAAGVSVLLIFWIAKLPKQKWMEALALALVLGGALGNLYDRMLLGYVVDFI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
           ++H +   +  FN+AD  I IG  ++++D +      K
Sbjct: 126 VVHYKEHEWPAFNIADSAICIGAALLVWDSLFGTKVAK 163


>gi|33596599|ref|NP_884242.1| lipoprotein signal peptidase [Bordetella parapertussis 12822]
 gi|33601154|ref|NP_888714.1| lipoprotein signal peptidase [Bordetella bronchiseptica RB50]
 gi|33573300|emb|CAE37283.1| lipoprotein signal peptidase [Bordetella parapertussis]
 gi|33575589|emb|CAE32667.1| lipoprotein signal peptidase [Bordetella bronchiseptica RB50]
          Length = 168

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 23/97 (23%), Positives = 50/97 (51%), Gaps = 1/97 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   ++ +     I ++ ++         +   LI  GALGNV+D   YG+V+D++
Sbjct: 68  GWQRWFFTALGVGASIVIVWLLRRTAGQPRF-SLALTLIMGGALGNVIDRVAYGHVVDFL 126

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
           + + + W +  FNLAD+ I+ G  +++ D+++   ++
Sbjct: 127 LFYWRDWHYPAFNLADVAITCGAVLLVVDELLRARKR 163


>gi|94311818|ref|YP_585028.1| lipoprotein signal peptidase [Cupriavidus metallidurans CH34]
 gi|93355670|gb|ABF09759.1| prolipoprotein signal peptidase (signal peptidase II) [Cupriavidus
           metallidurans CH34]
          Length = 178

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 53/97 (54%), Gaps = 1/97 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    + +++ AFI ++  ++   + +F +   LI  GA+GNVVD  ++G+VID++
Sbjct: 83  GWQRWFFTLLGVVVGAFIIWLLYRH-TGQKLFCLAVSLILGGAVGNVVDRIIHGHVIDFL 141

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
             H +   F  FN+AD  I++G  ++I D++    R 
Sbjct: 142 DFHLRNTHFPAFNVADCAITLGAILLIVDELRRVRRH 178


>gi|30249135|ref|NP_841205.1| signal peptidase II [Nitrosomonas europaea ATCC 19718]
 gi|30180454|emb|CAD85059.1| Signal peptidase II/lipoprotein signal peptidase family (A8)
           [Nitrosomonas europaea ATCC 19718]
          Length = 160

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 30/97 (30%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S      L +I +L+   I ++  KN     +F     LI  GALGN+ D  + G+V+D+
Sbjct: 59  SGWQRWFLSTIAVLVSVLIVYLLYKN-TANRLFCFALSLILGGALGNLWDRIMLGHVVDF 117

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
           +  H   + +  FNLAD  I  G  ++I D I     
Sbjct: 118 LDFHLNGYHWPAFNLADSAIFCGAFLLILDSIRNGRN 154


>gi|157374334|ref|YP_001472934.1| Signal peptidase II [Shewanella sediminis HAW-EB3]
 gi|189028778|sp|A8FSI3|LSPA_SHESH RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|157316708|gb|ABV35806.1| Signal peptidase II [Shewanella sediminis HAW-EB3]
          Length = 176

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 30/101 (29%), Positives = 48/101 (47%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +   I +     +    +K P      ++ Y L+  GALGN++D   +GYV+D++
Sbjct: 66  GWQKWLFTFIAVAFSTILTIWLRKQPTKVWRLNLAYTLVIGGALGNLIDRLQHGYVVDFL 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
                T  FA FN+AD  I IG  +II D  I   ++K + 
Sbjct: 126 DFFWNTSHFAAFNIADSAICIGAGLIILDSFIGDDKEKSQN 166


>gi|330818073|ref|YP_004361778.1| signal peptidase II [Burkholderia gladioli BSR3]
 gi|327370466|gb|AEA61822.1| signal peptidase II [Burkholderia gladioli BSR3]
          Length = 166

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 32/96 (33%), Positives = 52/96 (54%), Gaps = 1/96 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S        ++ I     I ++ K++   + +F +   LI  GALGNV+D  +YG+VID+
Sbjct: 69  SGWQRWAFTALGIGATLVICYLLKRH-GHQRLFSLSLALILGGALGNVIDRLMYGHVIDF 127

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
           +  H   W +  FNLAD  I+IG  ++IYD++    
Sbjct: 128 LDFHVGGWHWPAFNLADSAITIGAILLIYDELRRVR 163


>gi|56412320|ref|YP_149395.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197361257|ref|YP_002140892.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|81821362|sp|Q5PDL8|LSPA_SALPA RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|238058064|sp|B5BLL1|LSPA_SALPK RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|56126577|gb|AAV76083.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197092732|emb|CAR58155.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
          Length = 166

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 31/101 (30%), Positives = 49/101 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I   +  +  ++  T+ + +I Y LI  GALGN+ D   +G+V+D I
Sbjct: 66  GWQRWFFAGIAIGICVILLVMMYRSKATQKLNNIAYALIIGGALGNLFDRLWHGFVVDMI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
             +   W FA FNLAD  I IG  +I+ +  + +   K + 
Sbjct: 126 DFYVGDWHFATFNLADTAICIGAALIVLEGFLPKPTAKEQA 166


>gi|145628052|ref|ZP_01783853.1| signal peptidase II [Haemophilus influenzae 22.1-21]
 gi|144979827|gb|EDJ89486.1| signal peptidase II [Haemophilus influenzae 22.1-21]
          Length = 171

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 26/98 (26%), Positives = 48/98 (48%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S       + + + I   + +   KN   + I +  Y LI  GAL N+VD    G+V+D+
Sbjct: 62  SGWQQYFFILLALAISGMLVYFLAKNNAEQKIQNSAYALIIGGALANMVDRAYNGFVVDF 121

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
              +   + + VFN+AD+ I IG  +++ D    + ++
Sbjct: 122 FDFYWDIYHYPVFNIADIAICIGAGLLVLDAFKSEKKK 159


>gi|218680737|ref|ZP_03528634.1| putative transmembrane lipoprotein signal peptidase [Rhizobium etli
           CIAT 894]
          Length = 167

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 46/99 (46%), Positives = 71/99 (71%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           MLS +    +V +R++I+AF+ ++W +  K + +  +GY LI  GA+GN+VD   YG+VI
Sbjct: 66  MLSGMDGWFIVGMRLVIVAFVVWLWYRTAKDRWLAHLGYALIIAGAIGNLVDRFAYGHVI 125

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
           DYI+ HT++WSFAVFNLAD FI+IG   +I D+++L  +
Sbjct: 126 DYILFHTESWSFAVFNLADSFITIGAGCVILDELLLPKK 164


>gi|116052702|ref|YP_793018.1| lipoprotein signal peptidase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|313107204|ref|ZP_07793403.1| lipoprotein signal peptidase [Pseudomonas aeruginosa 39016]
 gi|122257288|sp|Q02GB8|LSPA_PSEAB RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|115587923|gb|ABJ13938.1| lipoprotein signal peptidase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|310879905|gb|EFQ38499.1| lipoprotein signal peptidase [Pseudomonas aeruginosa 39016]
          Length = 169

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 30/97 (30%), Positives = 50/97 (51%), Gaps = 1/97 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S     +   I I++ A +    K+  K ++   I   L+  GALGN+ D  + G+V+D+
Sbjct: 66  SGWQRWLFALIAIVVSAILVVWLKRLKKGETWLAIALALVLGGALGNLYDRMVLGHVVDF 125

Query: 63  IMIHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQH 98
           I++H Q  W F  FNLAD  I++G  ++  D    + 
Sbjct: 126 ILVHWQNRWYFPAFNLADSAITVGAVMLALDMFRSKK 162


>gi|261338975|ref|ZP_05966833.1| hypothetical protein ENTCAN_05178 [Enterobacter cancerogenus ATCC
           35316]
 gi|288318804|gb|EFC57742.1| signal peptidase II [Enterobacter cancerogenus ATCC 35316]
          Length = 166

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 29/101 (28%), Positives = 50/101 (49%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I + I   +  +  ++  T+ + +I Y LI  GALGN+ D   +G+V+D I
Sbjct: 66  GWQRWFFAGIAMGICVVLAVMMYRSKATQKLNNIAYALIIGGALGNLFDRLWHGFVVDMI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
             +   W FA FNLAD  I +G  +I+ +  + +   K ++
Sbjct: 126 DFYVGDWHFATFNLADSAICVGAALIVLEGFLPKPAAKEQV 166


>gi|329296597|ref|ZP_08253933.1| lipoprotein signal peptidase [Plautia stali symbiont]
          Length = 166

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 26/98 (26%), Positives = 49/98 (50%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I+  +  +  +N  +  + +I Y LI  GA+GN+ D   +G+V+D+I
Sbjct: 65  GWQRWFFAGIAIAIVVSLLVMMYRNRASNKLTNIAYALIIGGAMGNLFDRAWHGFVVDFI 124

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
             +   W F+ FN+AD  I IG  +++ +  +    ++
Sbjct: 125 DFYVGDWHFSTFNIADCGICIGAALVVLEGFLSPKGKQ 162


>gi|312970119|ref|ZP_07784301.1| signal peptidase II [Escherichia coli 1827-70]
 gi|310337617|gb|EFQ02728.1| signal peptidase II [Escherichia coli 1827-70]
          Length = 164

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 30/98 (30%), Positives = 48/98 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I   +  +  ++  T+ + +I Y LI  GALGN+ D   +G+V+D I
Sbjct: 66  GWQRWFFAGIAIGISVILAVMMYRSKATQKLNNIAYALIIGGALGNLFDRLWHGFVVDMI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
             +   W FA FNLAD  I +G  +I+ +  +    +K
Sbjct: 126 DFYVGDWHFATFNLADTAICVGAALIVLEGFLPSRAKK 163


>gi|22127573|ref|NP_670996.1| lipoprotein signal peptidase [Yersinia pestis KIM 10]
 gi|45443436|ref|NP_994975.1| lipoprotein signal peptidase [Yersinia pestis biovar Microtus str.
           91001]
 gi|51594969|ref|YP_069160.1| lipoprotein signal peptidase [Yersinia pseudotuberculosis IP 32953]
 gi|108810059|ref|YP_653975.1| lipoprotein signal peptidase [Yersinia pestis Antiqua]
 gi|108810513|ref|YP_646280.1| lipoprotein signal peptidase [Yersinia pestis Nepal516]
 gi|145600411|ref|YP_001164487.1| lipoprotein signal peptidase [Yersinia pestis Pestoides F]
 gi|150260488|ref|ZP_01917216.1| lipoprotein signal peptidase [Yersinia pestis CA88-4125]
 gi|162419270|ref|YP_001605364.1| lipoprotein signal peptidase [Yersinia pestis Angola]
 gi|165927328|ref|ZP_02223160.1| signal peptidase II [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165937891|ref|ZP_02226452.1| signal peptidase II [Yersinia pestis biovar Orientalis str. IP275]
 gi|166008717|ref|ZP_02229615.1| signal peptidase II [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166212236|ref|ZP_02238271.1| signal peptidase II [Yersinia pestis biovar Antiqua str. B42003004]
 gi|167401602|ref|ZP_02307096.1| signal peptidase II [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167419338|ref|ZP_02311091.1| signal peptidase II [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167426113|ref|ZP_02317866.1| signal peptidase II [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|170025802|ref|YP_001722307.1| lipoprotein signal peptidase [Yersinia pseudotuberculosis YPIII]
 gi|186893971|ref|YP_001871083.1| lipoprotein signal peptidase [Yersinia pseudotuberculosis PB1/+]
 gi|218927673|ref|YP_002345548.1| lipoprotein signal peptidase [Yersinia pestis CO92]
 gi|229836942|ref|ZP_04457107.1| prolipoprotein signal peptidase (signal peptidase II) [Yersinia
           pestis Pestoides A]
 gi|229840363|ref|ZP_04460522.1| prolipoprotein signal peptidase (signal peptidase II) [Yersinia
           pestis biovar Orientalis str. PEXU2]
 gi|229842443|ref|ZP_04462598.1| prolipoprotein signal peptidase (signal peptidase II) [Yersinia
           pestis biovar Orientalis str. India 195]
 gi|229900702|ref|ZP_04515826.1| prolipoprotein signal peptidase (signal peptidase II) [Yersinia
           pestis Nepal516]
 gi|270487930|ref|ZP_06205004.1| signal peptidase II [Yersinia pestis KIM D27]
 gi|294502572|ref|YP_003566634.1| signal peptidase II [Yersinia pestis Z176003]
 gi|34098650|sp|Q8ZIL9|LSPA_YERPE RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|81825934|sp|Q66ES3|LSPA_YERPS RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|122382441|sp|Q1C0J2|LSPA_YERPA RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|122385315|sp|Q1CMV0|LSPA_YERPN RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|166232882|sp|A4TQF2|LSPA_YERPP RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|226801500|sp|A9R007|LSPA_YERPG RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|226801501|sp|B1JKZ7|LSPA_YERPY RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|238691374|sp|B2K3M7|LSPA_YERPB RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|21960679|gb|AAM87247.1|AE013973_6 prolipoprotein signal peptidase (SPase II) [Yersinia pestis KIM 10]
 gi|45438305|gb|AAS63852.1| FKBP-type peptidyl-prolyl cis-trans isomerase [Yersinia pestis
           biovar Microtus str. 91001]
 gi|51588251|emb|CAH19858.1| prolipoprotein signal peptidase (SPase II) [Yersinia
           pseudotuberculosis IP 32953]
 gi|108774161|gb|ABG16680.1| signal peptidase II. Aspartic peptidase. MEROPS family A08
           [Yersinia pestis Nepal516]
 gi|108781972|gb|ABG16030.1| signal peptidase II. Aspartic peptidase. MEROPS family A08
           [Yersinia pestis Antiqua]
 gi|115346284|emb|CAL19155.1| lipoprotein signal peptidase [Yersinia pestis CO92]
 gi|145212107|gb|ABP41514.1| lipoprotein signal peptidase [Yersinia pestis Pestoides F]
 gi|149289896|gb|EDM39973.1| lipoprotein signal peptidase [Yersinia pestis CA88-4125]
 gi|162352085|gb|ABX86033.1| signal peptidase II [Yersinia pestis Angola]
 gi|165914303|gb|EDR32919.1| signal peptidase II [Yersinia pestis biovar Orientalis str. IP275]
 gi|165920790|gb|EDR38038.1| signal peptidase II [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165992056|gb|EDR44357.1| signal peptidase II [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166206982|gb|EDR51462.1| signal peptidase II [Yersinia pestis biovar Antiqua str. B42003004]
 gi|166963332|gb|EDR59353.1| signal peptidase II [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167048984|gb|EDR60392.1| signal peptidase II [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167055036|gb|EDR64836.1| signal peptidase II [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|169752336|gb|ACA69854.1| lipoprotein signal peptidase [Yersinia pseudotuberculosis YPIII]
 gi|186696997|gb|ACC87626.1| lipoprotein signal peptidase [Yersinia pseudotuberculosis PB1/+]
 gi|229682041|gb|EEO78133.1| prolipoprotein signal peptidase (signal peptidase II) [Yersinia
           pestis Nepal516]
 gi|229690753|gb|EEO82807.1| prolipoprotein signal peptidase (signal peptidase II) [Yersinia
           pestis biovar Orientalis str. India 195]
 gi|229696729|gb|EEO86776.1| prolipoprotein signal peptidase (signal peptidase II) [Yersinia
           pestis biovar Orientalis str. PEXU2]
 gi|229705885|gb|EEO91894.1| prolipoprotein signal peptidase (signal peptidase II) [Yersinia
           pestis Pestoides A]
 gi|262360602|gb|ACY57323.1| signal peptidase II [Yersinia pestis D106004]
 gi|262364548|gb|ACY61105.1| signal peptidase II [Yersinia pestis D182038]
 gi|270336434|gb|EFA47211.1| signal peptidase II [Yersinia pestis KIM D27]
 gi|294353031|gb|ADE63372.1| signal peptidase II [Yersinia pestis Z176003]
          Length = 169

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 27/100 (27%), Positives = 47/100 (47%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S         I I I   +  +  ++   + + +  Y LI  GALGN+ D  ++G V D+
Sbjct: 65  SGWQRWFFAGIAIGISVVLMVMMYRSTAKQRLINCAYALIIGGALGNLYDRLVHGAVNDF 124

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           +  +   W F  FNLAD+ I IG  ++I++  +    +  
Sbjct: 125 LDFYINNWHFPTFNLADVAICIGAALVIFEGFLSPVEKNA 164


>gi|145637310|ref|ZP_01792971.1| lipoprotein signal peptidase [Haemophilus influenzae PittHH]
 gi|229846062|ref|ZP_04466174.1| lipoprotein signal peptidase [Haemophilus influenzae 7P49H1]
 gi|319775062|ref|YP_004137550.1| lipoprotein signal peptidase [Haemophilus influenzae F3047]
 gi|145269562|gb|EDK09504.1| lipoprotein signal peptidase [Haemophilus influenzae PittHH]
 gi|229811066|gb|EEP46783.1| lipoprotein signal peptidase [Haemophilus influenzae 7P49H1]
 gi|301169730|emb|CBW29331.1| lipoprotein signal peptidase (ec 3.4.23.36) (prolipoprotein signal
           peptidase) (signal peptidase ii) (spase ii) [Haemophilus
           influenzae 10810]
 gi|317449653|emb|CBY85859.1| lipoprotein signal peptidase [Haemophilus influenzae F3047]
          Length = 171

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 26/98 (26%), Positives = 48/98 (48%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S       + + + I   + +   KN   + I +  Y LI  GAL N+VD    G+V+D+
Sbjct: 62  SGWQQYFFILLALAISGMLVYFLAKNNAEQKIQNSAYALIIGGALANMVDRAYNGFVVDF 121

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
              +   + + VFN+AD+ I IG  +++ D    + ++
Sbjct: 122 FDFYWDIYHYPVFNIADIAICIGAGLLVLDAFKSEKKK 159


>gi|296101201|ref|YP_003611347.1| signal peptidase II [Enterobacter cloacae subsp. cloacae ATCC
           13047]
 gi|295055660|gb|ADF60398.1| signal peptidase II [Enterobacter cloacae subsp. cloacae ATCC
           13047]
          Length = 166

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 31/101 (30%), Positives = 49/101 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I   +  +  ++  T+ + +I Y LI  GALGN+ D   +G+V+D I
Sbjct: 66  GWQRWFFAGIAIGICVVLAVLMYRSKATQKLNNIAYALIIGGALGNLFDRLWHGFVVDMI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
             +   W FA FNLAD  I IG  +I+ +  + +   K + 
Sbjct: 126 DFYVGDWHFATFNLADSAICIGAALIVLEGFLPKPAAKEQA 166


>gi|110640238|ref|YP_667966.1| lipoprotein signal peptidase [Escherichia coli 536]
 gi|191174122|ref|ZP_03035636.1| signal peptidase II [Escherichia coli F11]
 gi|218547460|ref|YP_002381251.1| lipoprotein signal peptidase [Escherichia fergusonii ATCC 35469]
 gi|300984128|ref|ZP_07176879.1| signal peptidase II [Escherichia coli MS 200-1]
 gi|331661062|ref|ZP_08361994.1| signal peptidase II [Escherichia coli TA206]
 gi|123049529|sp|Q0TLW4|LSPA_ECOL5 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|226739676|sp|B7LVN3|LSPA_ESCF3 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|110341830|gb|ABG68067.1| lipoprotein signal peptidase [Escherichia coli 536]
 gi|190905616|gb|EDV65241.1| signal peptidase II [Escherichia coli F11]
 gi|218355001|emb|CAQ87607.1| prolipoprotein signal peptidase (signal peptidase II) [Escherichia
           fergusonii ATCC 35469]
 gi|300306753|gb|EFJ61273.1| signal peptidase II [Escherichia coli MS 200-1]
 gi|315298459|gb|EFU57714.1| signal peptidase II [Escherichia coli MS 16-3]
 gi|323964877|gb|EGB60344.1| signal peptidase II [Escherichia coli M863]
 gi|324012346|gb|EGB81565.1| signal peptidase II [Escherichia coli MS 60-1]
 gi|324112586|gb|EGC06563.1| signal peptidase II [Escherichia fergusonii B253]
 gi|325495944|gb|EGC93803.1| lipoprotein signal peptidase [Escherichia fergusonii ECD227]
 gi|327255000|gb|EGE66603.1| signal peptidase II [Escherichia coli STEC_7v]
 gi|331052104|gb|EGI24143.1| signal peptidase II [Escherichia coli TA206]
          Length = 164

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 30/98 (30%), Positives = 48/98 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I   +  +  ++  T+ + +I Y LI  GALGN+ D   +G+V+D I
Sbjct: 66  GWQRWFFAGIAIGISVILVVMMYRSKATQKLNNIAYALIIGGALGNLFDRLWHGFVVDMI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
             +   W FA FNLAD  I +G  +I+ +  +    +K
Sbjct: 126 DFYVGDWHFATFNLADTAICVGAALIVLEGFLPSKAKK 163


>gi|229843936|ref|ZP_04464077.1| lipoprotein signal peptidase [Haemophilus influenzae 6P18H1]
 gi|229812930|gb|EEP48618.1| lipoprotein signal peptidase [Haemophilus influenzae 6P18H1]
          Length = 171

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 26/98 (26%), Positives = 48/98 (48%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S       + + + I   + +   KN   + I +  Y LI  GAL N+VD    G+V+D+
Sbjct: 62  SGWQQYFFILLALAISGMLVYFLVKNNAEQKIQNSAYALIIGGALANMVDRAYNGFVVDF 121

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
              +   + + VFN+AD+ I IG  +++ D    + ++
Sbjct: 122 FDFYWDIYHYPVFNIADIAICIGAGLLVLDAFKSEKKK 159


>gi|167946039|ref|ZP_02533113.1| Signal peptidase II [Endoriftia persephone 'Hot96_1+Hot96_2']
          Length = 156

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 27/99 (27%), Positives = 53/99 (53%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + + + + +++ F  ++  + +    +   L+  GA+GNVVD   YG VID+I
Sbjct: 58  GWQRWFFIGLALAVTSYLVFWVRRLGRGERWVAVALSLVIGGAIGNVVDRIFYGQVIDFI 117

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
            +H Q W +  FN+AD  I++G  ++I+D + L  ++  
Sbjct: 118 HLHYQQWYWPAFNIADSAITVGVVVLIFDSLFLASKRSN 156


>gi|107099778|ref|ZP_01363696.1| hypothetical protein PaerPA_01000796 [Pseudomonas aeruginosa PACS2]
 gi|218893654|ref|YP_002442523.1| lipoprotein signal peptidase [Pseudomonas aeruginosa LESB58]
 gi|254238693|ref|ZP_04932016.1| prolipoprotein signal peptidase [Pseudomonas aeruginosa C3719]
 gi|254244544|ref|ZP_04937866.1| prolipoprotein signal peptidase [Pseudomonas aeruginosa 2192]
 gi|126170624|gb|EAZ56135.1| prolipoprotein signal peptidase [Pseudomonas aeruginosa C3719]
 gi|126197922|gb|EAZ61985.1| prolipoprotein signal peptidase [Pseudomonas aeruginosa 2192]
 gi|218773882|emb|CAW29696.1| prolipoprotein signal peptidase [Pseudomonas aeruginosa LESB58]
          Length = 169

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 30/97 (30%), Positives = 50/97 (51%), Gaps = 1/97 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S     +   I I++ A +    K+  K ++   I   L+  GALGN+ D  + G+V+D+
Sbjct: 66  SGWQRWLFALIAIVVSAILVVWLKRLKKGETWLAIALALVLGGALGNLYDRMVLGHVVDF 125

Query: 63  IMIHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQH 98
           I++H Q  W F  FNLAD  I++G  ++  D    + 
Sbjct: 126 ILVHWQNRWYFPAFNLADSAITVGAVMLALDMFRSKK 162


>gi|15799709|ref|NP_285721.1| lipoprotein signal peptidase [Escherichia coli O157:H7 EDL933]
 gi|15829284|ref|NP_308057.1| lipoprotein signal peptidase [Escherichia coli O157:H7 str. Sakai]
 gi|168751719|ref|ZP_02776741.1| signal peptidase II [Escherichia coli O157:H7 str. EC4113]
 gi|168756851|ref|ZP_02781858.1| signal peptidase II [Escherichia coli O157:H7 str. EC4401]
 gi|168762787|ref|ZP_02787794.1| signal peptidase II [Escherichia coli O157:H7 str. EC4501]
 gi|168766715|ref|ZP_02791722.1| signal peptidase II [Escherichia coli O157:H7 str. EC4486]
 gi|168776943|ref|ZP_02801950.1| signal peptidase II [Escherichia coli O157:H7 str. EC4196]
 gi|168781724|ref|ZP_02806731.1| signal peptidase II [Escherichia coli O157:H7 str. EC4076]
 gi|168785078|ref|ZP_02810085.1| signal peptidase II [Escherichia coli O157:H7 str. EC869]
 gi|168801908|ref|ZP_02826915.1| signal peptidase II [Escherichia coli O157:H7 str. EC508]
 gi|195937700|ref|ZP_03083082.1| lipoprotein signal peptidase [Escherichia coli O157:H7 str. EC4024]
 gi|208809047|ref|ZP_03251384.1| signal peptidase II [Escherichia coli O157:H7 str. EC4206]
 gi|208812871|ref|ZP_03254200.1| signal peptidase II [Escherichia coli O157:H7 str. EC4045]
 gi|208820735|ref|ZP_03261055.1| signal peptidase II [Escherichia coli O157:H7 str. EC4042]
 gi|209399687|ref|YP_002268633.1| signal peptidase II [Escherichia coli O157:H7 str. EC4115]
 gi|217325171|ref|ZP_03441255.1| signal peptidase II [Escherichia coli O157:H7 str. TW14588]
 gi|254791162|ref|YP_003075999.1| lipoprotein signal peptidase [Escherichia coli O157:H7 str.
           TW14359]
 gi|261226785|ref|ZP_05941066.1| prolipoprotein signal peptidase (signal peptidase II) [Escherichia
           coli O157:H7 str. FRIK2000]
 gi|261255188|ref|ZP_05947721.1| prolipoprotein signal peptidase (signal peptidase II) [Escherichia
           coli O157:H7 str. FRIK966]
 gi|291280850|ref|YP_003497668.1| Lipoprotein signal peptidase [Escherichia coli O55:H7 str. CB9615]
 gi|31563190|sp|Q8XA48|LSPA_ECO57 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|226801490|sp|B5YYB9|LSPA_ECO5E RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|12512710|gb|AAG54329.1|AE005179_6 prolipoprotein signal peptidase (SPase II) [Escherichia coli
           O157:H7 str. EDL933]
 gi|13359486|dbj|BAB33453.1| prolipoprotein signal peptidase [Escherichia coli O157:H7 str.
           Sakai]
 gi|187767705|gb|EDU31549.1| signal peptidase II [Escherichia coli O157:H7 str. EC4196]
 gi|188014307|gb|EDU52429.1| signal peptidase II [Escherichia coli O157:H7 str. EC4113]
 gi|189000670|gb|EDU69656.1| signal peptidase II [Escherichia coli O157:H7 str. EC4076]
 gi|189356046|gb|EDU74465.1| signal peptidase II [Escherichia coli O157:H7 str. EC4401]
 gi|189363895|gb|EDU82314.1| signal peptidase II [Escherichia coli O157:H7 str. EC4486]
 gi|189366973|gb|EDU85389.1| signal peptidase II [Escherichia coli O157:H7 str. EC4501]
 gi|189375127|gb|EDU93543.1| signal peptidase II [Escherichia coli O157:H7 str. EC869]
 gi|189376019|gb|EDU94435.1| signal peptidase II [Escherichia coli O157:H7 str. EC508]
 gi|208728848|gb|EDZ78449.1| signal peptidase II [Escherichia coli O157:H7 str. EC4206]
 gi|208734148|gb|EDZ82835.1| signal peptidase II [Escherichia coli O157:H7 str. EC4045]
 gi|208740858|gb|EDZ88540.1| signal peptidase II [Escherichia coli O157:H7 str. EC4042]
 gi|209161087|gb|ACI38520.1| signal peptidase II [Escherichia coli O157:H7 str. EC4115]
 gi|209747114|gb|ACI71864.1| prolipoprotein signal peptidase [Escherichia coli]
 gi|209747116|gb|ACI71865.1| prolipoprotein signal peptidase [Escherichia coli]
 gi|209747118|gb|ACI71866.1| prolipoprotein signal peptidase [Escherichia coli]
 gi|209747120|gb|ACI71867.1| prolipoprotein signal peptidase [Escherichia coli]
 gi|209747122|gb|ACI71868.1| prolipoprotein signal peptidase [Escherichia coli]
 gi|217321392|gb|EEC29816.1| signal peptidase II [Escherichia coli O157:H7 str. TW14588]
 gi|254590562|gb|ACT69923.1| prolipoprotein signal peptidase (signal peptidase II) [Escherichia
           coli O157:H7 str. TW14359]
 gi|290760723|gb|ADD54684.1| Lipoprotein signal peptidase [Escherichia coli O55:H7 str. CB9615]
 gi|320190454|gb|EFW65104.1| Lipoprotein signal peptidase [Escherichia coli O157:H7 str. EC1212]
 gi|320642067|gb|EFX11418.1| lipoprotein signal peptidase [Escherichia coli O157:H7 str. G5101]
 gi|320647430|gb|EFX16225.1| lipoprotein signal peptidase [Escherichia coli O157:H- str. 493-89]
 gi|320652764|gb|EFX21002.1| lipoprotein signal peptidase [Escherichia coli O157:H- str. H 2687]
 gi|320658153|gb|EFX25882.1| lipoprotein signal peptidase [Escherichia coli O55:H7 str. 3256-97
           TW 07815]
 gi|320663462|gb|EFX30746.1| lipoprotein signal peptidase [Escherichia coli O55:H7 str. USDA
           5905]
 gi|320668774|gb|EFX35569.1| lipoprotein signal peptidase [Escherichia coli O157:H7 str. LSU-61]
 gi|326345257|gb|EGD69000.1| Lipoprotein signal peptidase [Escherichia coli O157:H7 str. 1125]
 gi|326346890|gb|EGD70624.1| Lipoprotein signal peptidase [Escherichia coli O157:H7 str. 1044]
          Length = 164

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 30/98 (30%), Positives = 48/98 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I   +  +  ++  T+ + +I Y LI  GALGN+ D   +G+V+D I
Sbjct: 66  GWQRWFFAGIAIGISVTLVVMMYRSKATQKLNNIAYALIIGGALGNLFDRLWHGFVVDMI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
             +   W FA FNLAD  I +G  +I+ +  +    +K
Sbjct: 126 DFYVGDWHFATFNLADTAICVGAALIVLEGFLPSKAKK 163


>gi|296391373|ref|ZP_06880848.1| lipoprotein signal peptidase [Pseudomonas aeruginosa PAb1]
          Length = 169

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 30/97 (30%), Positives = 50/97 (51%), Gaps = 1/97 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S     +   I I++ A +    K+  K ++   I   L+  GALGN+ D  + G+V+D+
Sbjct: 66  SGWQRWLFALIAIVVSAILVVWLKRLKKGETWLAIALALVLGGALGNLYDRMVLGHVVDF 125

Query: 63  IMIHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQH 98
           I++H Q  W F  FNLAD  I++G  ++  D    + 
Sbjct: 126 ILVHWQNRWYFPAFNLADSAITVGAVMLALDMFRSKK 162


>gi|163857127|ref|YP_001631425.1| lipoprotein signal peptidase [Bordetella petrii DSM 12804]
 gi|163260855|emb|CAP43157.1| lipoprotein signal peptidase [Bordetella petrii]
          Length = 172

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 24/100 (24%), Positives = 54/100 (54%), Gaps = 1/100 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +     +  ++ I+    I ++ +++        +   LI  GALGNV+D   YG+V+D+
Sbjct: 73  AGWQRWLFTALGIVASVVIVWLLRRHAGQARF-SLALALILGGALGNVIDRVAYGHVVDF 131

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           ++ + + W +  FN+AD+ I+ G  +++ D+++   R + 
Sbjct: 132 LLFYWKDWQYPAFNVADIGITCGAILLVLDELLRARRSRS 171


>gi|113971291|ref|YP_735084.1| lipoprotein signal peptidase [Shewanella sp. MR-4]
 gi|114048529|ref|YP_739079.1| lipoprotein signal peptidase [Shewanella sp. MR-7]
 gi|117921573|ref|YP_870765.1| lipoprotein signal peptidase [Shewanella sp. ANA-3]
 gi|122944451|sp|Q0HS83|LSPA_SHESR RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|123029414|sp|Q0HFZ0|LSPA_SHESM RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|113885975|gb|ABI40027.1| signal peptidase II. Aspartic peptidase. MEROPS family A08
           [Shewanella sp. MR-4]
 gi|113889971|gb|ABI44022.1| signal peptidase II. Aspartic peptidase. MEROPS family A08
           [Shewanella sp. MR-7]
 gi|117613905|gb|ABK49359.1| signal peptidase II. Aspartic peptidase. MEROPS family A08
           [Shewanella sp. ANA-3]
          Length = 170

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 24/105 (22%), Positives = 49/105 (46%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +   + +     +    +K   +    ++ Y L+  GALGN++D  ++G+V+D+I
Sbjct: 66  GWQRWLFTLVAVGFSTLLTVWLRKQSASLWKLNLAYTLVIGGALGNLIDRLMHGFVVDFI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDFPQ 108
             +     +  FN+AD  I IG  +II+D       ++ K +  +
Sbjct: 126 DFYWGKSHYPAFNIADSAIFIGAVLIIWDSFFNSKSEQDKTEEVK 170


>gi|262370951|ref|ZP_06064274.1| prolipoprotein signal peptidase [Acinetobacter johnsonii SH046]
 gi|262314027|gb|EEY95071.1| prolipoprotein signal peptidase [Acinetobacter johnsonii SH046]
          Length = 179

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 29/102 (28%), Positives = 51/102 (50%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   S+  ++     F   + PKT  +  I   LI  GA+GN++D    GYV+D+I
Sbjct: 74  GWQRYFFTSLAGIVSVIFLFWLMRMPKTVKVLPIAIALILGGAIGNLIDRVTLGYVVDFI 133

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
            ++ Q   F  FN+AD  I++GT +++ D   L+  +  + +
Sbjct: 134 HVYYQNSHFPAFNIADSAITLGTILLLIDTFFLEKNRIQRAE 175


>gi|161504823|ref|YP_001571935.1| lipoprotein signal peptidase [Salmonella enterica subsp. arizonae
           serovar 62:z4,z23:-- str. RSK2980]
 gi|189028664|sp|A9MR45|LSPA_SALAR RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|160866170|gb|ABX22793.1| hypothetical protein SARI_02947 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 166

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 31/101 (30%), Positives = 49/101 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I   +  +  ++  T+ + +I Y LI  GALGN+ D   +G+V+D I
Sbjct: 66  GWQRWFFAGIAIGICVILVAMMYRSKATQKLNNIAYALIIGGALGNLFDRLWHGFVVDMI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
             +   W FA FNLAD  I IG  +I+ +  + +   K + 
Sbjct: 126 DFYVGDWHFATFNLADSAICIGAALIVLEGFLPKPAAKEQA 166


>gi|332975821|gb|EGK12700.1| signal peptidase II [Psychrobacter sp. 1501(2011)]
          Length = 235

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 26/100 (26%), Positives = 51/100 (51%), Gaps = 1/100 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    +  ++  F+     K P+   +  +G  L+  GA+GN++D    G V+D+I
Sbjct: 136 GWQKWFFSGLAFVMAIFLTVYLIKAPRAAKLLSMGLALMLGGAIGNLIDRLRIGKVVDFI 195

Query: 64  MIHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
            +H    W++ +FN+AD+ + +G  +II D I L+ ++  
Sbjct: 196 HVHYADVWNYPIFNVADIGVCVGVALIIIDMIFLESKRNK 235


>gi|153947776|ref|YP_001402414.1| lipoprotein signal peptidase [Yersinia pseudotuberculosis IP 31758]
 gi|167008963|sp|A7FMD6|LSPA_YERP3 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|152959271|gb|ABS46732.1| signal peptidase II [Yersinia pseudotuberculosis IP 31758]
          Length = 169

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 28/100 (28%), Positives = 48/100 (48%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S         I I I   +  +  ++   + + +  Y LI  GALGN+ D  ++G V D+
Sbjct: 65  SGWQRWFFAGIAIGISVVLMVMMYRSTAKQRLINCAYALIIGGALGNLYDRLVHGAVNDF 124

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           +  +   W F  FNLAD+ ISIG  ++I++  +    +  
Sbjct: 125 LDFYINNWHFPTFNLADVAISIGAVLVIFEGFLSPAEKNA 164


>gi|270673355|ref|ZP_06222642.1| signal peptidase II [Haemophilus influenzae HK1212]
 gi|270316504|gb|EFA28363.1| signal peptidase II [Haemophilus influenzae HK1212]
          Length = 120

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 26/98 (26%), Positives = 48/98 (48%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S       + + + I   + +   KN   + I +  Y LI  GAL N+VD    G+V+D+
Sbjct: 11  SGWQQYFFILLALAISGMLVYFLAKNNAEQKIQNSAYALIIGGALANMVDRAYNGFVVDF 70

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
              +   + + VFN+AD+ I IG  +++ D    + ++
Sbjct: 71  FDFYWDIYHYPVFNIADIAICIGAGLLVLDAFKSEKKK 108


>gi|304413766|ref|ZP_07395210.1| lipoprotein signal peptidase [Candidatus Regiella insecticola LSR1]
 gi|304283857|gb|EFL92251.1| lipoprotein signal peptidase [Candidatus Regiella insecticola LSR1]
          Length = 170

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 44/97 (45%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I + I+  +     + P+ K + +  Y LI  GALGN+ D  + G VID+I
Sbjct: 66  GWQRWFFALIALAIVLTLLVFMSRTPRQKKLINCAYALIIGGALGNLFDRMVQGVVIDFI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
             H   W +  FNLAD  I IG  +++ +       +
Sbjct: 126 DFHVNHWHWPTFNLADTAICIGAMLVVCEGAFSPPEK 162


>gi|257455749|ref|ZP_05620977.1| signal peptidase II [Enhydrobacter aerosaccus SK60]
 gi|257446877|gb|EEV21892.1| signal peptidase II [Enhydrobacter aerosaccus SK60]
          Length = 182

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 30/99 (30%), Positives = 54/99 (54%), Gaps = 1/99 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +   + + +   I    +K P+   +  +G  L+  GALGN++D    GYVID++
Sbjct: 82  GWQKWLFSGLALAVSLGIMAYLRKIPQQAKLLALGLSLVMAGALGNLIDRVRLGYVIDFL 141

Query: 64  MIHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
            +H    W F +FN+AD+ I+IG  +I+ D  +L+ ++K
Sbjct: 142 HVHYGNAWHFPIFNIADVAINIGVVLILIDAFLLESKRK 180


>gi|152968603|ref|YP_001333712.1| lipoprotein signal peptidase [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|238893008|ref|YP_002917742.1| lipoprotein signal peptidase [Klebsiella pneumoniae NTUH-K2044]
 gi|262044934|ref|ZP_06017976.1| signal peptidase II [Klebsiella pneumoniae subsp. rhinoscleromatis
           ATCC 13884]
 gi|330009357|ref|ZP_08306514.1| signal peptidase II [Klebsiella sp. MS 92-3]
 gi|166232869|sp|A6T4G1|LSPA_KLEP7 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|150953452|gb|ABR75482.1| signal peptidase II [Klebsiella pneumoniae subsp. pneumoniae MGH
           78578]
 gi|238545324|dbj|BAH61675.1| signal peptidase II [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
 gi|238774011|dbj|BAH66508.1| signal peptidase II [Klebsiella pneumoniae NTUH-K2044]
 gi|238774032|dbj|BAH66528.1| signal peptidase II [Klebsiella pneumoniae]
 gi|259037661|gb|EEW38890.1| signal peptidase II [Klebsiella pneumoniae subsp. rhinoscleromatis
           ATCC 13884]
 gi|328534820|gb|EGF61366.1| signal peptidase II [Klebsiella sp. MS 92-3]
          Length = 166

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 31/101 (30%), Positives = 49/101 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I   +  +  ++  T+ + +I Y LI  GALGN+ D   +G+V+D I
Sbjct: 66  GWQRWFFSGIAIGICVVLTVLMYRSKATQKLNNIAYALIIGGALGNLFDRLWHGFVVDMI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
             +   W FA FNLAD  I IG  +I+ +  + +   K + 
Sbjct: 126 DFYVGDWHFATFNLADSAICIGAALIVLEGFLPKPTVKEQA 166


>gi|323492575|ref|ZP_08097721.1| lipoprotein signal peptidase [Vibrio brasiliensis LMG 20546]
 gi|323313177|gb|EGA66295.1| lipoprotein signal peptidase [Vibrio brasiliensis LMG 20546]
          Length = 167

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 28/100 (28%), Positives = 47/100 (47%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +     +   I   +   + +   K P  +   +I Y +I  GA+GNV D  ++G+V+DY
Sbjct: 68  AGWQRWLFTGIAFAVTGMLTYWMSKLPAAEKWNNIAYAMIIGGAVGNVFDRVVHGFVVDY 127

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           +  +   + +  FNLAD  I IG  +II D    +   K 
Sbjct: 128 LDFYWGNYHWPAFNLADTTICIGAAMIILDGFRNKEDAKA 167


>gi|145634180|ref|ZP_01789891.1| lipoprotein signal peptidase [Haemophilus influenzae PittAA]
 gi|145268624|gb|EDK08617.1| lipoprotein signal peptidase [Haemophilus influenzae PittAA]
          Length = 171

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 26/98 (26%), Positives = 47/98 (47%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S       + + + I   + +   KN   + I +  Y LI  GAL N+VD    G+V+D+
Sbjct: 62  SGWQQYFFILLALAISGMLVYFLAKNNAEQKIQNSAYALIIGGALANMVDRAYNGFVVDF 121

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
              +   + + VFN+AD+ I IG  ++  D    + ++
Sbjct: 122 FDFYWDIYHYPVFNIADIAICIGAVLLALDAFKSEKKK 159


>gi|24111472|ref|NP_705982.1| lipoprotein signal peptidase [Shigella flexneri 2a str. 301]
 gi|30061595|ref|NP_835766.1| lipoprotein signal peptidase [Shigella flexneri 2a str. 2457T]
 gi|81839323|sp|Q83MH1|LSPA_SHIFL RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|24050222|gb|AAN41689.1| prolipoprotein signal peptidase (SPase II) [Shigella flexneri 2a
           str. 301]
 gi|30039837|gb|AAP15571.1| prolipoprotein signal peptidase (SPase II) [Shigella flexneri 2a
           str. 2457T]
 gi|281599388|gb|ADA72372.1| Lipoprotein signal peptidase [Shigella flexneri 2002017]
 gi|313646598|gb|EFS11059.1| signal peptidase II [Shigella flexneri 2a str. 2457T]
 gi|332762586|gb|EGJ92851.1| signal peptidase II [Shigella flexneri 4343-70]
 gi|332764868|gb|EGJ95096.1| signal peptidase II [Shigella flexneri K-671]
 gi|332768814|gb|EGJ98993.1| signal peptidase II [Shigella flexneri 2930-71]
 gi|333009088|gb|EGK28544.1| signal peptidase II [Shigella flexneri K-218]
 gi|333010518|gb|EGK29951.1| signal peptidase II [Shigella flexneri VA-6]
 gi|333011408|gb|EGK30822.1| signal peptidase II [Shigella flexneri K-272]
 gi|333022319|gb|EGK41557.1| signal peptidase II [Shigella flexneri K-304]
          Length = 164

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 30/98 (30%), Positives = 48/98 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I   +  +  ++  T+ + +I Y LI  GALGN+ D   +G+V+D I
Sbjct: 66  GWQRWFFAGIAIGISVLLAVMMYRSKATQKLNNIAYALIIGGALGNLFDRLWHGFVVDMI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
             +   W FA FNLAD  I +G  +I+ +  +    +K
Sbjct: 126 DFYVGDWHFATFNLADTAICVGAALIVLEGFLPSKAKK 163


>gi|183600977|ref|ZP_02962470.1| hypothetical protein PROSTU_04592 [Providencia stuartii ATCC 25827]
 gi|188019309|gb|EDU57349.1| hypothetical protein PROSTU_04592 [Providencia stuartii ATCC 25827]
          Length = 166

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 29/99 (29%), Positives = 49/99 (49%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I + I   +  +  +    K + +I Y LI +GA+GN+ D  ++G+VIDYI
Sbjct: 66  GWQRWFFAGIAVTISVILMVMMYRQSAQKRLSNIAYALIISGAIGNLSDRLIHGFVIDYI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
             +   W +  FNLAD+ I IG  ++I +  +    +K 
Sbjct: 126 DFYIGNWHYPTFNLADVTICIGAALVILEGFLPDKDKKK 164


>gi|317153420|ref|YP_004121468.1| lipoprotein signal peptidase [Desulfovibrio aespoeensis Aspo-2]
 gi|316943671|gb|ADU62722.1| lipoprotein signal peptidase [Desulfovibrio aespoeensis Aspo-2]
          Length = 162

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 25/98 (25%), Positives = 48/98 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
           +    + +++ IL + FI ++ K    +      G  LI  GA+GN++D    G V+D++
Sbjct: 63  DWQRPLFIAVTILALGFIGYMLKTADNSDRWMITGLGLIAGGAVGNLIDRVRLGVVVDFL 122

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
             H + + +  FN+AD  +++G   II      +   K
Sbjct: 123 DFHVKGYHWPAFNVADCALTVGAGCIIISLFFNRRPAK 160


>gi|93006180|ref|YP_580617.1| lipoprotein signal peptidase [Psychrobacter cryohalolentis K5]
 gi|92393858|gb|ABE75133.1| signal peptidase II. Aspartic peptidase. MEROPS family A08
           [Psychrobacter cryohalolentis K5]
          Length = 235

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 26/100 (26%), Positives = 51/100 (51%), Gaps = 1/100 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    +  ++  F+     K P+   +  +G  L+  GA+GN++D    G V+D+I
Sbjct: 136 GWQKWFFSGLAFIMAIFLTVYLIKAPRAAKLLSMGLALMLGGAIGNLIDRLRIGKVVDFI 195

Query: 64  MIHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
            +H    W++ +FN+AD+ + +G  +II D I L+ ++  
Sbjct: 196 HVHYADVWNYPIFNVADIGVCVGVALIIIDMIFLESKRNK 235


>gi|167469837|ref|ZP_02334541.1| signal peptidase II [Yersinia pestis FV-1]
          Length = 169

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 27/100 (27%), Positives = 47/100 (47%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S         I I I   +  +  ++   + + +  Y LI  GALGN+ D  ++G V D+
Sbjct: 65  SGWQRWFFAGIAIGISVALMVMMYRSTAKQRLINCAYALIIGGALGNLYDRLVHGAVNDF 124

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           +  +   W F  FNLAD+ I IG  ++I++  +    +  
Sbjct: 125 LDFYINNWHFPTFNLADVAICIGAALVIFEGFLSPVEKNA 164


>gi|262395187|ref|YP_003287041.1| lipoprotein signal peptidase [Vibrio sp. Ex25]
 gi|262338781|gb|ACY52576.1| lipoprotein signal peptidase [Vibrio sp. Ex25]
          Length = 169

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 28/100 (28%), Positives = 48/100 (48%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +     +   I  ++   + +   K P  +   +I Y +I  GA+GNV D  ++G+V+DY
Sbjct: 70  AGWQRWLFTGIAFIVTGLLTYWMSKLPAKEKWNNIAYAMIIGGAVGNVFDRVIHGFVVDY 129

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           +      + +  FNLAD+ I IG  +II D    +   K 
Sbjct: 130 LDFFWGNYHWPAFNLADMTICIGAAMIILDGFRKKDEAKA 169


>gi|16272941|ref|NP_439167.1| lipoprotein signal peptidase [Haemophilus influenzae Rd KW20]
 gi|145630102|ref|ZP_01785884.1| lipoprotein signal peptidase [Haemophilus influenzae R3021]
 gi|145638174|ref|ZP_01793784.1| signal peptidase II [Haemophilus influenzae PittII]
 gi|260580095|ref|ZP_05847925.1| signal peptidase II [Haemophilus influenzae RdAW]
 gi|1170837|sp|P44975|LSPA_HAEIN RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|1574036|gb|AAC22667.1| lipoprotein signal peptidase (lspA) [Haemophilus influenzae Rd
           KW20]
 gi|144984383|gb|EDJ91806.1| lipoprotein signal peptidase [Haemophilus influenzae R3021]
 gi|145272503|gb|EDK12410.1| signal peptidase II [Haemophilus influenzae PittII]
 gi|260093379|gb|EEW77312.1| signal peptidase II [Haemophilus influenzae RdAW]
 gi|309751330|gb|ADO81314.1| Lipoprotein signal peptidase [Haemophilus influenzae R2866]
          Length = 171

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 26/98 (26%), Positives = 48/98 (48%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S       + + + I   + +   KN   + I +  Y LI  GAL N+VD    G+V+D+
Sbjct: 62  SGWQQYFFILLALAISGMLVYFLAKNNAEQKIQNSAYALIIGGALANMVDRAYNGFVVDF 121

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
              +   + + VFN+AD+ I IG  +++ D    + ++
Sbjct: 122 FDFYWDIYHYPVFNIADIAICIGAGLLVLDAFKSEKKK 159


>gi|149192163|ref|ZP_01870383.1| lipoprotein signal peptidase [Vibrio shilonii AK1]
 gi|148834003|gb|EDL51020.1| lipoprotein signal peptidase [Vibrio shilonii AK1]
          Length = 167

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 28/98 (28%), Positives = 50/98 (51%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +     +   I  ++   + +   K P  +   +I Y +I  GA+GNV D  ++G+V+DY
Sbjct: 70  AGWQRWLFTGIAFIVTGLLTYWMSKLPAKEKWNNIAYAMIIGGAVGNVFDRVVHGFVVDY 129

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
           +  +  T+ +  FNLAD+ I IG  +II D    +  +
Sbjct: 130 LDFYWGTYHWPAFNLADMAICIGAGMIIIDSFRNKEVK 167


>gi|323945764|gb|EGB41811.1| signal peptidase II [Escherichia coli H120]
          Length = 170

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 30/98 (30%), Positives = 48/98 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I   +  +  ++  T+ + +I Y LI  GALGN+ D   +G+V+D I
Sbjct: 66  GWQRWFFAGIAIGISVILAVMMYRSKATQKLNNIAYALIIGGALGNLFDRLWHGFVVDMI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
             +   W FA FNLAD  I +G  +I+ +  +    +K
Sbjct: 126 DFYVGDWHFATFNLADTAICVGAALIVLEGFLPSKSEK 163


>gi|301330210|ref|ZP_07222870.1| signal peptidase II [Escherichia coli MS 78-1]
 gi|300843772|gb|EFK71532.1| signal peptidase II [Escherichia coli MS 78-1]
 gi|323975806|gb|EGB70902.1| signal peptidase II [Escherichia coli TW10509]
          Length = 164

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 30/98 (30%), Positives = 48/98 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I   +  +  ++  T+ + +I Y LI  GALGN+ D   +G+V+D I
Sbjct: 66  GWQRWFFAGIAIGISVILMVMMYRSKATQKLNNIAYALIIGGALGNLFDRLWHGFVVDMI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
             +   W FA FNLAD  I +G  +I+ +  +    +K
Sbjct: 126 DFYVGDWHFATFNLADTAICVGAALIVLEGFLPSKAKK 163


>gi|161612368|ref|YP_001586333.1| hypothetical protein SPAB_00057 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|161361732|gb|ABX65500.1| hypothetical protein SPAB_00057 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
          Length = 148

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 31/101 (30%), Positives = 49/101 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I   +  +  ++  T+ + +I Y LI  GALGN+ D   +G+V+D I
Sbjct: 48  GWQRWFFAGIAIGICVILLVMMYRSKATQKLNNIAYALIIGGALGNLFDRLWHGFVVDMI 107

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
             +   W FA FNLAD  I IG  +I+ +  + +   K + 
Sbjct: 108 DFYVGDWHFATFNLADSAICIGAALIVLEGFLPKPTAKEQA 148


>gi|126491|sp|P13514|LSPA_ENTAE RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|148358|gb|AAA24804.1| signal peptidase II [Enterobacter aerogenes]
          Length = 165

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 30/98 (30%), Positives = 48/98 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I + I   +  +  ++  T+ + +I Y LI  GALGN+ D   +G+V+D I
Sbjct: 66  GWQRWFFAGIAVGICVVLAVLMYRSKATQKLNNIAYALIIGGALGNLFDRLWHGFVVDMI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
             +   W FA FNLAD  I IG  +I+ +  +    +K
Sbjct: 126 DFYVGDWHFATFNLADSAICIGAALIVLEGFLPSSDKK 163


>gi|16759041|ref|NP_454658.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|29140591|ref|NP_803933.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|213027716|ref|ZP_03342163.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Typhi str. 404ty]
 gi|213053364|ref|ZP_03346242.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Typhi str. E00-7866]
 gi|213427310|ref|ZP_03360060.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
 gi|213583615|ref|ZP_03365441.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-0664]
 gi|213646629|ref|ZP_03376682.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
 gi|289803234|ref|ZP_06533863.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Typhi str. AG3]
 gi|289826106|ref|ZP_06545218.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
 gi|34222682|sp|Q8Z9N1|LSPA_SALTI RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|25290087|pir||AB0508 lipoprotein signal peptidase [imported] - Salmonella enterica
           subsp. enterica serovar Typhi (strain CT18)
 gi|16501331|emb|CAD01202.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29136215|gb|AAO67782.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
          Length = 166

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 31/101 (30%), Positives = 50/101 (49%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
           +        I I I   +  +  ++  T+ + +I Y LI  GALGN+ D   +G+V+D I
Sbjct: 66  SWQRWFFAGIAIGICVILLVMMYRSKATQKLNNIAYALIIGGALGNLFDRLWHGFVVDMI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
             +   W FA FNLAD  I IG  +I+ +  + +   K + 
Sbjct: 126 DFYVGDWHFATFNLADTAICIGAALIVLEGFLPKPTAKEQA 166


>gi|78484841|ref|YP_390766.1| lipoprotein signal peptidase [Thiomicrospira crunogena XCL-2]
 gi|123555896|sp|Q31ID1|LSPA_THICR RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|78363127|gb|ABB41092.1| signal peptidase II. Aspartic peptidase. MEROPS family A08
           [Thiomicrospira crunogena XCL-2]
          Length = 172

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 28/101 (27%), Positives = 53/101 (52%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   ++ +++   +     K PK  ++  +   L+ +GA+GNV+D  L G V D++
Sbjct: 65  GWQRWFFTALALVVGTALVIWLAKLPKRWTLEVVAINLVLSGAIGNVIDRILAGRVTDFV 124

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
             +  +W +A FN+AD+ ISIG  ++I  +  L+ R + K 
Sbjct: 125 DFYIGSWHYATFNVADMGISIGAVLLIISEFWLKPRHEKKA 165


>gi|49081292|gb|AAT50114.1| PA4559 [synthetic construct]
          Length = 170

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 30/97 (30%), Positives = 50/97 (51%), Gaps = 1/97 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S     +   I I++ A +    K+  K ++   I   L+  GALGN+ D  + G+V+D+
Sbjct: 66  SGWQRWLFALIAIVVSASLVVWLKRLKKGETWLAIALALVLGGALGNLYDRMVLGHVVDF 125

Query: 63  IMIHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQH 98
           I++H Q  W F  FNLAD  I++G  ++  D    + 
Sbjct: 126 ILVHWQNRWYFPAFNLADSAITVGAVMLALDMFRSKK 162


>gi|68249589|ref|YP_248701.1| lipoprotein signal peptidase [Haemophilus influenzae 86-028NP]
 gi|81335982|sp|Q4QLQ6|LSPA_HAEI8 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|68057788|gb|AAX88041.1| lipoprotein signal peptidase [Haemophilus influenzae 86-028NP]
          Length = 171

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 26/98 (26%), Positives = 47/98 (47%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S       + + + I   + +   KN   + I +  Y LI  GAL N+VD    G+V+D+
Sbjct: 62  SGWQQYFFILLALAISGMLVYFLAKNNAEQKIQNSAYALIIGGALANMVDRTYNGFVVDF 121

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
              +   + + VFN+AD+ I IG  ++  D    + ++
Sbjct: 122 FDFYWDIYHYPVFNIADIAICIGAGLLALDAFKSEKKK 159


>gi|26245948|ref|NP_751987.1| lipoprotein signal peptidase [Escherichia coli CFT073]
 gi|82775429|ref|YP_401776.1| lipoprotein signal peptidase [Shigella dysenteriae Sd197]
 gi|91209084|ref|YP_539070.1| lipoprotein signal peptidase [Escherichia coli UTI89]
 gi|117622316|ref|YP_851229.1| lipoprotein signal peptidase [Escherichia coli APEC O1]
 gi|157155523|ref|YP_001461195.1| lipoprotein signal peptidase [Escherichia coli E24377A]
 gi|157159494|ref|YP_001456812.1| lipoprotein signal peptidase [Escherichia coli HS]
 gi|170021614|ref|YP_001726568.1| lipoprotein signal peptidase [Escherichia coli ATCC 8739]
 gi|170679728|ref|YP_001742142.1| lipoprotein signal peptidase [Escherichia coli SMS-3-5]
 gi|191168907|ref|ZP_03030678.1| signal peptidase II [Escherichia coli B7A]
 gi|193066202|ref|ZP_03047255.1| signal peptidase II [Escherichia coli E22]
 gi|194429882|ref|ZP_03062394.1| signal peptidase II [Escherichia coli B171]
 gi|209917216|ref|YP_002291300.1| lipoprotein signal peptidase [Escherichia coli SE11]
 gi|215485188|ref|YP_002327619.1| lipoprotein signal peptidase [Escherichia coli O127:H6 str.
           E2348/69]
 gi|218552611|ref|YP_002385524.1| lipoprotein signal peptidase [Escherichia coli IAI1]
 gi|218556964|ref|YP_002389877.1| lipoprotein signal peptidase [Escherichia coli S88]
 gi|218687901|ref|YP_002396113.1| lipoprotein signal peptidase [Escherichia coli ED1a]
 gi|218693498|ref|YP_002401165.1| lipoprotein signal peptidase [Escherichia coli 55989]
 gi|218698447|ref|YP_002406076.1| lipoprotein signal peptidase [Escherichia coli IAI39]
 gi|218703287|ref|YP_002410806.1| lipoprotein signal peptidase [Escherichia coli UMN026]
 gi|227885079|ref|ZP_04002884.1| lipoprotein signal peptidase [Escherichia coli 83972]
 gi|237704166|ref|ZP_04534647.1| signal peptidase II [Escherichia sp. 3_2_53FAA]
 gi|254037442|ref|ZP_04871519.1| signal peptidase II [Escherichia sp. 1_1_43]
 gi|256025344|ref|ZP_05439209.1| lipoprotein signal peptidase [Escherichia sp. 4_1_40B]
 gi|260842264|ref|YP_003220042.1| prolipoprotein signal peptidase [Escherichia coli O103:H2 str.
           12009]
 gi|260853237|ref|YP_003227128.1| prolipoprotein signal peptidase [Escherichia coli O26:H11 str.
           11368]
 gi|260866177|ref|YP_003232579.1| prolipoprotein signal peptidase [Escherichia coli O111:H- str.
           11128]
 gi|293403100|ref|ZP_06647197.1| lspA [Escherichia coli FVEC1412]
 gi|293408118|ref|ZP_06651958.1| signal peptidase II [Escherichia coli B354]
 gi|293417902|ref|ZP_06660524.1| signal peptidase II [Escherichia coli B185]
 gi|293476689|ref|ZP_06665097.1| signal peptidase II [Escherichia coli B088]
 gi|298378627|ref|ZP_06988511.1| lipoprotein signal peptidase [Escherichia coli FVEC1302]
 gi|300816059|ref|ZP_07096282.1| signal peptidase II [Escherichia coli MS 107-1]
 gi|300821971|ref|ZP_07102115.1| signal peptidase II [Escherichia coli MS 119-7]
 gi|300896790|ref|ZP_07115294.1| signal peptidase II [Escherichia coli MS 198-1]
 gi|300905427|ref|ZP_07123194.1| signal peptidase II [Escherichia coli MS 84-1]
 gi|300948628|ref|ZP_07162712.1| signal peptidase II [Escherichia coli MS 116-1]
 gi|300956954|ref|ZP_07169206.1| signal peptidase II [Escherichia coli MS 175-1]
 gi|300980956|ref|ZP_07175270.1| signal peptidase II [Escherichia coli MS 45-1]
 gi|301019791|ref|ZP_07183935.1| signal peptidase II [Escherichia coli MS 69-1]
 gi|301048405|ref|ZP_07195432.1| signal peptidase II [Escherichia coli MS 185-1]
 gi|301303541|ref|ZP_07209664.1| signal peptidase II [Escherichia coli MS 124-1]
 gi|301648409|ref|ZP_07248145.1| signal peptidase II [Escherichia coli MS 146-1]
 gi|306815376|ref|ZP_07449525.1| lipoprotein signal peptidase [Escherichia coli NC101]
 gi|307136629|ref|ZP_07495985.1| lipoprotein signal peptidase [Escherichia coli H736]
 gi|307311520|ref|ZP_07591162.1| lipoprotein signal peptidase [Escherichia coli W]
 gi|309797792|ref|ZP_07692176.1| signal peptidase II [Escherichia coli MS 145-7]
 gi|312966146|ref|ZP_07780372.1| signal peptidase II [Escherichia coli 2362-75]
 gi|331640474|ref|ZP_08341622.1| signal peptidase II [Escherichia coli H736]
 gi|331645130|ref|ZP_08346241.1| signal peptidase II [Escherichia coli M605]
 gi|331650916|ref|ZP_08351944.1| signal peptidase II [Escherichia coli M718]
 gi|331661391|ref|ZP_08362315.1| signal peptidase II [Escherichia coli TA143]
 gi|331666259|ref|ZP_08367140.1| signal peptidase II [Escherichia coli TA271]
 gi|331671545|ref|ZP_08372343.1| signal peptidase II [Escherichia coli TA280]
 gi|331680595|ref|ZP_08381254.1| signal peptidase II [Escherichia coli H591]
 gi|331681408|ref|ZP_08382045.1| signal peptidase II [Escherichia coli H299]
 gi|31563160|sp|Q8FLB6|LSPA_ECOL6 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|122425076|sp|Q1RGH5|LSPA_ECOUT RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|123563561|sp|Q32K70|LSPA_SHIDS RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|152032417|sp|A1A775|LSPA_ECOK1 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|167008957|sp|A7ZHB6|LSPA_ECO24 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|167008958|sp|A7ZVX5|LSPA_ECOHS RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|189028647|sp|B1IRE8|LSPA_ECOLC RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|226739673|sp|B7M0C3|LSPA_ECO8A RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|226739674|sp|B7N7Q1|LSPA_ECOLU RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|226739675|sp|B1LFV7|LSPA_ECOSM RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|226740873|sp|B7MAE7|LSPA_ECO45 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|226740874|sp|B7NHD1|LSPA_ECO7I RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|226801491|sp|B6HZ22|LSPA_ECOSE RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|254810444|sp|B7UI72|LSPA_ECO27 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|254810445|sp|B7L4E9|LSPA_ECO55 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|254810446|sp|B7MNN2|LSPA_ECO81 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|26106345|gb|AAN78531.1|AE016755_31 Lipoprotein signal peptidase [Escherichia coli CFT073]
 gi|81239577|gb|ABB60287.1| prolipoprotein signal peptidase [Shigella dysenteriae Sd197]
 gi|91070658|gb|ABE05539.1| lipoprotein signal peptidase [Escherichia coli UTI89]
 gi|115511440|gb|ABI99514.1| signal peptidase II [Escherichia coli APEC O1]
 gi|157065174|gb|ABV04429.1| signal peptidase II [Escherichia coli HS]
 gi|157077553|gb|ABV17261.1| signal peptidase II [Escherichia coli E24377A]
 gi|169756542|gb|ACA79241.1| lipoprotein signal peptidase [Escherichia coli ATCC 8739]
 gi|170517446|gb|ACB15624.1| signal peptidase II [Escherichia coli SMS-3-5]
 gi|190901073|gb|EDV60851.1| signal peptidase II [Escherichia coli B7A]
 gi|192926127|gb|EDV80768.1| signal peptidase II [Escherichia coli E22]
 gi|194412101|gb|EDX28411.1| signal peptidase II [Escherichia coli B171]
 gi|209910475|dbj|BAG75549.1| prolipoprotein signal peptidase [Escherichia coli SE11]
 gi|215263260|emb|CAS07575.1| prolipoprotein signal peptidase (signal peptidase II) [Escherichia
           coli O127:H6 str. E2348/69]
 gi|218350230|emb|CAU95913.1| prolipoprotein signal peptidase (signal peptidase II) [Escherichia
           coli 55989]
 gi|218359379|emb|CAQ96918.1| prolipoprotein signal peptidase (signal peptidase II) [Escherichia
           coli IAI1]
 gi|218363733|emb|CAR01393.1| prolipoprotein signal peptidase (signal peptidase II) [Escherichia
           coli S88]
 gi|218368433|emb|CAR16169.1| prolipoprotein signal peptidase (signal peptidase II) [Escherichia
           coli IAI39]
 gi|218425465|emb|CAR06247.1| prolipoprotein signal peptidase (signal peptidase II) [Escherichia
           coli ED1a]
 gi|218430384|emb|CAR11251.1| prolipoprotein signal peptidase (signal peptidase II) [Escherichia
           coli UMN026]
 gi|222031858|emb|CAP74596.1| Lipoprotein signal peptidase [Escherichia coli LF82]
 gi|226840548|gb|EEH72550.1| signal peptidase II [Escherichia sp. 1_1_43]
 gi|226902078|gb|EEH88337.1| signal peptidase II [Escherichia sp. 3_2_53FAA]
 gi|227837908|gb|EEJ48374.1| lipoprotein signal peptidase [Escherichia coli 83972]
 gi|257751886|dbj|BAI23388.1| prolipoprotein signal peptidase [Escherichia coli O26:H11 str.
           11368]
 gi|257757411|dbj|BAI28908.1| prolipoprotein signal peptidase [Escherichia coli O103:H2 str.
           12009]
 gi|257762533|dbj|BAI34028.1| prolipoprotein signal peptidase [Escherichia coli O111:H- str.
           11128]
 gi|284919808|emb|CBG32863.1| lipoprotein signal peptidase [Escherichia coli 042]
 gi|291321142|gb|EFE60584.1| signal peptidase II [Escherichia coli B088]
 gi|291430015|gb|EFF03029.1| lspA [Escherichia coli FVEC1412]
 gi|291430620|gb|EFF03618.1| signal peptidase II [Escherichia coli B185]
 gi|291472369|gb|EFF14851.1| signal peptidase II [Escherichia coli B354]
 gi|294492205|gb|ADE90961.1| signal peptidase II [Escherichia coli IHE3034]
 gi|298280961|gb|EFI22462.1| lipoprotein signal peptidase [Escherichia coli FVEC1302]
 gi|300299698|gb|EFJ56083.1| signal peptidase II [Escherichia coli MS 185-1]
 gi|300316244|gb|EFJ66028.1| signal peptidase II [Escherichia coli MS 175-1]
 gi|300359380|gb|EFJ75250.1| signal peptidase II [Escherichia coli MS 198-1]
 gi|300399078|gb|EFJ82616.1| signal peptidase II [Escherichia coli MS 69-1]
 gi|300402705|gb|EFJ86243.1| signal peptidase II [Escherichia coli MS 84-1]
 gi|300409113|gb|EFJ92651.1| signal peptidase II [Escherichia coli MS 45-1]
 gi|300451854|gb|EFK15474.1| signal peptidase II [Escherichia coli MS 116-1]
 gi|300525571|gb|EFK46640.1| signal peptidase II [Escherichia coli MS 119-7]
 gi|300531266|gb|EFK52328.1| signal peptidase II [Escherichia coli MS 107-1]
 gi|300841268|gb|EFK69028.1| signal peptidase II [Escherichia coli MS 124-1]
 gi|301073544|gb|EFK88350.1| signal peptidase II [Escherichia coli MS 146-1]
 gi|305851038|gb|EFM51493.1| lipoprotein signal peptidase [Escherichia coli NC101]
 gi|306908499|gb|EFN38997.1| lipoprotein signal peptidase [Escherichia coli W]
 gi|307551868|gb|ADN44643.1| lipoprotein signal peptidase [Escherichia coli ABU 83972]
 gi|307629598|gb|ADN73902.1| lipoprotein signal peptidase [Escherichia coli UM146]
 gi|308118621|gb|EFO55883.1| signal peptidase II [Escherichia coli MS 145-7]
 gi|309700240|emb|CBI99528.1| lipoprotein signal peptidase [Escherichia coli ETEC H10407]
 gi|312289389|gb|EFR17283.1| signal peptidase II [Escherichia coli 2362-75]
 gi|312944630|gb|ADR25457.1| lipoprotein signal peptidase [Escherichia coli O83:H1 str. NRG
           857C]
 gi|315059252|gb|ADT73579.1| prolipoprotein signal peptidase (signal peptidase II) [Escherichia
           coli W]
 gi|315255701|gb|EFU35669.1| signal peptidase II [Escherichia coli MS 85-1]
 gi|315285013|gb|EFU44458.1| signal peptidase II [Escherichia coli MS 110-3]
 gi|315293404|gb|EFU52756.1| signal peptidase II [Escherichia coli MS 153-1]
 gi|315616198|gb|EFU96817.1| signal peptidase II [Escherichia coli 3431]
 gi|320197532|gb|EFW72146.1| Lipoprotein signal peptidase [Escherichia coli WV_060327]
 gi|320200457|gb|EFW75043.1| Lipoprotein signal peptidase [Escherichia coli EC4100B]
 gi|323157917|gb|EFZ44020.1| signal peptidase II [Escherichia coli EPECa14]
 gi|323160057|gb|EFZ46020.1| signal peptidase II [Escherichia coli E128010]
 gi|323176332|gb|EFZ61924.1| signal peptidase II [Escherichia coli 1180]
 gi|323190294|gb|EFZ75570.1| signal peptidase II [Escherichia coli RN587/1]
 gi|323380191|gb|ADX52459.1| lipoprotein signal peptidase [Escherichia coli KO11]
 gi|323935078|gb|EGB31445.1| signal peptidase II [Escherichia coli E1520]
 gi|323939754|gb|EGB35956.1| signal peptidase II [Escherichia coli E482]
 gi|323950485|gb|EGB46363.1| signal peptidase II [Escherichia coli H252]
 gi|323955221|gb|EGB50994.1| signal peptidase II [Escherichia coli H263]
 gi|324008368|gb|EGB77587.1| signal peptidase II [Escherichia coli MS 57-2]
 gi|324017708|gb|EGB86927.1| signal peptidase II [Escherichia coli MS 117-3]
 gi|324118378|gb|EGC12272.1| signal peptidase II [Escherichia coli E1167]
 gi|331040220|gb|EGI12427.1| signal peptidase II [Escherichia coli H736]
 gi|331045887|gb|EGI18006.1| signal peptidase II [Escherichia coli M605]
 gi|331051370|gb|EGI23419.1| signal peptidase II [Escherichia coli M718]
 gi|331061306|gb|EGI33269.1| signal peptidase II [Escherichia coli TA143]
 gi|331066470|gb|EGI38347.1| signal peptidase II [Escherichia coli TA271]
 gi|331071390|gb|EGI42747.1| signal peptidase II [Escherichia coli TA280]
 gi|331072058|gb|EGI43394.1| signal peptidase II [Escherichia coli H591]
 gi|331081629|gb|EGI52790.1| signal peptidase II [Escherichia coli H299]
 gi|332341357|gb|AEE54691.1| lipoprotein signal peptidase LspA [Escherichia coli UMNK88]
          Length = 164

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 30/98 (30%), Positives = 48/98 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I   +  +  ++  T+ + +I Y LI  GALGN+ D   +G+V+D I
Sbjct: 66  GWQRWFFAGIAIGISVILAVMMYRSKATQKLNNIAYALIIGGALGNLFDRLWHGFVVDMI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
             +   W FA FNLAD  I +G  +I+ +  +    +K
Sbjct: 126 DFYVGDWHFATFNLADTAICVGAALIVLEGFLPSKAKK 163


>gi|295677444|ref|YP_003605968.1| lipoprotein signal peptidase [Burkholderia sp. CCGE1002]
 gi|295437287|gb|ADG16457.1| lipoprotein signal peptidase [Burkholderia sp. CCGE1002]
          Length = 168

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 29/98 (29%), Positives = 50/98 (51%), Gaps = 1/98 (1%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           M          ++ ++    I ++ K++   + +F     LI  GALGNV+D   YG+VI
Sbjct: 69  MAGGWQRWAFTALGVVAALVICYLLKRH-SGQKMFCTALALILGGALGNVIDRLAYGHVI 127

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
           D++  H   W +  FNLAD  I+IG  +++ D++    
Sbjct: 128 DFLDFHVGGWHWPAFNLADSAITIGAILLVIDELRRVR 165


>gi|281177238|dbj|BAI53568.1| prolipoprotein signal peptidase [Escherichia coli SE15]
          Length = 164

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 29/98 (29%), Positives = 47/98 (47%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I   +  +  ++   + + +I Y LI  GALGN+ D   +G+V+D I
Sbjct: 66  GWQRWFFAGIAIGISVILVVMMYRSKAAQKLNNIAYALIIGGALGNLFDRLWHGFVVDMI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
             +   W FA FNLAD  I +G  +I+ +  +    +K
Sbjct: 126 DFYVGDWHFATFNLADTAICVGAALIVLEGFLPSKAKK 163


>gi|91794073|ref|YP_563724.1| lipoprotein signal peptidase [Shewanella denitrificans OS217]
 gi|91716075|gb|ABE56001.1| signal peptidase II. Aspartic peptidase. MEROPS family A08
           [Shewanella denitrificans OS217]
          Length = 182

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 28/95 (29%), Positives = 46/95 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I +     +    +K   T    ++ + L+  GALGN+VD   +GYV+D++
Sbjct: 78  GWQRWFFTVIALGFSTLLTLWLRKQSHTLWRTNLAFTLVIGGALGNLVDRLYHGYVVDFL 137

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
             + Q++ F  FN+AD  I IG  +II+D    Q 
Sbjct: 138 HFYWQSYHFPAFNIADSAIFIGAVLIIWDSFKPQK 172


>gi|145632390|ref|ZP_01788125.1| lipoprotein signal peptidase [Haemophilus influenzae 3655]
 gi|148828174|ref|YP_001292927.1| lipoprotein signal peptidase [Haemophilus influenzae PittGG]
 gi|260581917|ref|ZP_05849713.1| signal peptidase II [Haemophilus influenzae NT127]
 gi|166232867|sp|A5UID8|LSPA_HAEIG RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|144987297|gb|EDJ93827.1| lipoprotein signal peptidase [Haemophilus influenzae 3655]
 gi|148719416|gb|ABR00544.1| lipoprotein signal peptidase [Haemophilus influenzae PittGG]
 gi|260095110|gb|EEW79002.1| signal peptidase II [Haemophilus influenzae NT127]
          Length = 171

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 26/98 (26%), Positives = 47/98 (47%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S       + + + I   + +   KN   + I +  Y LI  GAL N+VD    G+V+D+
Sbjct: 62  SGWQQYFFILLALAISGMLVYFLAKNNAEQKIQNSAYALIIGGALANMVDRAYNGFVVDF 121

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
              +   + + VFN+AD+ I IG  ++  D    + ++
Sbjct: 122 FDFYWDIYHYPVFNIADIAICIGAGLLALDAFKSEKKK 159


>gi|311107264|ref|YP_003980117.1| lipoprotein signal peptidase 1 [Achromobacter xylosoxidans A8]
 gi|310761953|gb|ADP17402.1| lipoprotein signal peptidase 1 [Achromobacter xylosoxidans A8]
          Length = 179

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 25/98 (25%), Positives = 48/98 (48%), Gaps = 1/98 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +   +  +    I  I ++         +   LI  GA+GNV+D  +YG+V+D++
Sbjct: 80  GWQRWLFTGLGCVAAVVITIILRRTHGQPRF-SLALTLILGGAIGNVIDRVVYGHVVDFL 138

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
           + +     F  FNLAD+ IS G  +++ D+++   + K
Sbjct: 139 LFYWNDSYFPAFNLADVGISCGAVLLVLDELLRGRKAK 176


>gi|295098547|emb|CBK87637.1| signal peptidase II . Aspartic peptidase. MEROPS family A08
           [Enterobacter cloacae subsp. cloacae NCTC 9394]
          Length = 166

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 30/101 (29%), Positives = 49/101 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I   +  +  ++  T+ + +I Y LI  GALGN+ D   +G+V+D I
Sbjct: 66  GWQRWFFAGIAIGICVVLAVLMYRSKATQKLNNIAYALIIGGALGNLFDRLWHGFVVDMI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
             +   W FA FNLAD  I +G  +I+ +  + +   K + 
Sbjct: 126 DFYVGDWHFATFNLADSAICVGAALIVLEGFLPKPAAKEQA 166


>gi|325982868|ref|YP_004295270.1| lipoprotein signal peptidase [Nitrosomonas sp. AL212]
 gi|325532387|gb|ADZ27108.1| lipoprotein signal peptidase [Nitrosomonas sp. AL212]
          Length = 162

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 44/96 (45%), Gaps = 1/96 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S      L  I       I ++  +    + +F +   LI  GALGN+ D    G+V+D+
Sbjct: 59  SGWQRWFLSGIAGSAALLIIYLLNRYR-HERLFCLSLSLILGGALGNLYDRITLGHVVDF 117

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
           +  +  T+ +  FN+AD  I IG  ++IY+      
Sbjct: 118 LDFYIGTYHWPAFNVADSAIFIGAVLMIYESFRKDK 153


>gi|333021647|gb|EGK40896.1| signal peptidase II [Shigella flexneri K-227]
          Length = 146

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 30/98 (30%), Positives = 48/98 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I   +  +  ++  T+ + +I Y LI  GALGN+ D   +G+V+D I
Sbjct: 48  GWQRWFFAGIAIGISVLLAVMMYRSKATQKLNNIAYALIIGGALGNLFDRLWHGFVVDMI 107

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
             +   W FA FNLAD  I +G  +I+ +  +    +K
Sbjct: 108 DFYVGDWHFATFNLADTAICVGAALIVLEGFLPSKAKK 145


>gi|15599755|ref|NP_253249.1| lipoprotein signal peptidase [Pseudomonas aeruginosa PAO1]
 gi|32171511|sp|Q9HVM5|LSPA_PSEAE RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|9950804|gb|AAG07947.1|AE004869_11 prolipoprotein signal peptidase [Pseudomonas aeruginosa PAO1]
          Length = 169

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 30/97 (30%), Positives = 50/97 (51%), Gaps = 1/97 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S     +   I I++ A +    K+  K ++   I   L+  GALGN+ D  + G+V+D+
Sbjct: 66  SGWQRWLFALIAIVVSASLVVWLKRLKKGETWLAIALALVLGGALGNLYDRMVLGHVVDF 125

Query: 63  IMIHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQH 98
           I++H Q  W F  FNLAD  I++G  ++  D    + 
Sbjct: 126 ILVHWQNRWYFPAFNLADSAITVGAVMLALDMFRSKK 162


>gi|311280992|ref|YP_003943223.1| lipoprotein signal peptidase [Enterobacter cloacae SCF1]
 gi|308750187|gb|ADO49939.1| lipoprotein signal peptidase [Enterobacter cloacae SCF1]
          Length = 166

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 30/101 (29%), Positives = 48/101 (47%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I   +  +  +   ++ + +I Y LI  GALGN+ D   +G+V+D I
Sbjct: 66  GWQRWFFAGIAIGICVILTVMMYRAKASQKLNNIAYALIIGGALGNLFDRLWHGFVVDMI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
             +   W FA FNLAD  I IG  +I+ +  + +   K + 
Sbjct: 126 DFYVGDWHFATFNLADTAICIGAALIVLEGFLPKPTAKEQA 166


>gi|134296686|ref|YP_001120421.1| lipoprotein signal peptidase [Burkholderia vietnamiensis G4]
 gi|166232861|sp|A4JH33|LSPA_BURVG RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|134139843|gb|ABO55586.1| signal peptidase II, Aspartic peptidase, MEROPS family A08
           [Burkholderia vietnamiensis G4]
          Length = 166

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 32/96 (33%), Positives = 52/96 (54%), Gaps = 1/96 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S        ++ I     I ++ +++   + +F +   LI  GALGNV+D  LYG+VID+
Sbjct: 69  SGWQRWAFTALGIGATLVICYLLRRHG-QQRLFSLSLALILGGALGNVIDRLLYGHVIDF 127

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
           +  H   W F  FNLAD  I++G  ++IYD++    
Sbjct: 128 LDFHLGGWHFPAFNLADSAITVGAVLLIYDELRRVR 163


>gi|269962530|ref|ZP_06176878.1| Lipoprotein signal peptidase [Vibrio harveyi 1DA3]
 gi|269832725|gb|EEZ86836.1| Lipoprotein signal peptidase [Vibrio harveyi 1DA3]
          Length = 168

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 29/99 (29%), Positives = 47/99 (47%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +     +   I  ++   + +   K P  +   +I Y LI  GA+GNV D  ++G+V+DY
Sbjct: 70  AGWQRWLFTGIAFVVTGLLTYWMSKLPAKEKWNNIAYALIIGGAVGNVFDRVVHGFVVDY 129

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
           +      + +  FNLAD  I IG  +II D    +   K
Sbjct: 130 LDFFWGNYHWPAFNLADTTICIGAAMIILDGFRKKDADK 168


>gi|188992577|ref|YP_001904587.1| lipoprotein signal peptidase [Xanthomonas campestris pv. campestris
           str. B100]
 gi|167734337|emb|CAP52547.1| unnamed protein product [Xanthomonas campestris pv. campestris]
          Length = 205

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 22/99 (22%), Positives = 43/99 (43%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   ++ + I   + F   +  +      + Y L+  GA+GNV+D  ++G+V+D+I
Sbjct: 105 GWQLWFFTALAVGISGLLAFWLSRTARGDWRSAVPYALVIGGAIGNVIDRLMHGHVVDFI 164

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
             +    ++  FN+AD  I  G   I    +    R + 
Sbjct: 165 QWYVGEHTWPSFNIADSAIVGGAIGIALFGLFDGKRSRK 203


>gi|187925134|ref|YP_001896776.1| lipoprotein signal peptidase [Burkholderia phytofirmans PsJN]
 gi|238058048|sp|B2T6I8|LSPA_BURPP RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|187716328|gb|ACD17552.1| lipoprotein signal peptidase [Burkholderia phytofirmans PsJN]
          Length = 172

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 29/98 (29%), Positives = 52/98 (53%), Gaps = 1/98 (1%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           M          ++ ++    I ++ K++   + +F     LI  GALGNV+D   YG+VI
Sbjct: 73  MAGGWQRWAFTALGVVAALVICYLLKRHG-GQKMFCTALALILGGALGNVIDRLAYGHVI 131

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
           D++  H +TW +  FNLAD  I++G  +++ D++    
Sbjct: 132 DFLDFHLRTWHWPAFNLADSAITVGAVLLVLDELRRVR 169


>gi|309973496|gb|ADO96697.1| Lipoprotein signal peptidase [Haemophilus influenzae R2846]
          Length = 171

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 26/98 (26%), Positives = 47/98 (47%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S       + + + I   + +   KN   + I +  Y LI  GAL N+VD    G+V+D+
Sbjct: 62  SGWQQYFFILLALAISGMLVYFLVKNNAEQKIQNSAYALIIGGALANMVDRAYNGFVVDF 121

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
              +   + + VFN+AD+ I IG  ++  D    + ++
Sbjct: 122 FDFYWDIYHYPVFNIADIAICIGAGLLALDAFKSEKKK 159


>gi|16128021|ref|NP_414568.1| prolipoprotein signal peptidase (signal peptidase II) [Escherichia
           coli str. K-12 substr. MG1655]
 gi|74310645|ref|YP_309064.1| lipoprotein signal peptidase [Shigella sonnei Ss046]
 gi|89106911|ref|AP_000691.1| prolipoprotein signal peptidase [Escherichia coli str. K-12 substr.
           W3110]
 gi|170079690|ref|YP_001729010.1| prolipoprotein signal peptidase (signal peptidase II) [Escherichia
           coli str. K-12 substr. DH10B]
 gi|187733568|ref|YP_001878851.1| lipoprotein signal peptidase [Shigella boydii CDC 3083-94]
 gi|193070980|ref|ZP_03051909.1| signal peptidase II [Escherichia coli E110019]
 gi|238899432|ref|YP_002925228.1| prolipoprotein signal peptidase (signal peptidase II) [Escherichia
           coli BW2952]
 gi|256020133|ref|ZP_05433998.1| lipoprotein signal peptidase [Shigella sp. D9]
 gi|300919576|ref|ZP_07136068.1| signal peptidase II [Escherichia coli MS 115-1]
 gi|300924027|ref|ZP_07140027.1| signal peptidase II [Escherichia coli MS 182-1]
 gi|332281288|ref|ZP_08393701.1| prolipoprotein signal peptidase (signal peptidase II) [Shigella sp.
           D9]
 gi|126490|sp|P00804|LSPA_ECOLI RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|123618117|sp|Q3Z5Y3|LSPA_SHISS RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|229470198|sp|B1XBF2|LSPA_ECODH RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|238689483|sp|B2U246|LSPA_SHIB3 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|259495132|sp|C4ZPV3|LSPA_ECOBW RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|41923|emb|CAA25353.1| unnamed protein product [Escherichia coli]
 gi|146670|gb|AAA24092.1| prolipoprotein signal peptidase [Escherichia coli]
 gi|1786210|gb|AAC73138.1| prolipoprotein signal peptidase (signal peptidase II) [Escherichia
           coli str. K-12 substr. MG1655]
 gi|21321909|dbj|BAB96596.1| prolipoprotein signal peptidase [Escherichia coli str. K12 substr.
           W3110]
 gi|73854122|gb|AAZ86829.1| prolipoprotein signal peptidase [Shigella sonnei Ss046]
 gi|169887525|gb|ACB01232.1| prolipoprotein signal peptidase (signal peptidase II) [Escherichia
           coli str. K-12 substr. DH10B]
 gi|187430560|gb|ACD09834.1| signal peptidase II [Shigella boydii CDC 3083-94]
 gi|192955710|gb|EDV86184.1| signal peptidase II [Escherichia coli E110019]
 gi|238863282|gb|ACR65280.1| prolipoprotein signal peptidase (signal peptidase II) [Escherichia
           coli BW2952]
 gi|260450764|gb|ACX41186.1| lipoprotein signal peptidase [Escherichia coli DH1]
 gi|300413322|gb|EFJ96632.1| signal peptidase II [Escherichia coli MS 115-1]
 gi|300419751|gb|EFK03062.1| signal peptidase II [Escherichia coli MS 182-1]
 gi|315134721|dbj|BAJ41880.1| lipoprotein signal peptidase [Escherichia coli DH1]
 gi|320173365|gb|EFW48567.1| Lipoprotein signal peptidase [Shigella dysenteriae CDC 74-1112]
 gi|323166072|gb|EFZ51851.1| signal peptidase II [Shigella sonnei 53G]
 gi|323171445|gb|EFZ57092.1| signal peptidase II [Escherichia coli LT-68]
 gi|332103640|gb|EGJ06986.1| prolipoprotein signal peptidase (signal peptidase II) [Shigella sp.
           D9]
          Length = 164

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 30/98 (30%), Positives = 48/98 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I   +  +  ++  T+ + +I Y LI  GALGN+ D   +G+V+D I
Sbjct: 66  GWQRWFFAGIAIGISVILAVMMYRSKATQKLNNIAYALIIGGALGNLFDRLWHGFVVDMI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
             +   W FA FNLAD  I +G  +I+ +  +    +K
Sbjct: 126 DFYVGDWHFATFNLADTAICVGAALIVLEGFLPSRAKK 163


>gi|251794005|ref|YP_003008737.1| lipoprotein signal peptidase [Aggregatibacter aphrophilus NJ8700]
 gi|247535404|gb|ACS98650.1| signal peptidase II [Aggregatibacter aphrophilus NJ8700]
          Length = 164

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 28/100 (28%), Positives = 48/100 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + + ++I   + +   K+   + + +  Y LI  GAL N VD    GYVID+ 
Sbjct: 65  GWQKFFFIGLAVVISCMLLYFMAKSEAGQKLQNAAYALIIGGALANAVDRAYNGYVIDFF 124

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
             + + W + VFN+AD+ I +G  +I  D      +Q+ K
Sbjct: 125 DFYWRDWHYPVFNVADIAICVGAALIALDAFKQGKKQEQK 164


>gi|207723592|ref|YP_002253991.1| lipoprotein signal peptidase [Ralstonia solanacearum MolK2]
 gi|206588794|emb|CAQ35757.1| lipoprotein signal peptidase [Ralstonia solanacearum MolK2]
          Length = 174

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 49/96 (51%), Gaps = 1/96 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    + +    FI ++ +++   + +F     LI  GALGNV+D  ++G+V+D++
Sbjct: 80  GWQRWFFTGLGVAAALFIVWLLRRH-SGQKLFCFALALILGGALGNVIDRVIHGHVVDFL 138

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
             H   + +  FN+AD  I IG  ++I D++    R
Sbjct: 139 DFHLHGYHWPAFNVADCGICIGAVLLIIDELRRVRR 174


>gi|239814274|ref|YP_002943184.1| lipoprotein signal peptidase [Variovorax paradoxus S110]
 gi|239800851|gb|ACS17918.1| lipoprotein signal peptidase [Variovorax paradoxus S110]
          Length = 170

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 30/99 (30%), Positives = 49/99 (49%), Gaps = 1/99 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S        +I +    FI ++  K+   + +F      I  GA+GNV+D  ++GYV+D+
Sbjct: 73  SGWQRWFFTAIGVAAAVFIVWML-KSHAGQKLFSFSMACILGGAIGNVIDRMMHGYVVDF 131

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
           +  H   W F  FN AD  I++G   ++ D+I    R K
Sbjct: 132 LSFHVGNWYFPAFNAADSAITLGAICLVLDEIRRVRRGK 170


>gi|296157166|ref|ZP_06840002.1| lipoprotein signal peptidase [Burkholderia sp. Ch1-1]
 gi|295892502|gb|EFG72284.1| lipoprotein signal peptidase [Burkholderia sp. Ch1-1]
          Length = 173

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 29/98 (29%), Positives = 52/98 (53%), Gaps = 1/98 (1%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           M          ++ ++    I ++ K++   + +F     LI  GALGNV+D   YG+VI
Sbjct: 73  MAGGWQRWAFTALGVVAALVICYLLKRHG-GQKMFCTALALILGGALGNVIDRLAYGHVI 131

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
           D++  H +TW +  FNLAD  I++G  +++ D++    
Sbjct: 132 DFLDFHVRTWHWPAFNLADSAITVGAILLVLDELRRVR 169


>gi|188492728|ref|ZP_02999998.1| signal peptidase II [Escherichia coli 53638]
 gi|194439695|ref|ZP_03071765.1| signal peptidase II [Escherichia coli 101-1]
 gi|253774941|ref|YP_003037772.1| lipoprotein signal peptidase [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|254160153|ref|YP_003043261.1| lipoprotein signal peptidase [Escherichia coli B str. REL606]
 gi|297517213|ref|ZP_06935599.1| lipoprotein signal peptidase [Escherichia coli OP50]
 gi|300928678|ref|ZP_07144197.1| signal peptidase II [Escherichia coli MS 187-1]
 gi|188487927|gb|EDU63030.1| signal peptidase II [Escherichia coli 53638]
 gi|194421380|gb|EDX37397.1| signal peptidase II [Escherichia coli 101-1]
 gi|242375867|emb|CAQ30547.1| prolipoprotein signal peptidase II [Escherichia coli BL21(DE3)]
 gi|253325985|gb|ACT30587.1| lipoprotein signal peptidase [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|253972054|gb|ACT37725.1| signal peptidase II [Escherichia coli B str. REL606]
 gi|253976263|gb|ACT41933.1| signal peptidase II [Escherichia coli BL21(DE3)]
 gi|300463347|gb|EFK26840.1| signal peptidase II [Escherichia coli MS 187-1]
 gi|323959974|gb|EGB55620.1| signal peptidase II [Escherichia coli H489]
 gi|323970698|gb|EGB65952.1| signal peptidase II [Escherichia coli TA007]
          Length = 164

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 30/98 (30%), Positives = 48/98 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I   +  +  ++  T+ + +I Y LI  GALGN+ D   +G+V+D I
Sbjct: 66  GWQRWFFAGIAIGISVILAVMMYRSKATQKLNNIAYALIIGGALGNLFDRLWHGFVVDMI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
             +   W FA FNLAD  I +G  +I+ +  +    +K
Sbjct: 126 DFYVGGWHFATFNLADTAICVGAALIVLEGFLPSKAKK 163


>gi|262377097|ref|ZP_06070322.1| signal peptidase II [Acinetobacter lwoffii SH145]
 gi|262307835|gb|EEY88973.1| signal peptidase II [Acinetobacter lwoffii SH145]
          Length = 179

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 48/97 (49%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   S+  L+     F   + PK   I  +   LI  GA+GN++D    GYV+D+I
Sbjct: 74  GWQRYFFTSLAGLVSVIFVFWLMRMPKDMKILPLAIALILGGAIGNLIDRVSLGYVVDFI 133

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
            ++ Q   F  FN+AD  I++GT +++ D   L+  +
Sbjct: 134 HVYYQNSHFPAFNIADSAITVGTILMLIDTFFLEKHR 170


>gi|95928498|ref|ZP_01311245.1| lipoprotein signal peptidase [Desulfuromonas acetoxidans DSM 684]
 gi|95135288|gb|EAT16940.1| lipoprotein signal peptidase [Desulfuromonas acetoxidans DSM 684]
          Length = 162

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 27/100 (27%), Positives = 52/100 (52%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S +   +L  + ++    I +++ K P T      G  L+ +GALGN++D    G VID+
Sbjct: 61  SELRLPLLSGVALIACGVIGWMFCKLPLTAFWQRFGLALVFSGALGNLIDRVRLGVVIDF 120

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           + +H     +  FN+AD  I++G  +++ D    + R++ 
Sbjct: 121 LDVHWYHHHWPAFNVADSAITVGVGLLLVDLWQEERRKRK 160


>gi|301024770|ref|ZP_07188408.1| signal peptidase II [Escherichia coli MS 196-1]
 gi|309787319|ref|ZP_07681931.1| signal peptidase II [Shigella dysenteriae 1617]
 gi|299880260|gb|EFI88471.1| signal peptidase II [Escherichia coli MS 196-1]
 gi|308924897|gb|EFP70392.1| signal peptidase II [Shigella dysenteriae 1617]
          Length = 146

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 30/98 (30%), Positives = 48/98 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I   +  +  ++  T+ + +I Y LI  GALGN+ D   +G+V+D I
Sbjct: 48  GWQRWFFAGIAIGISVILAVMMYRSKATQKLNNIAYALIIGGALGNLFDRLWHGFVVDMI 107

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
             +   W FA FNLAD  I +G  +I+ +  +    +K
Sbjct: 108 DFYVGDWHFATFNLADTAICVGAALIVLEGFLPSKAKK 145


>gi|262274900|ref|ZP_06052711.1| lipoprotein signal peptidase [Grimontia hollisae CIP 101886]
 gi|262221463|gb|EEY72777.1| lipoprotein signal peptidase [Grimontia hollisae CIP 101886]
          Length = 170

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 23/102 (22%), Positives = 51/102 (50%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I + +   + +  +  P +  I +I Y L+  GA+GN+ D  ++G+V+D++
Sbjct: 69  GWQRWFFAIIALSVSGLLMYWMRSTPASNRILNIAYALVIGGAIGNLFDRLVHGFVVDFL 128

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
             +  +  +  FNLAD  I +G  +I+ + +I   + + + +
Sbjct: 129 DFYLGSNHWPAFNLADTAIVVGAGLIVLESVIASKKPQAEAE 170


>gi|71908658|ref|YP_286245.1| signal peptidase II [Dechloromonas aromatica RCB]
 gi|71848279|gb|AAZ47775.1| signal peptidase II, Aspartic peptidase, MEROPS family A08
           [Dechloromonas aromatica RCB]
          Length = 159

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 22/99 (22%), Positives = 51/99 (51%), Gaps = 1/99 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    + + +  +I F+ +++P  + +  +   L+  GALGNV+D   +G V+D+I
Sbjct: 61  GWQRWFFALLALAVSGWIAFMLRQHP-QQKLLSLALALVMGGALGNVIDRIRFGAVVDFI 119

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
             H   + +  FN+AD  I++G  +++ + +    +++ 
Sbjct: 120 QWHAAGYYWPAFNVADSAITVGAVLLVLEQLTSAKQKEN 158


>gi|91784974|ref|YP_560180.1| signal peptidase II [Burkholderia xenovorans LB400]
 gi|91688928|gb|ABE32128.1| signal peptidase II, Aspartic peptidase, MEROPS family A08
           [Burkholderia xenovorans LB400]
          Length = 172

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 29/98 (29%), Positives = 52/98 (53%), Gaps = 1/98 (1%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           M          ++ ++    I ++ K++   + +F     LI  GALGNV+D   YG+VI
Sbjct: 73  MAGGWQRWAFTALGVVAALVICYLLKRHG-GQKMFCTALALILGGALGNVIDRLAYGHVI 131

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
           D++  H +TW +  FNLAD  I++G  +++ D++    
Sbjct: 132 DFLDFHVRTWHWPAFNLADSAITVGAVLLVLDELRRVR 169


>gi|330909873|gb|EGH38383.1| lipoprotein signal peptidase [Escherichia coli AA86]
          Length = 164

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 30/98 (30%), Positives = 48/98 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I   +  +  ++  T+ + +I Y LI  GALGN+ D   +G+V+D I
Sbjct: 66  GWQRWFFAGIAIGISVILAVMMYRSKATQKLNNIAYALIIGGALGNLFDRLWHGFVVDMI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
             +   W FA FNLAD  I +G  +I+ +  +    +K
Sbjct: 126 DFYVGDWHFATFNLADTAICVGAALIVLEGFLPSKAKK 163


>gi|254508959|ref|ZP_05121066.1| signal peptidase II [Vibrio parahaemolyticus 16]
 gi|219548134|gb|EED25152.1| signal peptidase II [Vibrio parahaemolyticus 16]
          Length = 167

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 28/100 (28%), Positives = 47/100 (47%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +     +   I  ++   + +   K P  +   +I Y +I  GA+GNV D  ++G+V+DY
Sbjct: 68  AGWQRWLFTGIAFVVTGMLTYWMSKLPSKEKWNNIAYAMIIGGAVGNVFDRVVHGFVVDY 127

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           +      + +  FNLAD  I IG  +II D    +   K 
Sbjct: 128 LDFFWGDYHWPAFNLADTTICIGAAMIILDGFRNKEEAKA 167


>gi|300939437|ref|ZP_07154099.1| signal peptidase II [Escherichia coli MS 21-1]
 gi|300455658|gb|EFK19151.1| signal peptidase II [Escherichia coli MS 21-1]
          Length = 164

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 30/98 (30%), Positives = 48/98 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I   +  +  ++  T+ + +I Y LI  GALGN+ D   +G+V+D I
Sbjct: 66  GWQRWFFAGIAIGISVILAVMMYRSKATQKLNNIAYALIIGGALGNLFDRLWHGFVVDMI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
             +   W FA FNLAD  I +G  +I+ +  +    +K
Sbjct: 126 DFYVGDWHFATFNLADTAICVGAALIVLEGFLPSKAKK 163


>gi|194434552|ref|ZP_03066810.1| signal peptidase II [Shigella dysenteriae 1012]
 gi|194417205|gb|EDX33316.1| signal peptidase II [Shigella dysenteriae 1012]
 gi|320179584|gb|EFW54533.1| Lipoprotein signal peptidase [Shigella boydii ATCC 9905]
 gi|332095312|gb|EGJ00335.1| signal peptidase II [Shigella boydii 5216-82]
 gi|332098360|gb|EGJ03333.1| signal peptidase II [Shigella dysenteriae 155-74]
          Length = 160

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 30/98 (30%), Positives = 48/98 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I   +  +  ++  T+ + +I Y LI  GALGN+ D   +G+V+D I
Sbjct: 62  GWQRWFFAGIAIGISVILAVMMYRSKATQKLNNIAYALIIGGALGNLFDRLWHGFVVDMI 121

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
             +   W FA FNLAD  I +G  +I+ +  +    +K
Sbjct: 122 DFYVGDWHFATFNLADTAICVGAALIVLEGFLPSKAKK 159


>gi|293391735|ref|ZP_06636069.1| signal peptidase II [Aggregatibacter actinomycetemcomitans D7S-1]
 gi|290952269|gb|EFE02388.1| signal peptidase II [Aggregatibacter actinomycetemcomitans D7S-1]
          Length = 164

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 29/100 (29%), Positives = 52/100 (52%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  +++ + I A + +   KN   + + +  Y LI  GALGN  D   +GYV+D++
Sbjct: 65  GWQKFFFLALAVGISAMLVYFLMKNRHEQKLLNAAYALIIGGALGNAADRLYHGYVVDFL 124

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
             + + W + VFN+AD+ I +G  +I  D     ++Q+ K
Sbjct: 125 DFYWRDWHYPVFNVADIAICVGAGLIALDAFKNGNKQERK 164


>gi|323697807|ref|ZP_08109719.1| lipoprotein signal peptidase [Desulfovibrio sp. ND132]
 gi|323457739|gb|EGB13604.1| lipoprotein signal peptidase [Desulfovibrio desulfuricans ND132]
          Length = 166

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 20/99 (20%), Positives = 45/99 (45%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
           +    + + I +  +  I ++ +           G  +I  GA+GN +D    G VID++
Sbjct: 63  DWQRPLFILISLAAVLVIAYMIRLTRDGDRWMLAGLGMIAGGAVGNAIDRLWLGSVIDFL 122

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
             +  ++ +  FN+AD  +++G   II   ++ +   + 
Sbjct: 123 DFYAGSYHWPAFNVADSALTVGAGCIIVSTLLNRGDTRK 161


>gi|110804094|ref|YP_687614.1| lipoprotein signal peptidase [Shigella flexneri 5 str. 8401]
 gi|123048490|sp|Q0T8G7|LSPA_SHIF8 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|110613642|gb|ABF02309.1| prolipoprotein signal peptidase (SPase II) [Shigella flexneri 5
           str. 8401]
          Length = 164

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 30/98 (30%), Positives = 48/98 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I   +  +  ++  T+ + +I Y LI  GALGN+ D   +G+V+D I
Sbjct: 66  GWQRWFFAGIAIGISVLLAVMMYRSKATQKLNNIAYALIIGGALGNLFDRLWHGFVVDMI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
             +   W FA FNLAD  I +G  +I+ +  +    +K
Sbjct: 126 DFYVGDWHFATFNLADTAICVGAALIVLEGFLPSKAKK 163


>gi|170768465|ref|ZP_02902918.1| signal peptidase II [Escherichia albertii TW07627]
 gi|170122569|gb|EDS91500.1| signal peptidase II [Escherichia albertii TW07627]
          Length = 146

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 30/98 (30%), Positives = 48/98 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I   +  +  ++  T+ + +I Y LI  GALGN+ D   +G+V+D I
Sbjct: 48  GWQRWFFAGIAIGISVILTVMMYRSKATQKLNNIAYALIIGGALGNLFDRLWHGFVVDMI 107

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
             +   W FA FNLAD  I +G  +I+ +  +    +K
Sbjct: 108 DFYVGDWHFATFNLADTAICVGAALIVLEGFLPSKAKK 145


>gi|82542643|ref|YP_406590.1| lipoprotein signal peptidase [Shigella boydii Sb227]
 gi|123560616|sp|Q326J6|LSPA_SHIBS RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|81244054|gb|ABB64762.1| prolipoprotein signal peptidase [Shigella boydii Sb227]
 gi|332090439|gb|EGI95537.1| signal peptidase II [Shigella boydii 3594-74]
          Length = 164

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 30/98 (30%), Positives = 47/98 (47%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I   +  +  +   T+ + +I Y LI  GALGN+ D   +G+V+D I
Sbjct: 66  GWQRWFFAGIAIGISVILAVMMYRLKATQKLNNIAYALIIGGALGNLFDRLWHGFVVDMI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
             +   W FA FNLAD  I +G  +I+ +  +    +K
Sbjct: 126 DFYVGDWHFATFNLADTAICVGAALIVLEGFLPSRAKK 163


>gi|319897484|ref|YP_004135681.1| lipoprotein signal peptidase [Haemophilus influenzae F3031]
 gi|329123027|ref|ZP_08251598.1| signal peptidase II [Haemophilus aegyptius ATCC 11116]
 gi|317432990|emb|CBY81361.1| lipoprotein signal peptidase [Haemophilus influenzae F3031]
 gi|327471958|gb|EGF17398.1| signal peptidase II [Haemophilus aegyptius ATCC 11116]
          Length = 171

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 25/98 (25%), Positives = 46/98 (46%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S       + + + I   + +   KN   + I +  Y LI  GAL N+ D    G+V+D+
Sbjct: 62  SGWQQYFFILLALAISGMLVYFLAKNNAEQKIQNSAYALIIGGALANMADRAYNGFVVDF 121

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
              +   + + VFN+AD+ I IG  ++  D    + ++
Sbjct: 122 FDFYWDIYHYPVFNIADIAICIGAGLLALDAFKSEKKK 159


>gi|157147565|ref|YP_001454884.1| lipoprotein signal peptidase [Citrobacter koseri ATCC BAA-895]
 gi|166232863|sp|A8ALT5|LSPA_CITK8 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|157084770|gb|ABV14448.1| hypothetical protein CKO_03365 [Citrobacter koseri ATCC BAA-895]
          Length = 162

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 30/96 (31%), Positives = 48/96 (50%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I   +  +  ++  T+ + +I Y LI  GALGN+ D   +G+V+D I
Sbjct: 66  GWQRWFFAGIAIGICVILMVMMYRSKATQKLNNIAYALIIGGALGNLFDRLWHGFVVDMI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
             +   W FA FNLAD  I IG  +I+ +  + + +
Sbjct: 126 DFYVGDWHFATFNLADSAICIGAALIVLEGFLPKKQ 161


>gi|326560979|gb|EGE11344.1| lipoprotein signal peptidase [Moraxella catarrhalis 7169]
 gi|326563785|gb|EGE14036.1| lipoprotein signal peptidase [Moraxella catarrhalis 46P47B1]
 gi|326563968|gb|EGE14218.1| lipoprotein signal peptidase [Moraxella catarrhalis 12P80B1]
 gi|326566798|gb|EGE16937.1| lipoprotein signal peptidase [Moraxella catarrhalis 103P14B1]
 gi|326567362|gb|EGE17477.1| lipoprotein signal peptidase [Moraxella catarrhalis BC1]
 gi|326576711|gb|EGE26618.1| lipoprotein signal peptidase [Moraxella catarrhalis 101P30B1]
 gi|326577615|gb|EGE27492.1| lipoprotein signal peptidase [Moraxella catarrhalis O35E]
          Length = 170

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 33/101 (32%), Positives = 60/101 (59%), Gaps = 1/101 (0%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +         + +++  FI    KK PKT +I ++G  L+  GA+GNV+D  L+ +V+D+
Sbjct: 69  NGWQKWFFAILGLIVSGFIIIYLKKAPKTANILNLGLSLVLGGAIGNVIDRILHNHVVDF 128

Query: 63  IMIHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           I +H    W + +FN+AD+ I +G  +IIYD + L+ +++ 
Sbjct: 129 IHVHYADVWHYPIFNIADIGICVGMAMIIYDMLFLEKKRRS 169


>gi|53803699|ref|YP_114672.1| signal peptidase II [Methylococcus capsulatus str. Bath]
 gi|53757460|gb|AAU91751.1| signal peptidase II [Methylococcus capsulatus str. Bath]
          Length = 158

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 23/94 (24%), Positives = 46/94 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  +++       I +  K   + K+     + L+  GA+GN++D  +YGYVID++
Sbjct: 62  GWQRWFFIALSASATLLITYWLKHMDRRKTWEAAAWALVLGGAVGNLLDRIVYGYVIDFL 121

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQ 97
            +    W +  FN+AD  I++G  +++ D    +
Sbjct: 122 DVFYGDWHWPAFNVADSAITVGIGMLLIDSFRGR 155


>gi|332289399|ref|YP_004420251.1| lipoprotein signal peptidase [Gallibacterium anatis UMN179]
 gi|330432295|gb|AEC17354.1| lipoprotein signal peptidase [Gallibacterium anatis UMN179]
          Length = 166

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 31/104 (29%), Positives = 55/104 (52%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S       V I ++I A + F   K P+ K + +  Y LI  GAL N+ D   +G+V+D+
Sbjct: 63  SGWQKYFFVLIAVVISALLLFWLAKTPRQKILVNSAYALIIGGALANMTDRLYHGFVVDF 122

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDF 106
           +  + + + + VFN+AD+ I +G  ++I D +  + +Q    D 
Sbjct: 123 LDFYWRIYHYPVFNVADIAICVGAGLLILDYLKNERKQVKGKDE 166


>gi|326571515|gb|EGE21530.1| lipoprotein signal peptidase [Moraxella catarrhalis BC7]
          Length = 170

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 32/101 (31%), Positives = 59/101 (58%), Gaps = 1/101 (0%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +         + +++   I    KK PKT +I ++G  L+  GA+GNV+D  L+ +V+D+
Sbjct: 69  NGWQKWFFAILGLIVSGCIIIYLKKAPKTANILNLGLSLVLGGAIGNVIDRILHNHVVDF 128

Query: 63  IMIHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           I +H    W + +FN+AD+ I +G  +IIYD + L+ +++ 
Sbjct: 129 IHVHYADVWHYPIFNIADIGICVGMAMIIYDMLFLEKKRRS 169


>gi|320186138|gb|EFW60880.1| Lipoprotein signal peptidase [Shigella flexneri CDC 796-83]
 gi|323181721|gb|EFZ67134.1| signal peptidase II [Escherichia coli 1357]
          Length = 146

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 30/98 (30%), Positives = 48/98 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I   +  +  ++  T+ + +I Y LI  GALGN+ D   +G+V+D I
Sbjct: 48  GWQRWFFAGIAIGISVILAVMMYRSKATQKLNNIAYALIIGGALGNLFDRLWHGFVVDMI 107

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
             +   W FA FNLAD  I +G  +I+ +  +    +K
Sbjct: 108 DFYVGDWHFATFNLADTAICVGAALIVLEGFLPSRAKK 145


>gi|326569878|gb|EGE19928.1| lipoprotein signal peptidase [Moraxella catarrhalis BC8]
          Length = 170

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 32/101 (31%), Positives = 59/101 (58%), Gaps = 1/101 (0%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +         + +++   I    KK PKT +I ++G  L+  GA+GNV+D  L+ +V+D+
Sbjct: 69  NGWQKWFFAILGLIVSGCIIIYLKKAPKTANILNLGLSLVLGGAIGNVIDRILHNHVVDF 128

Query: 63  IMIHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           I +H    W + +FN+AD+ I +G  +IIYD + L+ +++ 
Sbjct: 129 IHVHYADVWHYPIFNIADIGICVGMAMIIYDMLFLEKKRRS 169


>gi|253690013|ref|YP_003019203.1| lipoprotein signal peptidase [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251756591|gb|ACT14667.1| lipoprotein signal peptidase [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 170

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 29/92 (31%), Positives = 44/92 (47%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I+  +  +  +      + +I Y LI  GALGN+ D   +G+V+D+I
Sbjct: 65  GWQRWFFAGIAIAIVVALLVMMYRGSVKHRLNNIAYSLIIGGALGNLFDRTWHGFVVDFI 124

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDII 95
             +   W FA FNLAD  I IG  +I+ +   
Sbjct: 125 DFYVGDWHFATFNLADTAICIGAALIVLEGFF 156


>gi|227114255|ref|ZP_03827911.1| lipoprotein signal peptidase [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 170

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 29/92 (31%), Positives = 44/92 (47%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I+  +  +  +      + +I Y LI  GALGN+ D   +G+V+D+I
Sbjct: 65  GWQRWFFAGIAIAIVVALLVMMYRGSVKHRLNNIAYSLIIGGALGNLFDRTWHGFVVDFI 124

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDII 95
             +   W FA FNLAD  I IG  +I+ +   
Sbjct: 125 DFYVGDWHFATFNLADTAICIGAALIVLEGFF 156


>gi|319792055|ref|YP_004153695.1| lipoprotein signal peptidase [Variovorax paradoxus EPS]
 gi|315594518|gb|ADU35584.1| lipoprotein signal peptidase [Variovorax paradoxus EPS]
          Length = 172

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 31/99 (31%), Positives = 49/99 (49%), Gaps = 1/99 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S        +I +    FI ++  ++   + +F      I  GA+GNVVD  ++GYV+D+
Sbjct: 75  SGWQRWFFTAIGVAAAIFIVWML-RSHAGQKLFSFAMACILGGAIGNVVDRMMHGYVVDF 133

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
           +  H   W F  FN AD  I++G   +I D+I    R K
Sbjct: 134 LSFHAGNWYFPAFNAADSAITLGAICLIVDEIRRVRRGK 172


>gi|327479530|gb|AEA82840.1| lipoprotein signal peptidase [Pseudomonas stutzeri DSM 4166]
          Length = 167

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 27/104 (25%), Positives = 50/104 (48%), Gaps = 1/104 (0%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S     +  +I I +   +    K+   +++   +   L+  GALGN+ D  + G+V+D+
Sbjct: 64  SGWQRWLFAAIAIGVSVVLVVWLKRLKASETWLAVALALVLGGALGNLYDRVVLGHVVDF 123

Query: 63  IMIHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
           I++H Q  W F  FN+AD  I++G  ++  D        +   D
Sbjct: 124 ILVHWQNRWYFPAFNIADSAITVGAVMLALDMFKGNKTGESAHD 167


>gi|134094806|ref|YP_001099881.1| prolipoprotein signal peptidase [Herminiimonas arsenicoxydans]
 gi|133738709|emb|CAL61754.1| Lipoprotein signal peptidase (Prolipoprotein signal peptidase)
           (Signal peptidase II) (SPase II) [Herminiimonas
           arsenicoxydans]
          Length = 190

 Score =  103 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 24/91 (26%), Positives = 46/91 (50%), Gaps = 2/91 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  +++  ++  ++    +K  +  ++    Y LI  GALGN +D  L GYV+DY+
Sbjct: 75  GWQRYFFITLAFVVSMWLALELRK--QLPTLSAWAYSLILGGALGNAIDRLLRGYVVDYL 132

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDI 94
             H   W +  FN+AD+ I  G  +++ + +
Sbjct: 133 DFHWSGWHWPAFNVADIGIVCGAVLLVVESL 163


>gi|227329316|ref|ZP_03833340.1| lipoprotein signal peptidase [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
          Length = 170

 Score =  103 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 29/92 (31%), Positives = 45/92 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I+  +  +  +    + + +I Y LI  GALGN+ D   +G+V+D+I
Sbjct: 65  GWQRWFFAGIAIAIVVALLVMMYRGSVKQRLNNIAYSLIIGGALGNLFDRTWHGFVVDFI 124

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDII 95
             +   W FA FNLAD  I IG  +I+ +   
Sbjct: 125 DFYVGDWHFATFNLADTAICIGAALIVLEGFF 156


>gi|332531436|ref|ZP_08407340.1| lipoprotein signal peptidase [Hylemonella gracilis ATCC 19624]
 gi|332039105|gb|EGI75527.1| lipoprotein signal peptidase [Hylemonella gracilis ATCC 19624]
          Length = 178

 Score =  103 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 25/98 (25%), Positives = 50/98 (51%), Gaps = 1/98 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + + ++ + F+ ++   +   + +F     L+  GA+GNV+D  ++GYV+D I
Sbjct: 82  GWQRWFFIVLGVVAVLFMVYLLL-SHAGQRLFCFALALLMGGAVGNVLDRLIHGYVVDMI 140

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
             H   W F  FNLAD  +++G   ++ D++    R +
Sbjct: 141 DFHIGRWHFPAFNLADSALTLGVVFLLIDELRRVRRTR 178


>gi|291616223|ref|YP_003518965.1| LspA [Pantoea ananatis LMG 20103]
 gi|291151253|gb|ADD75837.1| LspA [Pantoea ananatis LMG 20103]
 gi|327392674|dbj|BAK10096.1| lipoprotein signal peptidase LspA [Pantoea ananatis AJ13355]
          Length = 167

 Score =  103 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 28/100 (28%), Positives = 50/100 (50%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I + I+  +  +  +N  ++ I +I Y LI  GA+GN+ D   +G+V+D+I
Sbjct: 66  GWQRWFFAGIALAIVVSLLVMMYRNSASQKIANIAYALIIGGAVGNLFDRSYHGFVVDFI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
             +   W FA FN+AD  I IG  +++ +       ++ K
Sbjct: 126 DFYVGNWHFATFNIADCGICIGAALVVLEGFFNPSSKQVK 165


>gi|261823080|ref|YP_003261186.1| lipoprotein signal peptidase [Pectobacterium wasabiae WPP163]
 gi|261607093|gb|ACX89579.1| lipoprotein signal peptidase [Pectobacterium wasabiae WPP163]
          Length = 170

 Score =  103 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 29/92 (31%), Positives = 45/92 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I+  +  +  +    + + +I Y LI  GALGN+ D   +G+V+D+I
Sbjct: 65  GWQRWFFAGIAIAIVVALVVMMYRGSVKQKLNNIAYSLIIGGALGNLFDRTWHGFVVDFI 124

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDII 95
             +   W FA FNLAD  I IG  +I+ +   
Sbjct: 125 DFYVGDWHFATFNLADTAICIGAALIVLEGFF 156


>gi|121595700|ref|YP_987596.1| lipoprotein signal peptidase [Acidovorax sp. JS42]
 gi|120607780|gb|ABM43520.1| signal peptidase II [Acidovorax sp. JS42]
          Length = 165

 Score =  103 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 29/96 (30%), Positives = 49/96 (51%), Gaps = 1/96 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +   I +    FI +  + +P  + +F      I  GA+GNVVD   +GYV+D++
Sbjct: 69  GWQRWLFTGIALATAVFILWQLRAHP-GQKLFCFALSSILGGAIGNVVDRLQHGYVVDFL 127

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
             H + W F  FN+AD  I++G   +I D+++   R
Sbjct: 128 DFHLRGWHFPAFNVADCAITVGAACLILDELLRVRR 163


>gi|134094084|ref|YP_001099159.1| lipoprotein signal peptidase [Herminiimonas arsenicoxydans]
 gi|133737987|emb|CAL61032.1| Lipoprotein signal peptidase (Prolipoprotein signal peptidase)
           (Signal peptidase II) (SPase II) [Herminiimonas
           arsenicoxydans]
          Length = 166

 Score =  103 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 32/96 (33%), Positives = 51/96 (53%), Gaps = 1/96 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I   AFI ++ KKN + + +      LI  GA+GNV+D  LYG+VID++
Sbjct: 67  GWQRHFFTVIGIGASAFIIYLLKKN-QGQRLLSWALTLILGGAIGNVIDRILYGHVIDFL 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
            ++   W +  FN+AD  I IG  + +YD++    +
Sbjct: 126 DVYIGNWHWPAFNIADSAICIGAVLFVYDELKRSKK 161


>gi|312795296|ref|YP_004028218.1| lipoprotein signal peptidase [Burkholderia rhizoxinica HKI 454]
 gi|312167071|emb|CBW74074.1| Lipoprotein signal peptidase (EC 3.4.23.36) [Burkholderia
           rhizoxinica HKI 454]
          Length = 168

 Score =  103 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 27/95 (28%), Positives = 50/95 (52%), Gaps = 1/95 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   ++ I+    I ++ K++   + +F     LI  GALGNV+D  ++G+VID++
Sbjct: 72  GWQRWAFTALGIVAALVIAWLLKRH-SGQKLFCTALALILGGALGNVIDRLVHGHVIDFV 130

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
             H   W +  FN+AD  I+IG  +++ D++    
Sbjct: 131 DFHVGGWHWPAFNIADSGITIGAVLLVLDELRRVR 165


>gi|190890064|ref|YP_001976606.1| lipoprotein signal peptidase [Rhizobium etli CIAT 652]
 gi|190695343|gb|ACE89428.1| lipoprotein signal peptidase protein [Rhizobium etli CIAT 652]
 gi|327188567|gb|EGE55777.1| lipoprotein signal peptidase protein [Rhizobium etli CNPAF512]
          Length = 167

 Score =  103 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 45/99 (45%), Positives = 70/99 (70%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           MLS +    +V +R++I+AF+ ++W +  K + +  +GY LI  GA+GN+VD   YG+VI
Sbjct: 66  MLSGMDGWFIVGMRLVIVAFVVWLWYRTAKDRWLAHLGYALIIAGAIGNLVDRFAYGHVI 125

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
           DYI+ +T +WSFAVFNLAD FI+IG   +I D+++L  +
Sbjct: 126 DYILFYTASWSFAVFNLADSFITIGAACVILDELLLPKK 164


>gi|212636472|ref|YP_002312997.1| lipoprotein signal peptidase [Shewanella piezotolerans WP3]
 gi|226694561|sp|B8CSC0|LSPA_SHEPW RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|212557956|gb|ACJ30410.1| Peptidase A8, signal peptidase II [Shewanella piezotolerans WP3]
          Length = 170

 Score =  103 bits (259), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 25/105 (23%), Positives = 47/105 (44%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +   + +     +    ++        ++ Y L+  GALGN++D   +G+V+D++
Sbjct: 66  GWQRWLFTFVAVGFSILLSVWLRQQSTKMWRLNLAYTLVIGGALGNLIDRLQHGFVVDFL 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDFPQ 108
             + +T  F  FN+AD  I IG  +II D  +     K   D  +
Sbjct: 126 DFYWKTSHFPAFNIADSAICIGAGLIILDSFVSGKDVKKSDDIKE 170


>gi|6630989|gb|AAF19640.1|AF201388_2 prolipoprotein signal peptidase II [Klebsiella pneumoniae]
          Length = 166

 Score =  103 bits (259), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 31/101 (30%), Positives = 49/101 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I   +  +  ++  T+ + +I Y LI  GALGN+ D   +G+V+D I
Sbjct: 66  GWQRWFFSGIAIGICVVLTVLMYRSKATQKLNNIAYALIIGGALGNLFDRLWHGFVVDMI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
             +   W FA FNLAD  I IG  +I+ +  + +   K + 
Sbjct: 126 DFYVGDWHFATFNLADSAICIGARLIVLEGFLPKPTVKEQA 166


>gi|78221573|ref|YP_383320.1| lipoprotein signal peptidase [Geobacter metallireducens GS-15]
 gi|123572813|sp|Q39YS9|LSPA_GEOMG RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|78192828|gb|ABB30595.1| signal peptidase II, Aspartic peptidase, MEROPS family A08
           [Geobacter metallireducens GS-15]
          Length = 162

 Score =  103 bits (259), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 25/99 (25%), Positives = 52/99 (52%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
           +      +++ ++ +A I   ++K    + +  +   LI +GA+GN++D    G VID++
Sbjct: 62  DYRRPFFIAVTLVAMAAIAITFRKLRDDQRLAAVSLSLIFSGAVGNLIDRVRLGEVIDFL 121

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
            ++ +T  +  FN+AD  I +G  ++  D I  + RQ  
Sbjct: 122 DVYWKTHHWPAFNVADSAICVGVALLALDMIRDERRQSK 160


>gi|170697700|ref|ZP_02888788.1| lipoprotein signal peptidase [Burkholderia ambifaria IOP40-10]
 gi|172061473|ref|YP_001809125.1| lipoprotein signal peptidase [Burkholderia ambifaria MC40-6]
 gi|238058045|sp|B1YVA5|LSPA_BURA4 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|170137448|gb|EDT05688.1| lipoprotein signal peptidase [Burkholderia ambifaria IOP40-10]
 gi|171993990|gb|ACB64909.1| lipoprotein signal peptidase [Burkholderia ambifaria MC40-6]
          Length = 166

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 31/96 (32%), Positives = 52/96 (54%), Gaps = 1/96 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S        ++ I     I F+ +++   + +F +   LI  GALGNV+D  +YG+VID+
Sbjct: 69  SGWQRWAFTALGIGATLVICFLLRRHG-QQRLFSLSLALILGGALGNVIDRLVYGHVIDF 127

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
           +  H   W F  FNLAD  I++G  +++YD++    
Sbjct: 128 LDFHVGGWHFPAFNLADSAITVGAVLLVYDELRRVR 163


>gi|296112726|ref|YP_003626664.1| signal peptidase II [Moraxella catarrhalis RH4]
 gi|295920420|gb|ADG60771.1| signal peptidase II [Moraxella catarrhalis RH4]
 gi|326575203|gb|EGE25131.1| lipoprotein signal peptidase [Moraxella catarrhalis CO72]
          Length = 170

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 33/101 (32%), Positives = 60/101 (59%), Gaps = 1/101 (0%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +         + +++  FI    KK PKT +I ++G  L+  GA+GNV+D  L+ +V+D+
Sbjct: 69  NGWQKWFFAILGLIVSGFIIIYLKKAPKTANILNLGLSLVLGGAIGNVIDRILHNHVVDF 128

Query: 63  IMIHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           I +H    W + +FN+AD+ I +G  +IIYD + L+ +++ 
Sbjct: 129 IHVHYADVWHYPIFNIADIGICVGMAMIIYDMLFLEKKRRS 169


>gi|50083316|ref|YP_044826.1| lipoprotein signal peptidase [Acinetobacter sp. ADP1]
 gi|81827567|sp|Q6FG03|LSPA_ACIAD RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|49529292|emb|CAG67004.1| prolipoprotein signal peptidase (Signal peptidase II.)
           [Acinetobacter sp. ADP1]
          Length = 179

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 30/105 (28%), Positives = 50/105 (47%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +   +  ++     F   + PK   I      LI  GALGN++D    GYV+D+I
Sbjct: 74  GWQHYLFTGLAGIVSIIFIFWLMRMPKNAMILPAAIALILGGALGNLIDRMTLGYVVDFI 133

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDFPQ 108
            I+ Q   F  FN+AD  I+IGT +++ D   L+ ++  + +   
Sbjct: 134 HIYYQNHHFPAFNIADSAITIGTILLLIDTFFLEKQRIQRAEVKH 178


>gi|156973300|ref|YP_001444207.1| lipoprotein signal peptidase [Vibrio harveyi ATCC BAA-1116]
 gi|166232881|sp|A7MTD7|LSPA_VIBHB RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|156524894|gb|ABU69980.1| hypothetical protein VIBHAR_00981 [Vibrio harveyi ATCC BAA-1116]
          Length = 168

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 29/99 (29%), Positives = 48/99 (48%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +     +   I  ++   + +   K P  +   +I Y LI  GA+GNV D  ++G+V+DY
Sbjct: 70  AGWQRWLFTGIAFVVTGLLTYWMSKLPAKEKWNNIAYALIIGGAVGNVFDRVVHGFVVDY 129

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
           +     ++ +  FNLAD  I IG  +II D    +   K
Sbjct: 130 LDFFWGSYHWPAFNLADTTICIGAAMIILDGFRKKDANK 168


>gi|283783806|ref|YP_003363671.1| lipoprotein signal peptidase [Citrobacter rodentium ICC168]
 gi|282947260|emb|CBG86805.1| lipoprotein signal peptidase [Citrobacter rodentium ICC168]
          Length = 165

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 31/97 (31%), Positives = 47/97 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I   +  +  +   T+ + +I Y LI  GALGN+ D   +G+V+D I
Sbjct: 66  GWQRWFFAGIAIGICVILTVLMYRAKATQKLNNIAYALIIGGALGNLFDRLWHGFVVDMI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
             +   W FA FNLAD  I IG  +I+ +  I   ++
Sbjct: 126 DFYVGEWHFATFNLADSAICIGAALIVLEGFIPSKQK 162


>gi|153834664|ref|ZP_01987331.1| signal peptidase II [Vibrio harveyi HY01]
 gi|148868916|gb|EDL67974.1| signal peptidase II [Vibrio harveyi HY01]
          Length = 168

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 29/99 (29%), Positives = 48/99 (48%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +     +   I  ++   + +   K P  +   +I Y LI  GA+GNV D  ++G+V+DY
Sbjct: 70  AGWQRWLFTGIAFVVTGLLTYWMSKLPAKEKWNNIAYALIIGGAVGNVFDRVVHGFVVDY 129

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
           +     ++ +  FNLAD  I IG  +II D    +   K
Sbjct: 130 LDFFWGSYHWPAFNLADTTICIGAAMIILDGFRKKDADK 168


>gi|213852225|ref|ZP_03381757.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Typhi str. M223]
          Length = 152

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 31/101 (30%), Positives = 50/101 (49%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
           +        I I I   +  +  ++  T+ + +I Y LI  GALGN+ D   +G+V+D I
Sbjct: 52  SWQRWFFAGIAIGICVILLVMMYRSKATQKLNNIAYALIIGGALGNLFDRLWHGFVVDMI 111

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
             +   W FA FNLAD  I IG  +I+ +  + +   K + 
Sbjct: 112 DFYVGDWHFATFNLADTAICIGAALIVLEGFLPKPTAKEQA 152


>gi|15603528|ref|NP_246602.1| lipoprotein signal peptidase [Pasteurella multocida subsp.
           multocida str. Pm70]
 gi|13431627|sp|P57959|LSPA_PASMU RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|12722069|gb|AAK03747.1| LspA [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 165

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 29/102 (28%), Positives = 54/102 (52%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + + I I   + +   KN  T+ + +I Y LI  GALGN++D   +G+V+D+ 
Sbjct: 64  GWQKYFFIVLAIAISLMLCYFLAKNQATQKLQNIAYALIIGGALGNMIDRLYHGFVVDFF 123

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
             +   + + VFN+AD+ IS+G  ++I D    +H  + + +
Sbjct: 124 DFYWDIYHYPVFNVADIAISLGAGLMILDAFKNRHEPEQRTE 165


>gi|238028414|ref|YP_002912645.1| lipoprotein signal peptidase [Burkholderia glumae BGR1]
 gi|237877608|gb|ACR29941.1| Hypothetical protein bglu_1g28780 [Burkholderia glumae BGR1]
          Length = 166

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 30/96 (31%), Positives = 52/96 (54%), Gaps = 1/96 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S        ++ I     I ++ K++   + +F +   LI  GALGNV+D  +YG+VID+
Sbjct: 69  SGWQRWAFTALGIAATLVICYLLKRHG-HQRLFSLSLALILGGALGNVIDRLMYGHVIDF 127

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
           +  H +   +  FNLAD  I+IG  +++YD++    
Sbjct: 128 LDFHLRGSHWPAFNLADSAITIGAVLLVYDELRRVR 163


>gi|77461072|ref|YP_350579.1| lipoprotein signal peptidase [Pseudomonas fluorescens Pf0-1]
 gi|123603231|sp|Q3K6L6|LSPA_PSEPF RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|77385075|gb|ABA76588.1| lipoprotein signal peptidase [Pseudomonas fluorescens Pf0-1]
          Length = 170

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 47/97 (48%), Gaps = 1/97 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S     +   I I + A +    K+  + ++   I   L+  GALGN+ D    G+VID+
Sbjct: 67  SGWQRWLFALIAIAVSAVLVVWLKRLGRNETWLAIALALVLGGALGNLYDRIALGHVIDF 126

Query: 63  IMIHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQH 98
           I++H Q  W F  FN AD  I++G  ++  D    + 
Sbjct: 127 ILVHWQNRWYFPAFNFADSAITVGAVMLALDMFKSKK 163


>gi|115352611|ref|YP_774450.1| lipoprotein signal peptidase [Burkholderia ambifaria AMMD]
 gi|122322418|sp|Q0BCK7|LSPA_BURCM RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|115282599|gb|ABI88116.1| signal peptidase II, Aspartic peptidase, MEROPS family A08
           [Burkholderia ambifaria AMMD]
          Length = 166

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 32/96 (33%), Positives = 52/96 (54%), Gaps = 1/96 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S        ++ I     I F+ +++   + +F +   LI  GALGNV+D  +YG+VID+
Sbjct: 69  SGWQRWAFTALGIGATLVICFLLRRHG-QQRLFSLSLALILGGALGNVIDRLVYGHVIDF 127

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
           +  H   W F  FNLAD  I+IG  +++YD++    
Sbjct: 128 LDFHVGGWHFPAFNLADSAITIGAVLLVYDELRRVR 163


>gi|241202806|ref|YP_002973902.1| lipoprotein signal peptidase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240856696|gb|ACS54363.1| lipoprotein signal peptidase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 167

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 46/99 (46%), Positives = 71/99 (71%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           MLS +    +V +R++I+AF+ ++W +  K + I  +GY LI  GA+GN+VD   YG+VI
Sbjct: 66  MLSGMDGWFIVGMRLIIVAFVIWLWYRTAKDRWIAHLGYALIIAGAIGNLVDRFAYGHVI 125

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
           DYI+ +T++WSFAVFNLAD FI+IG   +I D+++L  +
Sbjct: 126 DYILFYTESWSFAVFNLADSFITIGAGCVILDELLLPKK 164


>gi|163802405|ref|ZP_02196298.1| signal peptidase II [Vibrio sp. AND4]
 gi|159173706|gb|EDP58521.1| signal peptidase II [Vibrio sp. AND4]
          Length = 168

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 29/99 (29%), Positives = 48/99 (48%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +     +   I  ++   + +   K P  +   +I Y LI  GA+GNV D  ++G+V+DY
Sbjct: 70  AGWQRWLFSGIAFVVTGLLTYWMSKLPAKEKWNNIAYALIIGGAVGNVFDRVVHGFVVDY 129

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
           +     T+ +  FNLAD  I IG  ++I D    +   K
Sbjct: 130 LDFFWGTYHWPAFNLADSTICIGAAMVILDGFRKKDTNK 168


>gi|146281351|ref|YP_001171504.1| lipoprotein signal peptidase [Pseudomonas stutzeri A1501]
 gi|145569556|gb|ABP78662.1| lipoprotein signal peptidase [Pseudomonas stutzeri A1501]
          Length = 167

 Score =  103 bits (258), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 26/104 (25%), Positives = 49/104 (47%), Gaps = 1/104 (0%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S     +  +I I +   +    K+   +++   +   L+  GALGN+ D  + G+V+D+
Sbjct: 64  SGWQRWLFAAIAIGVSVVLVVWLKRLKASETWLAVALALVLGGALGNLYDRVVLGHVVDF 123

Query: 63  IMIHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
           I++H    W F  FN+AD  I++G  ++  D        +   D
Sbjct: 124 ILVHWHNRWYFPAFNIADSAITVGAVMLALDMFKSHKTGESAHD 167


>gi|50122796|ref|YP_051963.1| lipoprotein signal peptidase [Pectobacterium atrosepticum SCRI1043]
 gi|49613322|emb|CAG76773.1| lipoprotein signal peptidase [Pectobacterium atrosepticum SCRI1043]
          Length = 170

 Score =  103 bits (258), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 29/92 (31%), Positives = 45/92 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I+  +  +  +    + + +I Y LI  GALGN+ D   +G+V+D+I
Sbjct: 65  GWQRWFFAGIAIAIVVALLVMMYRGSVKQRLNNIAYSLIIGGALGNLFDRTWHGFVVDFI 124

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDII 95
             +   W FA FNLAD  I IG  +I+ +   
Sbjct: 125 DFYVGNWHFATFNLADTAICIGAALIVLEGFF 156


>gi|227820614|ref|YP_002824584.1| lipoprotein signal peptidase [Sinorhizobium fredii NGR234]
 gi|254810452|sp|C3MEK8|LSPA_RHISN RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|227339613|gb|ACP23831.1| lipoprotein signal peptidase [Sinorhizobium fredii NGR234]
          Length = 166

 Score =  103 bits (258), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 47/102 (46%), Positives = 71/102 (69%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           MLS +    +V +R+ ++AF+ ++W++ PK +    +GY +I  GALGN+VD  L+GYVI
Sbjct: 62  MLSGMEGWFIVGMRLAVVAFVLWLWRRTPKDRFFAHLGYAMIIAGALGNLVDRLLFGYVI 121

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           DYI+ HT TWSFAVFNLAD FI++G   II D+++   + + 
Sbjct: 122 DYILFHTATWSFAVFNLADSFITVGAGAIILDELLQTKKTRS 163


>gi|116250179|ref|YP_766017.1| lipoprotein signal peptidase [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115254827|emb|CAK05901.1| putative transmembrane lipoprotein signal peptidase [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 167

 Score =  103 bits (258), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 46/99 (46%), Positives = 71/99 (71%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           MLS +    +V +R++I+AF+ ++W +  K + I  +GY LI  GA+GN+VD   YG+VI
Sbjct: 66  MLSGMDGWFIVGMRLIIVAFVIWLWYRTAKDRWIAHLGYALIIAGAIGNLVDRFAYGHVI 125

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
           DYI+ +T++WSFAVFNLAD FI+IG   +I D+++L  +
Sbjct: 126 DYILFYTESWSFAVFNLADSFITIGAGCVILDELLLPKK 164


>gi|58581250|ref|YP_200266.1| lipoprotein signal peptidase [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|58425844|gb|AAW74881.1| lipoprotein signal peptidase [Xanthomonas oryzae pv. oryzae
           KACC10331]
          Length = 206

 Score =  103 bits (258), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 21/99 (21%), Positives = 45/99 (45%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   ++ + I   + F   +  +      + Y L+  GA+GNV+D  ++G+V+D+I
Sbjct: 107 GWQLWFFTALAMGISGLLAFWLSRTARGHWRSALPYALVIGGAIGNVIDRLMHGHVVDFI 166

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
             +  + ++  FN+AD  I  G   I    +  +  ++ 
Sbjct: 167 QWYIGSHTWPSFNIADSAIVGGAIGIAVFGLFDKAGKQA 205


>gi|120554327|ref|YP_958678.1| lipoprotein signal peptidase [Marinobacter aquaeolei VT8]
 gi|120324176|gb|ABM18491.1| signal peptidase II, Aspartic peptidase, MEROPS family A08
           [Marinobacter aquaeolei VT8]
          Length = 176

 Score =  103 bits (258), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 26/100 (26%), Positives = 47/100 (47%), Gaps = 1/100 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                + + + ++I   + +   ++P     + +    I  GALGNV D    GYV D +
Sbjct: 75  GWQQPLFIGLALVISTLLVYWLWRSPSV-LSYRLALSAILGGALGNVADRLRLGYVEDLL 133

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
             H   W +  FNLAD++I +G  + I+ +I  Q   + +
Sbjct: 134 DFHYAQWHWPSFNLADVWIVLGAALFIWAEIRHQPGSRRR 173


>gi|323527127|ref|YP_004229280.1| lipoprotein signal peptidase [Burkholderia sp. CCGE1001]
 gi|323384129|gb|ADX56220.1| lipoprotein signal peptidase [Burkholderia sp. CCGE1001]
          Length = 172

 Score =  103 bits (258), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 28/98 (28%), Positives = 51/98 (52%), Gaps = 1/98 (1%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           M          ++ ++    I ++ K++   + +F     LI  GALGNV+D   YG+VI
Sbjct: 73  MAGGWQRWAFTALGVIAALVICYLLKRHGA-QKMFCTALALILGGALGNVIDRLAYGHVI 131

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
           D++  H + W +  FNLAD  I++G  +++ D++    
Sbjct: 132 DFLDFHVRAWHWPAFNLADSAITVGAILLVIDELRRVR 169


>gi|262374477|ref|ZP_06067751.1| signal peptidase II [Acinetobacter junii SH205]
 gi|262310473|gb|EEY91563.1| signal peptidase II [Acinetobacter junii SH205]
          Length = 179

 Score =  103 bits (258), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 29/103 (28%), Positives = 49/103 (47%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   S+   +     F   K PK   I  +   LI  GA+GN++D    GYV+D+I
Sbjct: 74  GWQRYFFTSLAGFVSIIFIFWLMKMPKKMIILPMAIALILGGAIGNLIDRVSLGYVVDFI 133

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDF 106
            ++ Q   F  FN+AD  I++GT +++ D   L+ ++    + 
Sbjct: 134 HVYYQDSHFPAFNIADSAITLGTILLLIDTFFLEKKRIQNAET 176


>gi|261250336|ref|ZP_05942912.1| lipoprotein signal peptidase [Vibrio orientalis CIP 102891]
 gi|260939452|gb|EEX95438.1| lipoprotein signal peptidase [Vibrio orientalis CIP 102891]
          Length = 167

 Score =  103 bits (258), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 28/100 (28%), Positives = 47/100 (47%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +     +   I   +   + +   K P  +   +I Y +I  GA+GNV D  ++G+V+DY
Sbjct: 68  AGWQRWLFTGIAFAVTGMLTYWMSKLPAKEKWNNIAYAMIIGGAVGNVFDRVVHGFVVDY 127

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           +      + +  FNLAD  I IG  +II D    + + K 
Sbjct: 128 LDFFWGDYHWPAFNLADTTICIGAAMIILDGFRNKEQAKA 167


>gi|15964144|ref|NP_384497.1| lipoprotein signal peptidase transmembrane [Sinorhizobium meliloti
           1021]
 gi|307317960|ref|ZP_07597397.1| lipoprotein signal peptidase [Sinorhizobium meliloti AK83]
 gi|81854387|sp|Q92SJ3|LSPA_RHIME RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|15073320|emb|CAC41828.1| Probable lipoprotein signal peptidase transmembrane [Sinorhizobium
           meliloti 1021]
 gi|306896362|gb|EFN27111.1| lipoprotein signal peptidase [Sinorhizobium meliloti AK83]
          Length = 166

 Score =  103 bits (257), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 46/102 (45%), Positives = 71/102 (69%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           MLS +    +V IR+ ++ F+ ++W++ PK +    +GY +I  GALGN+VD  L+GYVI
Sbjct: 62  MLSGMEGWFIVGIRLAVVTFVLWLWRRTPKDRFFAHLGYAMIIAGALGNLVDRLLFGYVI 121

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           DYI+ +T TWSFAVFNLAD FI++G   II D+++   +++ 
Sbjct: 122 DYILFYTATWSFAVFNLADSFITVGAGAIILDELLQAKKERS 163


>gi|213619293|ref|ZP_03373119.1| lipoprotein signal peptidase [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-2068]
          Length = 102

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 31/101 (30%), Positives = 50/101 (49%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
           +        I I I   +  +  ++  T+ + +I Y LI  GALGN+ D   +G+V+D I
Sbjct: 2   SWQRWFFAGIAIGICVILLVMMYRSKATQKLNNIAYALIIGGALGNLFDRLWHGFVVDMI 61

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
             +   W FA FNLAD  I IG  +I+ +  + +   K + 
Sbjct: 62  DFYVGDWHFATFNLADTAICIGAALIVLEGFLPKPTAKEQA 102


>gi|54307797|ref|YP_128817.1| lipoprotein signal peptidase [Photobacterium profundum SS9]
 gi|46912220|emb|CAG19015.1| putative lipoprotein signal peptidase [Photobacterium profundum
           SS9]
          Length = 154

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 48/97 (49%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   +I + +   + F  ++ P    + +  Y LI  GALGN+ D   +G+V+D++
Sbjct: 55  GWQRWFFAAIALGVSGLLAFWMRRTPIQNRLANSAYALIIGGALGNLFDRLYHGFVVDFL 114

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
             +  T+ +  FN+AD  I IG  +II +  I   ++
Sbjct: 115 DFYAGTYHWPAFNIADTAICIGAALIILEGFIADKKE 151


>gi|70732625|ref|YP_262388.1| lipoprotein signal peptidase [Pseudomonas fluorescens Pf-5]
 gi|123652815|sp|Q4K5U5|LSPA_PSEF5 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|68346924|gb|AAY94530.1| signal peptidase II [Pseudomonas fluorescens Pf-5]
          Length = 170

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 47/97 (48%), Gaps = 1/97 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S     +   I I + A +    K+  + ++   I   L+  GALGN+ D    G+VID+
Sbjct: 67  SGWQRWLFALIAIAVSAVLVVWLKRLGRNETWLAIALALVLGGALGNLYDRIALGHVIDF 126

Query: 63  IMIHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQH 98
           I++H Q  W F  FN AD  I++G  ++  D    + 
Sbjct: 127 ILVHWQNRWYFPAFNFADSAITVGAVMLALDMFKSKK 163


>gi|307730764|ref|YP_003907988.1| lipoprotein signal peptidase [Burkholderia sp. CCGE1003]
 gi|307585299|gb|ADN58697.1| lipoprotein signal peptidase [Burkholderia sp. CCGE1003]
          Length = 172

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 28/98 (28%), Positives = 51/98 (52%), Gaps = 1/98 (1%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           M          ++ ++    I ++ K++   + +F     LI  GALGNV+D   YG+VI
Sbjct: 73  MAGGWQRWAFTALGVIAALVICYLLKRHGA-QKMFCTALALILGGALGNVIDRLAYGHVI 131

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
           D++  H + W +  FNLAD  I++G  +++ D++    
Sbjct: 132 DFLDFHVRAWHWPAFNLADSAITVGAVLLVIDELRRVR 169


>gi|192362161|ref|YP_001983670.1| signal peptidase II [Cellvibrio japonicus Ueda107]
 gi|226740871|sp|B3PE13|LSPA_CELJU RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|190688326|gb|ACE86004.1| signal peptidase II [Cellvibrio japonicus Ueda107]
          Length = 170

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 25/100 (25%), Positives = 46/100 (46%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    + +     +     +   +K         I  GA+GN+ D  ++G+V+D+I
Sbjct: 66  GWQRWFFTIVAVAASVLLIVWICRVASSKPREAFALSFILGGAVGNLYDRIIHGHVVDFI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
           ++H Q + +  FNLAD  IS+G  ++I D  I   +  G+
Sbjct: 126 VVHYQDYYWPAFNLADAAISLGAMVLIADLFINPDKTSGE 165


>gi|78046847|ref|YP_363022.1| lipoprotein signal peptidase [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|325928651|ref|ZP_08189830.1| lipoprotein signal peptidase [Xanthomonas perforans 91-118]
 gi|123585592|sp|Q3BW41|LSPA_XANC5 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|78035277|emb|CAJ22922.1| lipoprotein signal peptidase [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|325540979|gb|EGD12542.1| lipoprotein signal peptidase [Xanthomonas perforans 91-118]
          Length = 172

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 21/99 (21%), Positives = 46/99 (46%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   ++ + I   + F   +  + +    + Y L+  GA+GNV+D  ++G+V+D+I
Sbjct: 67  GWQLWFFTALAVGISGLLAFWLSRTARGQWRSALPYALVIGGAIGNVIDRLMHGHVVDFI 126

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
             +  + ++  FN+AD  I  G   I    +  +  ++ 
Sbjct: 127 QWYIGSHTWPSFNIADSAIVGGAIGIAVFGLFDKSGKQE 165


>gi|307301289|ref|ZP_07581051.1| lipoprotein signal peptidase [Sinorhizobium meliloti BL225C]
 gi|306903745|gb|EFN34332.1| lipoprotein signal peptidase [Sinorhizobium meliloti BL225C]
          Length = 166

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 46/102 (45%), Positives = 71/102 (69%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           MLS +    +V IR+ ++ F+ ++W++ PK +    +GY +I  GALGN+VD  L+GYVI
Sbjct: 62  MLSGIEGWFIVGIRLAVVTFVLWLWRRTPKDRFFAHLGYAMIIAGALGNLVDRLLFGYVI 121

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           DYI+ +T TWSFAVFNLAD FI++G   II D+++   +++ 
Sbjct: 122 DYILFYTATWSFAVFNLADSFITVGAGAIILDELLQAKKERS 163


>gi|293606195|ref|ZP_06688558.1| signal peptidase II [Achromobacter piechaudii ATCC 43553]
 gi|292815342|gb|EFF74460.1| signal peptidase II [Achromobacter piechaudii ATCC 43553]
          Length = 178

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 24/97 (24%), Positives = 47/97 (48%), Gaps = 1/97 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +   +  +    I  I ++         +   LI  GA+GNV+D   YG+V+D++
Sbjct: 80  GWQRWLFTGLGCIAAVVITIILRRTHGQPRF-SLALTLILGGAIGNVIDRVAYGHVVDFL 138

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
           + +     F  FNLAD+ IS G  +++ D+++   ++
Sbjct: 139 LFYWNESYFPAFNLADVGISCGAVLLVLDELLRARKK 175


>gi|285017718|ref|YP_003375429.1| lipoprotein signal peptidase transmembrane [Xanthomonas albilineans
           GPE PC73]
 gi|283472936|emb|CBA15441.1| probable lipoprotein signal peptidase. transmembrane [Xanthomonas
           albilineans]
          Length = 167

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 23/99 (23%), Positives = 44/99 (44%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    + + I   + +   + P+++    + Y L+  GA+GNV+D  L+G+V+D+I
Sbjct: 67  GWQLWFFTLLALGISGLLAWWLARTPRSEWRSAVPYALVIGGAIGNVIDRLLHGHVVDFI 126

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
             +     +  FNLAD  I  G   I    +     ++ 
Sbjct: 127 QWYVGQHYWPSFNLADSAIVAGAIGIALFGLWDGKAKRK 165


>gi|167854872|ref|ZP_02477649.1| lipoprotein signal peptidase [Haemophilus parasuis 29755]
 gi|167854051|gb|EDS25288.1| lipoprotein signal peptidase [Haemophilus parasuis 29755]
          Length = 162

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 28/100 (28%), Positives = 50/100 (50%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S       + + I+I   +  +  KN     + +  Y LI  GA+GN VD    GYV+D+
Sbjct: 61  SGWQKYFFLGLAIVISIALIVMLFKNKAELKLQNAAYALIIGGAIGNAVDRAYNGYVVDF 120

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           +  +   + + VFN+AD+ I +G  ++I + I+   + K 
Sbjct: 121 LDFYWDIYHYPVFNIADIGIVVGAGLLILESILEHRKSKK 160


>gi|24375035|ref|NP_719078.1| lipoprotein signal peptidase [Shewanella oneidensis MR-1]
 gi|81845771|sp|Q8EBI5|LSPA_SHEON RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|24349778|gb|AAN56522.1|AE015789_9 lipoprotein signal peptidase [Shewanella oneidensis MR-1]
          Length = 170

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 25/105 (23%), Positives = 50/105 (47%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +   + +   + +    +K   +    ++ Y L+  GALGN+VD  ++G+V+D+I
Sbjct: 66  GWQRWLFTIVAVGFSSLLTVWLRKQSASLLKLNLAYTLVIGGALGNLVDRLMHGFVVDFI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDFPQ 108
             +     +  FN+AD  I IG  +II+D       ++ K +  +
Sbjct: 126 DFYWGKSHYPAFNIADSAIFIGAVLIIWDSFFNSQSEQDKTEEVK 170


>gi|170718658|ref|YP_001783406.1| lipoprotein signal peptidase [Haemophilus somnus 2336]
 gi|238688019|sp|B0UV09|LSPA_HAES2 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|168826787|gb|ACA32158.1| lipoprotein signal peptidase [Haemophilus somnus 2336]
          Length = 165

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 28/103 (27%), Positives = 51/103 (49%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +       + + + +   I F   KN  T+ + + GY L+  GAL N  D   +G+V+D+
Sbjct: 63  AGWQKYFFILLALAVSFMILFFLYKNQATQKLQNTGYALMIGGALANAADRAYHGFVVDF 122

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
              + Q W + VFN+AD+ I IG  ++  D      +++ K +
Sbjct: 123 FDFYWQQWHYPVFNVADIAICIGAGLLAIDAFKQNDKKESKQN 165


>gi|170693570|ref|ZP_02884728.1| lipoprotein signal peptidase [Burkholderia graminis C4D1M]
 gi|170141352|gb|EDT09522.1| lipoprotein signal peptidase [Burkholderia graminis C4D1M]
          Length = 172

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 28/98 (28%), Positives = 51/98 (52%), Gaps = 1/98 (1%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           M          ++ ++    I ++ K++   + +F     LI  GALGNV+D   YG+VI
Sbjct: 73  MAGGWQRWAFTALGVIAALVICYLLKRH-GGQKMFCTALALILGGALGNVIDRLAYGHVI 131

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
           D++  H + W +  FNLAD  I++G  +++ D++    
Sbjct: 132 DFLDFHVRAWHWPAFNLADSAITVGAVLLVIDELRRVR 169


>gi|226943310|ref|YP_002798383.1| lipoprotein signal peptidase [Azotobacter vinelandii DJ]
 gi|226718237|gb|ACO77408.1| lipoprotein signal peptidase, LspA [Azotobacter vinelandii DJ]
          Length = 167

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 31/104 (29%), Positives = 52/104 (50%), Gaps = 1/104 (0%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S     +   I I + + +    K+   +++   I   L+  GA+GN+ D   YG+VID+
Sbjct: 64  SGWQRWLFALIAIAVSSVLVVWLKRLQPSETWLAIALALVLGGAVGNLFDRVAYGHVIDF 123

Query: 63  IMIHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
           I++H Q  W F  FNLAD  I++G  ++  D  I +   +   D
Sbjct: 124 ILVHWQDRWFFPAFNLADSAITVGAIMLALDMFISKKSGETAHD 167


>gi|149911068|ref|ZP_01899696.1| lipoprotein signal peptidase (SPase II)(Prolipoprotein
           signalpeptidase) [Moritella sp. PE36]
 gi|149805894|gb|EDM65882.1| lipoprotein signal peptidase (SPase II)(Prolipoprotein
           signalpeptidase) [Moritella sp. PE36]
          Length = 170

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 29/102 (28%), Positives = 50/102 (49%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I + +   + +  K+    +   +I Y LI  GALGN+ D  ++GYVID++
Sbjct: 67  GWQRWFFGVIAVSVSGLLIYWLKQQSAKQYWSNIAYALILGGALGNLYDRIIHGYVIDFL 126

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
            ++     F +FNLAD +I IG  ++I + I+     K   +
Sbjct: 127 HVYWDKSHFPIFNLADTWICIGAAMLILEAIMESKNDKESSN 168


>gi|317407734|gb|EFV87663.1| lipoprotein signal peptidase [Achromobacter xylosoxidans C54]
          Length = 174

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 25/99 (25%), Positives = 51/99 (51%), Gaps = 1/99 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +   + I+    I  I ++         +   +I  GA+GNV+D  +YG+V+D++
Sbjct: 77  GWQRWLFTGLGIVAAVVITVILRRTRGQPRF-CLALAMILGGAIGNVIDRVVYGHVVDFL 135

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           + + + W F  FNLAD+ IS G  +++ D+++   + + 
Sbjct: 136 LFYWRDWYFPAFNLADVGISCGAVLLVLDELLRARKPRA 174


>gi|62263056|gb|AAX78123.1| unknown protein [synthetic construct]
          Length = 196

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 47/96 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
           +    +  +I ++    + ++  K P T+ I    + LI  GALGN  D    GYVID++
Sbjct: 91  SWQMIMFSTISLIAAIVLIYLIIKQPITEKINLFSFALILGGALGNFYDRAFQGYVIDFL 150

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
             H   + +  FN+AD  I+ G  I+I   +  + +
Sbjct: 151 DFHIGNYHWPSFNIADSAITCGVVILIAASLFTKKK 186


>gi|86356049|ref|YP_467941.1| lipoprotein signal peptidase protein [Rhizobium etli CFN 42]
 gi|86280151|gb|ABC89214.1| lipoprotein signal peptidase protein [Rhizobium etli CFN 42]
          Length = 167

 Score =  102 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 43/99 (43%), Positives = 70/99 (70%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           ML  +    +V +R++I+AF+ ++W +  K + +  +GY LI  GA+GN+VD   YG+VI
Sbjct: 66  MLEGMDGWFIVGMRLVIVAFVIWLWYRTAKDRWLAHLGYALIIAGAIGNLVDRFAYGHVI 125

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
           DYI+ +T++WSFAVFNLAD FI+IG   +I ++++L  +
Sbjct: 126 DYILFYTESWSFAVFNLADSFITIGAGCVILEELLLPKK 164


>gi|241766700|ref|ZP_04764540.1| lipoprotein signal peptidase [Acidovorax delafieldii 2AN]
 gi|241362968|gb|EER58657.1| lipoprotein signal peptidase [Acidovorax delafieldii 2AN]
          Length = 169

 Score =  102 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 28/98 (28%), Positives = 49/98 (50%), Gaps = 1/98 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +  +I I    FI +   +    + +F      I  GA+GNVVD  ++GYV+D++
Sbjct: 73  GWQRWLFTAIGIAATLFIVWQL-RAHAGQKLFCFALSSILGGAVGNVVDRLMHGYVVDFL 131

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
             H + W F  FN+AD  I++G   +I D+++     +
Sbjct: 132 DFHARGWHFPAFNIADAAITVGAACLILDELLRVRNAR 169


>gi|254251623|ref|ZP_04944941.1| signal peptidase II [Burkholderia dolosa AUO158]
 gi|124894232|gb|EAY68112.1| signal peptidase II [Burkholderia dolosa AUO158]
          Length = 166

 Score =  102 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 34/96 (35%), Positives = 53/96 (55%), Gaps = 1/96 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S        ++ I     I F+ K++   + +F +   LI  GALGNV+D  +YG+VID+
Sbjct: 69  SGWQRWAFTALGIGATLVICFLLKRHG-HQRLFSLSLALILGGALGNVIDRLVYGHVIDF 127

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
           +  H  TW F  FNLAD  I++G  ++IYD++    
Sbjct: 128 LDFHIGTWHFPAFNLADSAITVGAVLLIYDELRRVR 163


>gi|300703294|ref|YP_003744896.1| prolipoprotein signal peptidase (spase II) [Ralstonia solanacearum
           CFBP2957]
 gi|299070957|emb|CBJ42265.1| prolipoprotein signal peptidase (SPase II) [Ralstonia solanacearum
           CFBP2957]
          Length = 174

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 24/95 (25%), Positives = 48/95 (50%), Gaps = 1/95 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    + +    FI ++ +++   + +F     LI  GA+GNV+D  ++G+V+D++
Sbjct: 80  GWQRWFFTGLGVAAALFIVWLLRRH-SGQKLFCFALALILGGAVGNVIDRVIHGHVVDFL 138

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
             H   + +  FN+AD  I IG  ++I D++    
Sbjct: 139 DFHLHGYHWPAFNVADCGICIGAVLLIIDELRRVR 173


>gi|242238040|ref|YP_002986221.1| lipoprotein signal peptidase [Dickeya dadantii Ech703]
 gi|242130097|gb|ACS84399.1| lipoprotein signal peptidase [Dickeya dadantii Ech703]
          Length = 168

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 27/98 (27%), Positives = 45/98 (45%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I   +I  +  I  +   ++   +I Y LI  GA+GN+ D  ++GYVID++
Sbjct: 66  GWQRWFFALIAFAVIISLLVIMYRTRASQKAANIAYALIIGGAIGNLSDRLIHGYVIDFM 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
                 W +  FNLAD  I IG  +++ +       +K
Sbjct: 126 DFFIGNWHYPTFNLADCAIVIGAFLVVVESFFSSPDKK 163


>gi|115373488|ref|ZP_01460785.1| signal peptidase II [Stigmatella aurantiaca DW4/3-1]
 gi|310825339|ref|YP_003957697.1| Lipoprotein signal peptidase [Stigmatella aurantiaca DW4/3-1]
 gi|115369494|gb|EAU68432.1| signal peptidase II [Stigmatella aurantiaca DW4/3-1]
 gi|309398411|gb|ADO75870.1| Lipoprotein signal peptidase [Stigmatella aurantiaca DW4/3-1]
          Length = 207

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 27/103 (26%), Positives = 50/103 (48%), Gaps = 7/103 (6%)

Query: 1   MLSNV----SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLY 56
           M  ++             ++ + FIF ++ ++  ++ +  +   L+  GALGN VD  L 
Sbjct: 90  MFGDLPESVRRFFFQGASLVALTFIFVMYVRSEPSQRLVRLSLALVVGGALGNFVDRLLR 149

Query: 57  GYVIDYIMIHTQT---WSFAVFNLADLFISIGTCIIIYDDIIL 96
           GYVID+I  H +      +  FN+AD  I +G  +++ D +  
Sbjct: 150 GYVIDFIDWHWRNQPGMRWPTFNVADAAICVGVALMLMDSLRR 192


>gi|261868578|ref|YP_003256500.1| lipoprotein signal peptidase [Aggregatibacter actinomycetemcomitans
           D11S-1]
 gi|261413910|gb|ACX83281.1| signal peptidase II [Aggregatibacter actinomycetemcomitans D11S-1]
          Length = 153

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 29/100 (29%), Positives = 52/100 (52%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  +++ + I A + +   KN   + + +  Y LI  GALGN  D   +GYV+D++
Sbjct: 54  GWQKFFFLALAVGISAMLVYFLMKNRHEQKLLNAAYALIIGGALGNAADRLYHGYVVDFL 113

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
             + + W + VFN+AD+ I +G  +I  D     ++Q+ K
Sbjct: 114 DFYWRDWHYPVFNVADIAICVGAGLIALDAFKNGNKQERK 153


>gi|167561853|ref|ZP_02354769.1| signal peptidase II [Burkholderia oklahomensis EO147]
 gi|167569076|ref|ZP_02361950.1| signal peptidase II [Burkholderia oklahomensis C6786]
          Length = 167

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 31/95 (32%), Positives = 51/95 (53%), Gaps = 1/95 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   ++ I     I ++ K++   + +F +   LI  GALGNV+D  LYG+VID++
Sbjct: 71  GWQRWAFTALGIGATLVICYLLKRHG-HQRLFSLSLALILGGALGNVIDRLLYGHVIDFL 129

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
             H   W +  FNLAD  I++G  ++IYD++    
Sbjct: 130 DFHAGAWHWPAFNLADSAITVGAVLLIYDELRRVR 164


>gi|219871470|ref|YP_002475845.1| lipoprotein signal peptidase [Haemophilus parasuis SH0165]
 gi|219691674|gb|ACL32897.1| lipoprotein signal peptidase [Haemophilus parasuis SH0165]
          Length = 162

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 27/100 (27%), Positives = 50/100 (50%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S       + + I+I   +  +  KN     + +  Y LI  GA+GN +D    GYV+D+
Sbjct: 61  SGWQKYFFLGLAIVISIALIVMLFKNKAELKLQNSAYALIIGGAIGNAIDRAYNGYVVDF 120

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           +  +   + + VFN+AD+ I +G  ++I + I+   + K 
Sbjct: 121 LDFYWDIYHYPVFNIADIGIVVGAGLLILESILEHRKSKK 160


>gi|258593869|emb|CBE70210.1| Lipoprotein signal peptidase (Prolipoprotein signal peptidase)
           (SPase II) (Signal peptidase II) [NC10 bacterium 'Dutch
           sediment']
          Length = 162

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 26/99 (26%), Positives = 51/99 (51%)

Query: 5   VSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIM 64
           +     + I +L I FI +   +      +  +G  LI  GA+GN++D    G V+D+I 
Sbjct: 60  IRNPFFIGISLLAIGFILYYRHRRLDDHPLASLGLSLILGGAVGNLLDRLRIGMVVDFID 119

Query: 65  IHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
           +H   + +  FN+AD  I++G  +++   I+ + R + +
Sbjct: 120 VHYYQYHWPAFNVADSGITVGVSLMMLTMILDERRGRHR 158


>gi|32034924|ref|ZP_00135015.1| COG0597: Lipoprotein signal peptidase [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|126208983|ref|YP_001054208.1| lipoprotein signal peptidase [Actinobacillus pleuropneumoniae L20]
 gi|126097775|gb|ABN74603.1| lipoprotein signal peptidase [Actinobacillus pleuropneumoniae
           serovar 5b str. L20]
          Length = 160

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 23/99 (23%), Positives = 49/99 (49%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + + ++I   +  +  +N   K + +  Y LI  GA+GN +D    GYV+D+ 
Sbjct: 62  GWQKYFFLGLAVVISLGLIVMLWRNHAVKKLENSAYALIIGGAIGNAIDRAYNGYVVDFF 121

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
             +   + + VFN+AD+ I +G  ++I +  + + ++  
Sbjct: 122 DFYWDIYHYPVFNVADIAIVVGAGLLILEAFLDKKKKSD 160


>gi|209517454|ref|ZP_03266295.1| lipoprotein signal peptidase [Burkholderia sp. H160]
 gi|209502108|gb|EEA02123.1| lipoprotein signal peptidase [Burkholderia sp. H160]
          Length = 168

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 29/98 (29%), Positives = 50/98 (51%), Gaps = 1/98 (1%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           M          ++ ++    I ++ K++   + +F     LI  GALGNV+D   YG+VI
Sbjct: 69  MAGGWQRWAFTALGVVAALVICYLLKRH-SGQKMFCTALALILGGALGNVIDRLAYGHVI 127

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
           D++  H   W +  FNLAD  I+IG  +++ D++    
Sbjct: 128 DFLDFHVGGWHWPAFNLADSAITIGAILLVIDELRRVR 165


>gi|332704040|ref|ZP_08424128.1| Lipoprotein signal peptidase [Desulfovibrio africanus str. Walvis
           Bay]
 gi|332554189|gb|EGJ51233.1| Lipoprotein signal peptidase [Desulfovibrio africanus str. Walvis
           Bay]
          Length = 163

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 24/96 (25%), Positives = 47/96 (48%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
            +    +      L +  I +I +K P+       G  L+  GA+GN++D    G+V+D+
Sbjct: 63  QSWQTWMFAGASALALVVILWILRKTPERDLWTIYGLGLVLGGAMGNLLDRVTQGFVVDF 122

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
           + ++ + W +  FN+AD+ I +G   +I      +H
Sbjct: 123 LDVYYRNWHWPAFNVADMSICLGAGGLILALWKSEH 158


>gi|283477206|emb|CAY73113.1| prolipoprotein signal peptidase (SPase II) [Erwinia pyrifoliae DSM
           12163]
          Length = 169

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 29/100 (29%), Positives = 50/100 (50%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I+  +  +  ++  +  + +I Y LI  GALGN+ D   +G+V+D+I
Sbjct: 67  GWQRWFFAGIAIAIVVVLLVMMYRSKASNKLNNIAYALIVGGALGNLFDRAYHGFVVDFI 126

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
             +   W FA FN+AD  I IG  +I+ +  I    ++ +
Sbjct: 127 DFYIGDWHFATFNIADCGICIGAALIVLEGFISPASKQSE 166


>gi|259907375|ref|YP_002647731.1| lipoprotein signal peptidase [Erwinia pyrifoliae Ep1/96]
 gi|224962997|emb|CAX54480.1| Lipoprotein signal peptidase [Erwinia pyrifoliae Ep1/96]
          Length = 168

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 29/100 (29%), Positives = 50/100 (50%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I+  +  +  ++  +  + +I Y LI  GALGN+ D   +G+V+D+I
Sbjct: 66  GWQRWFFAGIAIAIVVVLLVMMYRSKASNKLNNIAYALIVGGALGNLFDRAYHGFVVDFI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
             +   W FA FN+AD  I IG  +I+ +  I    ++ +
Sbjct: 126 DFYIGDWHFATFNIADCGICIGAALIVLEGFISPASKQSE 165


>gi|326318118|ref|YP_004235790.1| lipoprotein signal peptidase [Acidovorax avenae subsp. avenae ATCC
           19860]
 gi|323374954|gb|ADX47223.1| lipoprotein signal peptidase [Acidovorax avenae subsp. avenae ATCC
           19860]
          Length = 169

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 30/96 (31%), Positives = 50/96 (52%), Gaps = 1/96 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +   I +    FI +  + +P  + +F      I  GA+GNVVD  ++GYV+D++
Sbjct: 73  GWQRWVFTGIGVAAALFIVWQLRAHP-GQKLFCFALSSILGGAIGNVVDRMMHGYVVDFL 131

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
             H + W F  FNLAD  I++G   +I D+++   R
Sbjct: 132 DFHARGWHFPAFNLADSAITVGAACLIIDELMRVRR 167


>gi|150395254|ref|YP_001325721.1| lipoprotein signal peptidase [Sinorhizobium medicae WSM419]
 gi|150026769|gb|ABR58886.1| lipoprotein signal peptidase [Sinorhizobium medicae WSM419]
          Length = 165

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 46/102 (45%), Positives = 71/102 (69%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           MLS +    +V IR+ ++ F+ ++W++ PK +    +GY +I  GALGN+VD  L+GYVI
Sbjct: 61  MLSGMEGWFIVGIRLGVVTFVLWLWRRTPKDRFFAHLGYAMIIAGALGNLVDRLLFGYVI 120

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           DYI+ +T TWSFAVFNLAD FI++G   II D+++   +++ 
Sbjct: 121 DYILFYTATWSFAVFNLADSFITVGAGAIILDELLQAKKERS 162


>gi|165976948|ref|YP_001652541.1| lipoprotein signal peptidase [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|190150848|ref|YP_001969373.1| lipoprotein signal peptidase [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|303250937|ref|ZP_07337127.1| lipoprotein signal peptidase [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|303253403|ref|ZP_07339546.1| lipoprotein signal peptidase [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|307246436|ref|ZP_07528509.1| Lipoprotein signal peptidase [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|307248561|ref|ZP_07530576.1| Lipoprotein signal peptidase [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|307250794|ref|ZP_07532723.1| Lipoprotein signal peptidase [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|307253170|ref|ZP_07535048.1| Lipoprotein signal peptidase [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307255419|ref|ZP_07537226.1| Lipoprotein signal peptidase [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|307257588|ref|ZP_07539348.1| Lipoprotein signal peptidase [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|307259871|ref|ZP_07541585.1| Lipoprotein signal peptidase [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|307262001|ref|ZP_07543656.1| Lipoprotein signal peptidase [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
 gi|307264198|ref|ZP_07545789.1| Lipoprotein signal peptidase [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
 gi|165877049|gb|ABY70097.1| lipoprotein signal peptidase [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|189915979|gb|ACE62231.1| lipoprotein signal peptidase [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|302647748|gb|EFL77961.1| lipoprotein signal peptidase [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|302650209|gb|EFL80375.1| lipoprotein signal peptidase [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306852640|gb|EFM84872.1| Lipoprotein signal peptidase [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|306854911|gb|EFM87099.1| Lipoprotein signal peptidase [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|306857153|gb|EFM89280.1| Lipoprotein signal peptidase [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|306859355|gb|EFM91390.1| Lipoprotein signal peptidase [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306861603|gb|EFM93590.1| Lipoprotein signal peptidase [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|306863891|gb|EFM95814.1| Lipoprotein signal peptidase [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|306866041|gb|EFM97915.1| Lipoprotein signal peptidase [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|306868284|gb|EFN00106.1| Lipoprotein signal peptidase [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
 gi|306870444|gb|EFN02197.1| Lipoprotein signal peptidase [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
          Length = 160

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 24/99 (24%), Positives = 49/99 (49%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + + I+I   +  +  +N   K + +  Y LI  GA+GN +D    GYV+D+ 
Sbjct: 62  GWQKYFFLGLAIVISLGLIVMLWRNQAVKKLENSAYALIIGGAIGNAIDRAYNGYVVDFF 121

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
             +   + + VFN+AD+ I +G  ++I +  + + ++  
Sbjct: 122 DFYWDIYHYPVFNVADIAIVVGAGLLILEAFLDKKKKSD 160


>gi|162452176|ref|YP_001614543.1| Signal peptidase II [Sorangium cellulosum 'So ce 56']
 gi|161162758|emb|CAN94063.1| Signal peptidase II [Sorangium cellulosum 'So ce 56']
          Length = 227

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 26/99 (26%), Positives = 49/99 (49%), Gaps = 4/99 (4%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
            +     + +    + FIF I+++  + ++    G  L   GA+GN+VD   YG+VID+I
Sbjct: 92  GLRRPFFLFVSAAAMVFIFSIYRRVHRDQTGMKWGLALALGGAMGNLVDRIRYGWVIDFI 151

Query: 64  MIHTQ----TWSFAVFNLADLFISIGTCIIIYDDIILQH 98
            ++       + +  FN+AD+ I  G  ++  D I+   
Sbjct: 152 DVYVIRGGREFHWPTFNVADIAIVAGVILMSKDMIVATR 190


>gi|83721661|ref|YP_441325.1| lipoprotein signal peptidase [Burkholderia thailandensis E264]
 gi|167580109|ref|ZP_02372983.1| signal peptidase II [Burkholderia thailandensis TXDOH]
 gi|167618174|ref|ZP_02386805.1| signal peptidase II [Burkholderia thailandensis Bt4]
 gi|257140000|ref|ZP_05588262.1| lipoprotein signal peptidase [Burkholderia thailandensis E264]
 gi|123537856|sp|Q2T0H4|LSPA_BURTA RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|83655486|gb|ABC39549.1| signal peptidase II [Burkholderia thailandensis E264]
          Length = 166

 Score =  101 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 30/95 (31%), Positives = 51/95 (53%), Gaps = 1/95 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   ++ I     I ++ K++   + +F +   LI  GALGNV+D  +YG+VID++
Sbjct: 70  GWQRWAFTALGIGATLVICYLLKRHG-HQRLFSLSLALILGGALGNVIDRLIYGHVIDFL 128

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
             H   W +  FNLAD  I++G  ++IYD++    
Sbjct: 129 DFHVGAWHWPAFNLADSAITVGAVLLIYDELRRVR 163


>gi|292489404|ref|YP_003532291.1| prolipoprotein signal peptidase (SPase II) [Erwinia amylovora
           CFBP1430]
 gi|291554838|emb|CBA22708.1| prolipoprotein signal peptidase (SPase II) [Erwinia amylovora
           CFBP1430]
 gi|312173569|emb|CBX81823.1| prolipoprotein signal peptidase (SPase II) [Erwinia amylovora ATCC
           BAA-2158]
          Length = 169

 Score =  101 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 29/100 (29%), Positives = 50/100 (50%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I+  +  +  ++  +  + +I Y LI  GALGN+ D   +G+V+D+I
Sbjct: 67  GWQRWFFAGIAIAIVVVLLVMMYRSKASNRLNNIAYALIVGGALGNLFDRAYHGFVVDFI 126

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
             +   W FA FN+AD  I IG  +I+ +  I    ++ +
Sbjct: 127 DFYVGDWHFATFNIADCGICIGAALIVLEGFISPASKQSE 166


>gi|90416603|ref|ZP_01224534.1| Lipoprotein signal peptidase [marine gamma proteobacterium
           HTCC2207]
 gi|90331802|gb|EAS47030.1| Lipoprotein signal peptidase [marine gamma proteobacterium
           HTCC2207]
          Length = 185

 Score =  101 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 32/99 (32%), Positives = 51/99 (51%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +   I I++   I     + P+ + +  +G  LI  GALGN+ D  + GYV+D++
Sbjct: 76  GWQRWLFSIISIVVSVVIAVWLTRLPRQRVLEALGLSLILGGALGNLYDRLILGYVVDFL 135

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
             H   W FA FN+AD+ IS+G  +II D +  Q  +  
Sbjct: 136 DFHWAGWHFAAFNVADMAISVGAVLIIIDGLFFQQAEDA 174


>gi|292898377|ref|YP_003537746.1| lipoprotein signal peptidase [Erwinia amylovora ATCC 49946]
 gi|291198225|emb|CBJ45331.1| lipoprotein signal peptidase (prolipoprotein signal peptidase)
           (signal peptidase II) [Erwinia amylovora ATCC 49946]
          Length = 168

 Score =  101 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 29/100 (29%), Positives = 50/100 (50%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I+  +  +  ++  +  + +I Y LI  GALGN+ D   +G+V+D+I
Sbjct: 66  GWQRWFFAGIAIAIVVVLLVMMYRSKASNRLNNIAYALIVGGALGNLFDRAYHGFVVDFI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
             +   W FA FN+AD  I IG  +I+ +  I    ++ +
Sbjct: 126 DFYVGDWHFATFNIADCGICIGAALIVLEGFISPASKQSE 165


>gi|320326231|gb|EFW82285.1| lipoprotein signal peptidase [Pseudomonas syringae pv. glycinea
           str. B076]
          Length = 167

 Score =  101 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 48/96 (50%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +     +   I I++ A +    K+  +  +   +   L+  GALGN+ D  + G+VID+
Sbjct: 65  AGWQRWLFALIAIVVSAVLVVWLKRLGRDDTWLAVALALVLGGALGNLYDRIVLGHVIDF 124

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
           I++H Q   F  FN+AD  I++G  ++  D    + 
Sbjct: 125 ILVHWQNRCFPAFNVADSAITVGAIMLALDMFKSKK 160


>gi|310765125|gb|ADP10075.1| prolipoprotein signal peptidase (SPase II) [Erwinia sp. Ejp617]
          Length = 169

 Score =  101 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 29/100 (29%), Positives = 50/100 (50%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I+  +  +  ++  +  + +I Y LI  GALGN+ D   +G+V+D+I
Sbjct: 67  GWQRWFFAGIAIAIVVVLLVMMYRSKASNKLNNIAYALIVGGALGNLFDRAYHGFVVDFI 126

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
             +   W FA FN+AD  I IG  +I+ +  I    ++ +
Sbjct: 127 DFYVGDWHFATFNIADCGICIGAALIVLEGFISPASKQSE 166


>gi|238797502|ref|ZP_04641000.1| Lipoprotein signal peptidase [Yersinia mollaretii ATCC 43969]
 gi|238718643|gb|EEQ10461.1| Lipoprotein signal peptidase [Yersinia mollaretii ATCC 43969]
          Length = 160

 Score =  101 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 28/98 (28%), Positives = 47/98 (47%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S         I I I   +  +  ++   + + +  Y LI  GALGN+ D  ++G V D+
Sbjct: 56  SGWQRWFFAGIAIGISVILMVMMYRSTAKQRLINCAYALIIGGALGNLFDRLVHGAVNDF 115

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
           I  +   W F  FNLAD+ I IG  ++I++  +    +
Sbjct: 116 IDFYVNNWHFPTFNLADVAICIGAALVIFEGFLSPADK 153


>gi|171319742|ref|ZP_02908830.1| lipoprotein signal peptidase [Burkholderia ambifaria MEX-5]
 gi|171095014|gb|EDT40037.1| lipoprotein signal peptidase [Burkholderia ambifaria MEX-5]
          Length = 166

 Score =  101 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 31/96 (32%), Positives = 52/96 (54%), Gaps = 1/96 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S        ++ +     I F+ K++   + +F +   LI  GALGNV+D  +YG+VID+
Sbjct: 69  SGWQRWAFTALGVGATLVICFLLKRHG-HQRLFSVSLALILGGALGNVIDRLVYGHVIDF 127

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
           +  H   W F  FNLAD  I++G  +++YD++    
Sbjct: 128 LDFHLGGWHFPAFNLADSAITVGAVLLVYDELRRVR 163


>gi|167893182|ref|ZP_02480584.1| signal peptidase II [Burkholderia pseudomallei 7894]
 gi|167909885|ref|ZP_02496976.1| signal peptidase II [Burkholderia pseudomallei 112]
 gi|167917908|ref|ZP_02504999.1| signal peptidase II [Burkholderia pseudomallei BCC215]
 gi|254190885|ref|ZP_04897392.1| signal peptidase II [Burkholderia pseudomallei Pasteur 52237]
 gi|157938560|gb|EDO94230.1| signal peptidase II [Burkholderia pseudomallei Pasteur 52237]
          Length = 166

 Score =  101 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 30/95 (31%), Positives = 51/95 (53%), Gaps = 1/95 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   ++ I     I ++ K++   + +F +   LI  GALGNV+D  +YG+VID++
Sbjct: 70  GWQRWAFTALGIGATLVICYLLKRHG-HQRLFSLSLALILGGALGNVIDRLIYGHVIDFL 128

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
             H   W +  FNLAD  I++G  ++IYD++    
Sbjct: 129 DFHVGAWHWPAFNLADSAITVGAVLLIYDELRRVR 163


>gi|222111906|ref|YP_002554170.1| lipoprotein signal peptidase [Acidovorax ebreus TPSY]
 gi|221731350|gb|ACM34170.1| lipoprotein signal peptidase [Acidovorax ebreus TPSY]
          Length = 165

 Score =  101 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 29/96 (30%), Positives = 49/96 (51%), Gaps = 1/96 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +   I +    FI +  + +P  + +F      I  GA+GNVVD   +GYV+D++
Sbjct: 69  GWQRWLFTGIALATAVFILWQLRAHP-GQKLFCFALSSILGGAIGNVVDRLQHGYVVDFL 127

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
             H + W F  FN+AD  I++G   +I D+++   R
Sbjct: 128 DFHLRGWHFPAFNVADCAITVGAACLILDELLRVRR 163


>gi|160900817|ref|YP_001566399.1| lipoprotein signal peptidase [Delftia acidovorans SPH-1]
 gi|160366401|gb|ABX38014.1| lipoprotein signal peptidase [Delftia acidovorans SPH-1]
          Length = 171

 Score =  101 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 30/98 (30%), Positives = 50/98 (51%), Gaps = 1/98 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                + V I +     I +  +K+P  + +F      I  GA+GNVVD   +GYV+D++
Sbjct: 73  GWQRWLFVGIGVAATLLIVWQLRKHP-GQKLFCFSLASILGGAIGNVVDRLQHGYVVDFL 131

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
             +     F  FN AD+ IS+G  ++I D+++   R K
Sbjct: 132 DFYWGRSHFPAFNAADIAISVGAALLILDEVLRARRAK 169


>gi|312958883|ref|ZP_07773402.1| Lipoprotein signal peptidase [Pseudomonas fluorescens WH6]
 gi|311286653|gb|EFQ65215.1| Lipoprotein signal peptidase [Pseudomonas fluorescens WH6]
          Length = 170

 Score =  101 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 45/96 (46%), Gaps = 1/96 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +   I +++ A +    K+  +  +   I   L+  GALGN+ D    G+VID+I
Sbjct: 68  GWQRWLFAVIALVVSAILVVWLKRLGRDDTWLAIALALVLGGALGNLYDRIALGHVIDFI 127

Query: 64  MIHTQTWS-FAVFNLADLFISIGTCIIIYDDIILQH 98
           ++H Q    F  FN AD  I++G  ++  D    + 
Sbjct: 128 LVHWQNRHYFPAFNFADSAITVGAIMLALDMFKSKK 163


>gi|257454568|ref|ZP_05619825.1| signal peptidase II [Enhydrobacter aerosaccus SK60]
 gi|257448041|gb|EEV23027.1| signal peptidase II [Enhydrobacter aerosaccus SK60]
          Length = 180

 Score =  101 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 28/100 (28%), Positives = 52/100 (52%), Gaps = 1/100 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    +   +  FI    ++ P+   +   G  LI  GALGN++D    GYV+D++
Sbjct: 75  GWQRFFFSGLAFGVCGFIIVYLRRLPRDTGVLSAGLALIMAGALGNLMDRVRLGYVVDFL 134

Query: 64  MIHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
            +H    W+F +FNLAD+ I++G  +++ D   L+ +++ 
Sbjct: 135 HVHYANVWNFPIFNLADVAINLGVVLVLIDSFFLEAKRRE 174


>gi|113460331|ref|YP_718392.1| lipoprotein signal peptidase [Haemophilus somnus 129PT]
 gi|123327157|sp|Q0I1V9|LSPA_HAES1 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|112822374|gb|ABI24463.1| signal peptidase II, Aspartic peptidase, MEROPS family A08
           [Haemophilus somnus 129PT]
          Length = 165

 Score =  101 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 28/103 (27%), Positives = 52/103 (50%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +       + + +++   I F   KN  T+ + + GY L+  GAL N  D   +G+V+D+
Sbjct: 63  AGWQKYFFILLALVVSFMILFFLYKNQATQKLQNTGYALMVGGALANAADRAYHGFVVDF 122

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
              + Q W + VFN+AD+ I IG  ++  D      +++ K +
Sbjct: 123 FDFYWQQWHYPVFNIADVAICIGAGLLAIDAFKQNDKKESKQN 165


>gi|194364904|ref|YP_002027514.1| lipoprotein signal peptidase [Stenotrophomonas maltophilia R551-3]
 gi|194347708|gb|ACF50831.1| lipoprotein signal peptidase [Stenotrophomonas maltophilia R551-3]
          Length = 174

 Score =  101 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 23/99 (23%), Positives = 44/99 (44%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    + I I   + +  +   +      + Y LI  GA+GNV+D  ++G+V+D+I
Sbjct: 68  GWQKHFFTVLAIAISGLMAWWLRSTARGNWKAAVPYALIIGGAIGNVIDRQVHGHVVDFI 127

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
             +  ++++  FN+AD  I +G   I    +      K 
Sbjct: 128 QWYVGSYTWPSFNIADSAIVVGAVGIALFGLFEGKSAKK 166


>gi|330961574|gb|EGH61834.1| lipoprotein signal peptidase [Pseudomonas syringae pv. maculicola
           str. ES4326]
          Length = 168

 Score =  101 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 49/97 (50%), Gaps = 1/97 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +     +   I I++ A +    K+  +  +   I   L+  GALGN+ D  + G+VID+
Sbjct: 65  AGWQRWLFALIAIVVSAVLVVWLKRLGRDDTWLAIALALVLGGALGNLYDRVVLGHVIDF 124

Query: 63  IMIHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQH 98
           I++H Q  W F  FN+AD  I++G  ++  D    + 
Sbjct: 125 ILVHWQNRWYFPAFNVADSAITVGAIMLALDMFKSKK 161


>gi|256822880|ref|YP_003146843.1| lipoprotein signal peptidase [Kangiella koreensis DSM 16069]
 gi|256796419|gb|ACV27075.1| lipoprotein signal peptidase [Kangiella koreensis DSM 16069]
          Length = 177

 Score =  101 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 30/106 (28%), Positives = 52/106 (49%), Gaps = 3/106 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   ++ I I   + F       +K + ++G  LI +GA GN++D   YGYV+D+I
Sbjct: 70  GWQRWFFTAVAIGISLLLLFWMWCTESSKKLPNVGMALILSGAFGNLIDRMAYGYVVDFI 129

Query: 64  MIH--TQTWSFAVFNLADLFISIGTCIIIYDDIIL-QHRQKGKIDF 106
             +     + +  FN+AD  I IG  +++ D  +  + + K KID 
Sbjct: 130 DWYVSIDGYHWPTFNIADSVILIGVGLLLIDSFVNPEEKSKAKIDE 175


>gi|254523221|ref|ZP_05135276.1| signal peptidase II [Stenotrophomonas sp. SKA14]
 gi|219720812|gb|EED39337.1| signal peptidase II [Stenotrophomonas sp. SKA14]
          Length = 174

 Score =  101 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 23/99 (23%), Positives = 45/99 (45%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   ++ I I   + +  +   +      + Y LI  GA+GNV+D  ++G+V+D+I
Sbjct: 68  GWQKYFFTALAIAISGLMAWWLRGTARGNWKAAVPYALIIGGAIGNVIDRQVHGHVVDFI 127

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
             +  ++++  FN+AD  I +G   I    +      K 
Sbjct: 128 QWYVGSYTWPSFNIADSAIVVGAIGIALFGLFDGKSAKK 166


>gi|190573353|ref|YP_001971198.1| lipoprotein signal peptidase [Stenotrophomonas maltophilia K279a]
 gi|190011275|emb|CAQ44888.1| putative transmembrane signal peptidase [Stenotrophomonas
           maltophilia K279a]
          Length = 174

 Score =  101 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 23/99 (23%), Positives = 45/99 (45%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   ++ I I   + +  +   +      + Y LI  GA+GNV+D  ++G+V+D+I
Sbjct: 68  GWQKYFFTALAIAISGLMAWWLRGTARGNWKAAVPYALIIGGAIGNVIDRQVHGHVVDFI 127

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
             +  ++++  FN+AD  I +G   I    +      K 
Sbjct: 128 QWYVGSYTWPSFNIADSAIVVGAIGIALFGLFDGKSAKK 166


>gi|152998224|ref|YP_001343059.1| lipoprotein signal peptidase [Marinomonas sp. MWYL1]
 gi|150839148|gb|ABR73124.1| lipoprotein signal peptidase [Marinomonas sp. MWYL1]
          Length = 168

 Score =  101 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 26/101 (25%), Positives = 51/101 (50%), Gaps = 1/101 (0%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I + ++  I +   K  +T  +  +    +  GA+GN+ D  +YG+V+D++
Sbjct: 67  GWQRWFFSLIALAVVVGISWRLVKIAETNRLESLALTFVLGGAIGNLYDRLVYGHVVDFL 126

Query: 64  MIHT-QTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
             H  Q+W F  FNLAD  I+IG  +++ +  + + ++  K
Sbjct: 127 QFHWQQSWYFPAFNLADSAITIGVILMLLESFVTKKQEGTK 167


>gi|186475340|ref|YP_001856810.1| lipoprotein signal peptidase [Burkholderia phymatum STM815]
 gi|226801488|sp|B2JDY8|LSPA_BURP8 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|184191799|gb|ACC69764.1| lipoprotein signal peptidase [Burkholderia phymatum STM815]
          Length = 166

 Score =  101 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 30/98 (30%), Positives = 52/98 (53%), Gaps = 1/98 (1%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           M          ++ +     I ++ K++  T+ +F     LI  GA+GNV+D  LYG+VI
Sbjct: 67  MAGGWQRWAFTALGVAAAVLICYLLKRHG-TQKMFCTALALIMGGAIGNVIDRLLYGHVI 125

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
           D++  H   W +  FNLAD  I+IG  ++++D++    
Sbjct: 126 DFLDFHVGAWHWPAFNLADSAITIGAALLVFDELRRVR 163


>gi|260913217|ref|ZP_05919699.1| signal peptidase II [Pasteurella dagmatis ATCC 43325]
 gi|260632804|gb|EEX50973.1| signal peptidase II [Pasteurella dagmatis ATCC 43325]
          Length = 169

 Score =  101 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 28/101 (27%), Positives = 49/101 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + + I I   + +   KN  T+ + +  Y LI  GALGN+ D   +G+V+D+ 
Sbjct: 64  GWQKYFFIILAIGISLMLLYFLAKNNATQKLQNTAYTLIIGGALGNMADRSYHGFVVDFF 123

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
             +   + + VFN+AD+ ISIG  +++ D    +   K   
Sbjct: 124 DFYWDIYHYPVFNVADIAISIGAGLLMLDAFKNRENTKPNN 164


>gi|134281113|ref|ZP_01767822.1| signal peptidase II [Burkholderia pseudomallei 305]
 gi|167901636|ref|ZP_02488841.1| signal peptidase II [Burkholderia pseudomallei NCTC 13177]
 gi|134247419|gb|EBA47504.1| signal peptidase II [Burkholderia pseudomallei 305]
          Length = 166

 Score =  101 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 30/95 (31%), Positives = 51/95 (53%), Gaps = 1/95 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   ++ I     I ++ K++   + +F +   LI  GALGNV+D  +YG+VID++
Sbjct: 70  GWQRWAFTALGIGATLVICYLLKRHG-HQRLFSLSLALILGGALGNVIDRLIYGHVIDFL 128

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
             H   W +  FNLAD  I++G  ++IYD++    
Sbjct: 129 DFHVGAWHWPAFNLADSAITVGAALLIYDELRRVR 163


>gi|326793617|ref|YP_004311437.1| Lipoprotein signal peptidase [Marinomonas mediterranea MMB-1]
 gi|326544381|gb|ADZ89601.1| Lipoprotein signal peptidase [Marinomonas mediterranea MMB-1]
          Length = 167

 Score =  101 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 31/101 (30%), Positives = 52/101 (51%), Gaps = 1/101 (0%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I   ++  I +   K  KT  +  +   LI  GA+GN+ D  +YG+V+D+I
Sbjct: 66  GWQRWFFSFIAAAVVIGISWRLVKIGKTHVMESLALSLILGGAVGNLYDRLVYGHVVDFI 125

Query: 64  MIHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
            +H Q+ W F  FN+AD  I++G  +++ D  + Q +Q  K
Sbjct: 126 QVHWQSEWYFPAFNIADSAITLGVIVMLLDSFMPQRQQGDK 166


>gi|323497797|ref|ZP_08102811.1| lipoprotein signal peptidase [Vibrio sinaloensis DSM 21326]
 gi|323317144|gb|EGA70141.1| lipoprotein signal peptidase [Vibrio sinaloensis DSM 21326]
          Length = 167

 Score =  101 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 47/97 (48%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +     +   I  ++ A + +   K P  +   +I Y +I  GA+GNV D  ++G+V+DY
Sbjct: 68  AGWQRWLFTGIAFVVTALLTYWMSKLPAKEKWNNIAYAMIIGGAVGNVFDRVVHGFVVDY 127

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
           +      + +  FNLAD  I IG  +II D    +  
Sbjct: 128 LDFFWGNYHWPAFNLADTTICIGAAMIILDGFRRKED 164


>gi|53718546|ref|YP_107532.1| lipoprotein signal peptidase [Burkholderia pseudomallei K96243]
 gi|53726228|ref|YP_103807.1| lipoprotein signal peptidase [Burkholderia mallei ATCC 23344]
 gi|67641266|ref|ZP_00440048.1| signal peptidase II [Burkholderia mallei GB8 horse 4]
 gi|76810209|ref|YP_332533.1| lipoprotein signal peptidase [Burkholderia pseudomallei 1710b]
 gi|121599113|ref|YP_993956.1| lipoprotein signal peptidase [Burkholderia mallei SAVP1]
 gi|124386607|ref|YP_001027021.1| lipoprotein signal peptidase [Burkholderia mallei NCTC 10229]
 gi|126438494|ref|YP_001058017.1| lipoprotein signal peptidase [Burkholderia pseudomallei 668]
 gi|126451322|ref|YP_001081644.1| lipoprotein signal peptidase [Burkholderia mallei NCTC 10247]
 gi|126453443|ref|YP_001065251.1| signal peptidase II [Burkholderia pseudomallei 1106a]
 gi|166998898|ref|ZP_02264750.1| signal peptidase II [Burkholderia mallei PRL-20]
 gi|167718452|ref|ZP_02401688.1| signal peptidase II [Burkholderia pseudomallei DM98]
 gi|167737502|ref|ZP_02410276.1| signal peptidase II [Burkholderia pseudomallei 14]
 gi|167814620|ref|ZP_02446300.1| signal peptidase II [Burkholderia pseudomallei 91]
 gi|167823090|ref|ZP_02454561.1| signal peptidase II [Burkholderia pseudomallei 9]
 gi|167844651|ref|ZP_02470159.1| signal peptidase II [Burkholderia pseudomallei B7210]
 gi|217419698|ref|ZP_03451204.1| signal peptidase II [Burkholderia pseudomallei 576]
 gi|226194537|ref|ZP_03790135.1| signal peptidase II [Burkholderia pseudomallei Pakistan 9]
 gi|237811168|ref|YP_002895619.1| signal peptidase II [Burkholderia pseudomallei MSHR346]
 gi|242314633|ref|ZP_04813649.1| signal peptidase II [Burkholderia pseudomallei 1106b]
 gi|254175552|ref|ZP_04882212.1| signal peptidase II [Burkholderia mallei ATCC 10399]
 gi|254181498|ref|ZP_04888095.1| signal peptidase II [Burkholderia pseudomallei 1655]
 gi|254196540|ref|ZP_04902964.1| signal peptidase II [Burkholderia pseudomallei S13]
 gi|254202510|ref|ZP_04908873.1| signal peptidase II [Burkholderia mallei FMH]
 gi|254207845|ref|ZP_04914195.1| signal peptidase II [Burkholderia mallei JHU]
 gi|254258195|ref|ZP_04949249.1| signal peptidase II [Burkholderia pseudomallei 1710a]
 gi|254356260|ref|ZP_04972536.1| signal peptidase II [Burkholderia mallei 2002721280]
 gi|81823942|sp|Q62HL3|LSPA_BURMA RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|81824820|sp|Q63WI4|LSPA_BURPS RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|123600011|sp|Q3JV70|LSPA_BURP1 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|166232856|sp|A3MN08|LSPA_BURM7 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|166232857|sp|A2S502|LSPA_BURM9 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|166232858|sp|A1V6V3|LSPA_BURMS RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|166232859|sp|A3NSD0|LSPA_BURP0 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|166232860|sp|A3N6P6|LSPA_BURP6 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|52208960|emb|CAH34899.1| signal peptidase II [Burkholderia pseudomallei K96243]
 gi|52429651|gb|AAU50244.1| lipoprotein signal peptidase [Burkholderia mallei ATCC 23344]
 gi|76579662|gb|ABA49137.1| signal peptidase II [Burkholderia pseudomallei 1710b]
 gi|121227923|gb|ABM50441.1| signal peptidase II [Burkholderia mallei SAVP1]
 gi|124294627|gb|ABN03896.1| signal peptidase II [Burkholderia mallei NCTC 10229]
 gi|126217987|gb|ABN81493.1| signal peptidase II [Burkholderia pseudomallei 668]
 gi|126227085|gb|ABN90625.1| signal peptidase II [Burkholderia pseudomallei 1106a]
 gi|126244192|gb|ABO07285.1| signal peptidase II [Burkholderia mallei NCTC 10247]
 gi|147746757|gb|EDK53834.1| signal peptidase II [Burkholderia mallei FMH]
 gi|147751739|gb|EDK58806.1| signal peptidase II [Burkholderia mallei JHU]
 gi|148025257|gb|EDK83411.1| signal peptidase II [Burkholderia mallei 2002721280]
 gi|160696596|gb|EDP86566.1| signal peptidase II [Burkholderia mallei ATCC 10399]
 gi|169653283|gb|EDS85976.1| signal peptidase II [Burkholderia pseudomallei S13]
 gi|184212036|gb|EDU09079.1| signal peptidase II [Burkholderia pseudomallei 1655]
 gi|217397002|gb|EEC37018.1| signal peptidase II [Burkholderia pseudomallei 576]
 gi|225933622|gb|EEH29611.1| signal peptidase II [Burkholderia pseudomallei Pakistan 9]
 gi|237504543|gb|ACQ96861.1| signal peptidase II [Burkholderia pseudomallei MSHR346]
 gi|238522165|gb|EEP85611.1| signal peptidase II [Burkholderia mallei GB8 horse 4]
 gi|242137872|gb|EES24274.1| signal peptidase II [Burkholderia pseudomallei 1106b]
 gi|243064979|gb|EES47165.1| signal peptidase II [Burkholderia mallei PRL-20]
 gi|254216884|gb|EET06268.1| signal peptidase II [Burkholderia pseudomallei 1710a]
          Length = 166

 Score =  101 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 30/95 (31%), Positives = 51/95 (53%), Gaps = 1/95 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   ++ I     I ++ K++   + +F +   LI  GALGNV+D  +YG+VID++
Sbjct: 70  GWQRWAFTALGIGATLVICYLLKRH-GHQRLFSLSLALILGGALGNVIDRLIYGHVIDFL 128

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
             H   W +  FNLAD  I++G  ++IYD++    
Sbjct: 129 DFHVGAWHWPAFNLADSAITVGAVLLIYDELRRVR 163


>gi|297183895|gb|ADI20017.1| lipoprotein signal peptidase [uncultured gamma proteobacterium
           EB000_65A11]
          Length = 157

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 27/100 (27%), Positives = 49/100 (49%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                 LV++  ++ A I     +   T+ +  +   LI  GA+GN++D    G+V+D++
Sbjct: 57  GWQRWFLVTVSTVVSAIIGVWLFRIRSTEKLLAVALCLILGGAVGNLIDRVAAGFVVDFL 116

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
           ++H     F  FN+AD  IS+G   +I D  +    +K  
Sbjct: 117 LVHWDEHYFPAFNVADAAISVGAGCLILDMFLKPKLEKVN 156


>gi|237747566|ref|ZP_04578046.1| signal peptidase II [Oxalobacter formigenes OXCC13]
 gi|229378928|gb|EEO29019.1| signal peptidase II [Oxalobacter formigenes OXCC13]
          Length = 167

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 31/98 (31%), Positives = 56/98 (57%), Gaps = 1/98 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +        +I I+ I FI ++ KK+   + +F +   LI +GA+GN++D  LYG+VID+
Sbjct: 71  AGWQRYFFTAISIVAIVFIVYLLKKH-SQERLFCLALALILSGAVGNLIDRSLYGHVIDF 129

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
           + ++   W +  FN+AD  I IG  + I D++    ++
Sbjct: 130 LDVYANGWHWPTFNIADSAICIGAVLFIIDELKRVSKK 167


>gi|296531856|ref|ZP_06894661.1| signal peptidase II [Roseomonas cervicalis ATCC 49957]
 gi|296267826|gb|EFH13646.1| signal peptidase II [Roseomonas cervicalis ATCC 49957]
          Length = 173

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 25/97 (25%), Positives = 47/97 (48%), Gaps = 5/97 (5%)

Query: 1   MLSNVSP---TILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYG 57
           M ++ +     +LV I+++++A++    ++             LI  GALGN++D    G
Sbjct: 69  MFADSAAGAVWLLVGIKLVVVAWLLLWLRR--AASRTEATAIGLIIGGALGNILDRLRIG 126

Query: 58  YVIDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDI 94
            V D+I  H   W +  FN+AD+ I  G  +++    
Sbjct: 127 AVTDFIDAHYGGWHWPTFNMADVAIVCGVTLLVLTSF 163


>gi|149377781|ref|ZP_01895514.1| lipoprotein signal peptidase [Marinobacter algicola DG893]
 gi|149357953|gb|EDM46442.1| lipoprotein signal peptidase [Marinobacter algicola DG893]
          Length = 172

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 48/97 (49%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +       VS+ +++   +    K   + ++   I  +LI  GALGNV D  ++GYV+D+
Sbjct: 66  AGWQRWFFVSLALVVSVVLVVWLKSLRRDETWSAIAIVLILGGALGNVYDRVVHGYVVDF 125

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
           +  +   + F  FN+AD  I+IG  ++I D       
Sbjct: 126 LHFYWNDYHFPAFNIADTAITIGAGMMILDIFRKPRE 162


>gi|161523962|ref|YP_001578974.1| lipoprotein signal peptidase [Burkholderia multivorans ATCC 17616]
 gi|189351277|ref|YP_001946905.1| lipoprotein signal peptidase [Burkholderia multivorans ATCC 17616]
 gi|221199256|ref|ZP_03572300.1| signal peptidase II [Burkholderia multivorans CGD2M]
 gi|221205842|ref|ZP_03578857.1| signal peptidase II [Burkholderia multivorans CGD2]
 gi|221211477|ref|ZP_03584456.1| signal peptidase II [Burkholderia multivorans CGD1]
 gi|238058047|sp|A9AGN5|LSPA_BURM1 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|160341391|gb|ABX14477.1| lipoprotein signal peptidase [Burkholderia multivorans ATCC 17616]
 gi|189335299|dbj|BAG44369.1| signal peptidase II [Burkholderia multivorans ATCC 17616]
 gi|221168838|gb|EEE01306.1| signal peptidase II [Burkholderia multivorans CGD1]
 gi|221174680|gb|EEE07112.1| signal peptidase II [Burkholderia multivorans CGD2]
 gi|221180541|gb|EEE12944.1| signal peptidase II [Burkholderia multivorans CGD2M]
          Length = 166

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 33/96 (34%), Positives = 52/96 (54%), Gaps = 1/96 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S        ++ +     I F+ K++   + +F +   LI  GALGNV+D  +YG+VID+
Sbjct: 69  SGWQRWAFTALGVGATLVICFLLKRH-GHQRLFSLSLALILGGALGNVIDRLVYGHVIDF 127

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
           +  H   W F  FNLAD  I+IG  ++IYD++    
Sbjct: 128 LDFHLGGWHFPAFNLADSAITIGAVLLIYDELRRVR 163


>gi|329889724|ref|ZP_08268067.1| signal peptidase II [Brevundimonas diminuta ATCC 11568]
 gi|328845025|gb|EGF94589.1| signal peptidase II [Brevundimonas diminuta ATCC 11568]
          Length = 165

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 24/90 (26%), Positives = 44/90 (48%), Gaps = 2/90 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
           ++   +L  + +LII  +     +    + +   G  L+  GALGN++D   +G+V D+I
Sbjct: 60  DMGRWVLSIVSLLIIVVLSIWAWRTR--RPLLAAGLSLMVGGALGNLLDRLRFGHVTDFI 117

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDD 93
            +H     +  FNLAD  I  G  +++   
Sbjct: 118 DLHWGDAHWPTFNLADAAIVCGIGLLLLAS 147


>gi|257487501|ref|ZP_05641542.1| lipoprotein signal peptidase [Pseudomonas syringae pv. tabaci ATCC
           11528]
 gi|320330655|gb|EFW86632.1| lipoprotein signal peptidase [Pseudomonas syringae pv. glycinea
           str. race 4]
 gi|330891591|gb|EGH24252.1| lipoprotein signal peptidase [Pseudomonas syringae pv. mori str.
           301020]
 gi|330988788|gb|EGH86891.1| lipoprotein signal peptidase [Pseudomonas syringae pv. lachrymans
           str. M301315]
 gi|331008752|gb|EGH88808.1| lipoprotein signal peptidase [Pseudomonas syringae pv. tabaci ATCC
           11528]
          Length = 168

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 49/97 (50%), Gaps = 1/97 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +     +   I I++ A +    K+  +  +   +   L+  GALGN+ D  + G+VID+
Sbjct: 65  AGWQRWLFALIAIVVSAVLVVWLKRLGRDDTWLAVALALVLGGALGNLYDRIVLGHVIDF 124

Query: 63  IMIHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQH 98
           I++H Q  W F  FN+AD  I++G  ++  D    + 
Sbjct: 125 ILVHWQNRWYFPAFNVADSAITVGAIMLALDMFKSKK 161


>gi|119946876|ref|YP_944556.1| lipoprotein signal peptidase [Psychromonas ingrahamii 37]
 gi|166232871|sp|A1SZP2|LSPA_PSYIN RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|119865480|gb|ABM04957.1| signal peptidase II. Aspartic peptidase. MEROPS family A08
           [Psychromonas ingrahamii 37]
          Length = 173

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 31/101 (30%), Positives = 54/101 (53%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +  +I I++ +++ ++ KKN  T    +  Y LI +GALGNVVD  ++GYVID++
Sbjct: 66  GWQRYLFTAIAIVVSSYLVYLLKKNASTDRWINCAYALILSGALGNVVDRMMFGYVIDFL 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
                 + +  FN+AD  I  G  I+I++    +  +  K 
Sbjct: 126 DFDLGFYRWPTFNIADSAIFTGAVIMIFESFFAKQAKPIKQ 166


>gi|330881360|gb|EGH15509.1| lipoprotein signal peptidase [Pseudomonas syringae pv. glycinea
           str. race 4]
          Length = 168

 Score =  101 bits (253), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 48/97 (49%), Gaps = 1/97 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +         I I++ A +    K+  +  +   +   L+  GALGN+ D  + G+VID+
Sbjct: 65  AGWQRWFFALIAIVVSAVLVVWLKRLGRDDTWLAVALALVLGGALGNLYDRIVLGHVIDF 124

Query: 63  IMIHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQH 98
           I++H Q  W F  FN+AD  I++G  ++  D    + 
Sbjct: 125 ILVHWQNRWYFPAFNVADSAITVGAIMLALDMFKSKK 161


>gi|90407187|ref|ZP_01215375.1| lipoprotein signal peptidase [Psychromonas sp. CNPT3]
 gi|90311763|gb|EAS39860.1| lipoprotein signal peptidase [Psychromonas sp. CNPT3]
          Length = 173

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 33/93 (35%), Positives = 52/93 (55%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +  +I +L+ AF+     KN  TKS  +I + LI  GALGN+VD  ++GYV+D++
Sbjct: 66  GWQRYLFTAIAVLVSAFLVHSLYKNRVTKSRENIAFALILAGALGNLVDRLMFGYVVDFL 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIIL 96
                 + +  FN+AD+ I IG  ++I D I  
Sbjct: 126 DFDLGFYRWPTFNVADISIFIGAALLILDGIFN 158


>gi|255320685|ref|ZP_05361862.1| signal peptidase II [Acinetobacter radioresistens SK82]
 gi|262380683|ref|ZP_06073836.1| signal peptidase II [Acinetobacter radioresistens SH164]
 gi|255302301|gb|EET81541.1| signal peptidase II [Acinetobacter radioresistens SK82]
 gi|262297631|gb|EEY85547.1| signal peptidase II [Acinetobacter radioresistens SH164]
          Length = 178

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 27/102 (26%), Positives = 49/102 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +   +   +     F   + PK   I  +   LI  GA+GN++D    GYV+D+I
Sbjct: 74  GWQRYLFTGLAAGVSLLFVFWLMRMPKHLVILPMAIALILGGAIGNLIDRVSLGYVVDFI 133

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
            ++ Q   F  FN+AD  I++GT +++ D   L+  +  + +
Sbjct: 134 HVYYQNSHFPAFNIADSAITLGTILLLIDTFFLEKHRIQRAE 175


>gi|189424048|ref|YP_001951225.1| lipoprotein signal peptidase [Geobacter lovleyi SZ]
 gi|189420307|gb|ACD94705.1| lipoprotein signal peptidase [Geobacter lovleyi SZ]
          Length = 162

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 23/102 (22%), Positives = 48/102 (47%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
           +      + I ++    I    KK    + +      +I +GA+GN++D    G VID++
Sbjct: 61  SWRLPFFIGITLVAAVVIIVALKKMRDDQKLAQAALAMIFSGAIGNLIDRVRMGEVIDFL 120

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
            ++ +   +  FN+AD  I +G  ++  D +  +  Q+ + D
Sbjct: 121 DVYWKNHHWPAFNVADSLICVGVALVALDMLKEERNQQARAD 162


>gi|51246403|ref|YP_066287.1| lipoprotein signal peptidase [Desulfotalea psychrophila LSv54]
 gi|81826764|sp|Q6AK46|LSPA_DESPS RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|50877440|emb|CAG37280.1| probable lipoprotein signal peptidase [Desulfotalea psychrophila
           LSv54]
          Length = 165

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 23/101 (22%), Positives = 48/101 (47%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S       + I +  +  +        K   +  +G   I  GALGN++D   YGYV+D+
Sbjct: 64  SPWRHYFFLFIGLGAVLGLTVYTYTLRKEHFLHMVGLACIVGGALGNLIDRVSYGYVVDF 123

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
           + ++   + +  FN+AD  I +G  + +   ++  +++K +
Sbjct: 124 LDVYVGGYHWPAFNVADSAICVGVVLYMTMTLLAGNKEKKQ 164


>gi|296135802|ref|YP_003643044.1| lipoprotein signal peptidase [Thiomonas intermedia K12]
 gi|295795924|gb|ADG30714.1| lipoprotein signal peptidase [Thiomonas intermedia K12]
          Length = 175

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 29/103 (28%), Positives = 50/103 (48%), Gaps = 5/103 (4%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   ++ +    FI ++  +N   K +F++    I  GALGNV+D  L+G V D++
Sbjct: 74  GWQRWFFTALSLAASLFILWLMFRNR-GKPLFNLALACILGGALGNVIDRVLWGKVTDFL 132

Query: 64  MIHT----QTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
             +     Q W +  FNLAD  I IG  ++I D++    + + 
Sbjct: 133 DFYITLNGQQWHWPAFNLADSAIFIGAMLLIVDELRRARQHRS 175


>gi|325526426|gb|EGD04012.1| lipoprotein signal peptidase [Burkholderia sp. TJI49]
          Length = 166

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 34/96 (35%), Positives = 53/96 (55%), Gaps = 1/96 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S        ++ I     I F+ K++   + +F +   LI  GALGNV+D  +YG+VID+
Sbjct: 69  SGWQRWAFTALGIGATLVICFLLKRHG-HQRLFSLSLALILGGALGNVIDRIIYGHVIDF 127

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
           +  H  TW F  FNLAD  I+IG  +++YD++    
Sbjct: 128 LDFHLGTWHFPAFNLADSAITIGAVLLVYDELRRVR 163


>gi|21242009|ref|NP_641591.1| lipoprotein signal peptidase [Xanthomonas axonopodis pv. citri str.
           306]
 gi|81860658|sp|Q8PN18|LSPA_XANAC RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|21107407|gb|AAM36127.1| lipoprotein signal peptidase [Xanthomonas axonopodis pv. citri str.
           306]
          Length = 172

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 21/98 (21%), Positives = 46/98 (46%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   ++ + I   + F   +  + +    + Y L+  GA+GNV+D  ++G+V+D+I
Sbjct: 67  GWQLWFFTALAVGISGLLAFWLSRTARGQWRSALPYALVIGGAIGNVIDRLMHGHVVDFI 126

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
             +  + ++  FN+AD  I  G   I    +  +  ++
Sbjct: 127 QWYIGSHTWPSFNIADSAIVGGAIGIAVFGLFDKSDKQ 164


>gi|315634920|ref|ZP_07890202.1| signal peptidase II [Aggregatibacter segnis ATCC 33393]
 gi|315476472|gb|EFU67222.1| signal peptidase II [Aggregatibacter segnis ATCC 33393]
          Length = 166

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 26/99 (26%), Positives = 46/99 (46%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + + I I   + +  KKN   + + +  Y LI  GAL N+VD    G+V+D+ 
Sbjct: 64  GWQKYFFILLAISISLMLAYFMKKNRADQKLQNSAYALIIGGALANMVDRAYNGFVVDFF 123

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
             +   + + VFN+AD+ I IG  ++  D       ++ 
Sbjct: 124 DFYWDIYHYPVFNVADIAICIGAGLLALDAFKGDKNKQK 162


>gi|319786584|ref|YP_004146059.1| lipoprotein signal peptidase [Pseudoxanthomonas suwonensis 11-1]
 gi|317465096|gb|ADV26828.1| lipoprotein signal peptidase [Pseudoxanthomonas suwonensis 11-1]
          Length = 171

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 22/99 (22%), Positives = 43/99 (43%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    +   I   + +   + P+      + Y L+  GA+GNV+D  ++G+V+D+I
Sbjct: 71  GWQIVFFSVLAFAISGLMGWWLWRTPRGDWRQALPYSLVIGGAVGNVIDRMVHGHVVDFI 130

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
             H + + +  FN+AD  +  G   I    ++     K 
Sbjct: 131 QWHWRDYYWPAFNIADCAVVGGAIGIALFGLVGARSPKA 169


>gi|218460932|ref|ZP_03501023.1| putative transmembrane lipoprotein signal peptidase [Rhizobium etli
           Kim 5]
          Length = 128

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 44/99 (44%), Positives = 71/99 (71%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           MLS +    +V +R++I+AF+ ++W +  K + +  +GY LI  GA+GN++D   YG+VI
Sbjct: 27  MLSGMDGWFIVGMRLIIVAFVIWLWYRTAKDRWLAHLGYALIIAGAIGNLIDRFAYGHVI 86

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
           DYI+ +T++WSFAVFNLAD FI+IG   +I D+++L  +
Sbjct: 87  DYILFYTESWSFAVFNLADSFITIGAACVILDELLLPKK 125


>gi|120612104|ref|YP_971782.1| lipoprotein signal peptidase [Acidovorax citrulli AAC00-1]
 gi|120590568|gb|ABM34008.1| signal peptidase II [Acidovorax citrulli AAC00-1]
          Length = 169

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 31/96 (32%), Positives = 50/96 (52%), Gaps = 1/96 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +   I +    FI +  + +P  + +F      I  GA+GNVVD  ++GYV+D++
Sbjct: 73  GWQRWVFTGIGVAAAFFIVWQLRAHP-GQKLFCFALSSILGGAIGNVVDRMMHGYVVDFL 131

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
             H + W F  FNLAD  I+IG   +I D+++   R
Sbjct: 132 DFHARGWHFPAFNLADSAITIGAACLIIDELMRVRR 167


>gi|313200307|ref|YP_004038965.1| lipoprotein signal peptidase [Methylovorus sp. MP688]
 gi|312439623|gb|ADQ83729.1| lipoprotein signal peptidase [Methylovorus sp. MP688]
          Length = 159

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 27/94 (28%), Positives = 49/94 (52%), Gaps = 1/94 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   +I ++    I F+ +++P T+ +F     L+  GALGN+ D    GYV+D++
Sbjct: 66  GWQRVFFSAIALIASGIILFMLRRHP-TQKLFCFALALVLGGALGNLYDRLTLGYVVDFL 124

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQ 97
             H Q++ +  FN+AD  I +G  ++I D    +
Sbjct: 125 FFHYQSFYWPAFNVADSAICVGVALLILDSFKKK 158


>gi|146310249|ref|YP_001175323.1| lipoprotein signal peptidase [Enterobacter sp. 638]
 gi|167008959|sp|A4W6E2|LSPA_ENT38 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|145317125|gb|ABP59272.1| signal peptidase II, Aspartic peptidase, MEROPS family A08
           [Enterobacter sp. 638]
          Length = 166

 Score =  101 bits (252), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 28/101 (27%), Positives = 46/101 (45%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I + I   +  +  +   ++ + +I Y LI  GALGN+ D   +G+V+D I
Sbjct: 66  GWQRWFFAGIALGICLVLTVMMYRAKASQKLNNIAYALIIGGALGNLFDRLWHGFVVDMI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
             +   W FA FNLAD  I  G  +I+ +  +     K + 
Sbjct: 126 DFYVGNWHFATFNLADSAICFGAAMIVLEGFLPNAAAKKQA 166


>gi|260220489|emb|CBA28077.1| Lipoprotein signal peptidase [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 153

 Score =  101 bits (252), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 24/96 (25%), Positives = 47/96 (48%), Gaps = 1/96 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   ++  +    I ++  ++   + +F      I  GA+GNV+D  ++GYV+D++
Sbjct: 58  GWQRWFFTALGFVAAVVIIWLL-RSHAGQKLFSFAMACILGGAVGNVIDRLIHGYVVDFL 116

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
             H     F  FN+AD  IS+G   +I D+++   +
Sbjct: 117 DFHWNGMHFPAFNVADCAISVGAMCLILDELLRVRK 152


>gi|261856810|ref|YP_003264093.1| lipoprotein signal peptidase [Halothiobacillus neapolitanus c2]
 gi|261837279|gb|ACX97046.1| lipoprotein signal peptidase [Halothiobacillus neapolitanus c2]
          Length = 189

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 20/108 (18%), Positives = 43/108 (39%), Gaps = 9/108 (8%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKS---------IFDIGYILITTGALGNVVDHC 54
                    +  ++   +     + P+            +  +   LI  GA+GN++D  
Sbjct: 71  GWQRWGFAVLAFIVALGLMAWLLRIPRALPGVAVRPGVGVVKVAIALIIGGAVGNLIDRL 130

Query: 55  LYGYVIDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
             GYV+D++  H   + +  FN+AD  I +G  ++I  ++     +  
Sbjct: 131 TLGYVVDFLDFHWHAYHWPAFNVADSAIVVGVVLLILFELRPNPEKPN 178


>gi|237801851|ref|ZP_04590312.1| lipoprotein signal peptidase [Pseudomonas syringae pv. oryzae str.
           1_6]
 gi|331024709|gb|EGI04765.1| lipoprotein signal peptidase [Pseudomonas syringae pv. oryzae str.
           1_6]
          Length = 168

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 48/97 (49%), Gaps = 1/97 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +     +   I + + A +    K+  +  +   +   L+  GALGN+ D  + G+VID+
Sbjct: 65  AGWQRWLFALIAVAVSAVLVIWLKRLGRDDTWLAVALALVLGGALGNLYDRIVLGHVIDF 124

Query: 63  IMIHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQH 98
           I++H Q  W F  FN+AD  I++G  ++  D    + 
Sbjct: 125 ILVHWQNRWYFPAFNVADSAITVGAIMLALDMFKSKK 161


>gi|134093782|ref|YP_001098857.1| prolipoprotein signal peptidase [Herminiimonas arsenicoxydans]
          Length = 147

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 23/100 (23%), Positives = 46/100 (46%), Gaps = 2/100 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  +++   +  ++    +K  +  ++    Y LI  GALGN +D  L G+V+DY+
Sbjct: 33  GWQRYFFITLAFGVSMWLALELRK--QLPTLSAWAYSLILGGALGNAIDRLLRGHVVDYL 90

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
             H  +W +  FN AD+ I  G  +++ + +        +
Sbjct: 91  DFHLGSWHWPAFNAADIGIVCGAVLLVVESLRPAVDDPKE 130


>gi|289625178|ref|ZP_06458132.1| lipoprotein signal peptidase [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289651362|ref|ZP_06482705.1| lipoprotein signal peptidase [Pseudomonas syringae pv. aesculi str.
           2250]
 gi|330869174|gb|EGH03883.1| lipoprotein signal peptidase [Pseudomonas syringae pv. aesculi str.
           0893_23]
          Length = 168

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 49/97 (50%), Gaps = 1/97 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +     +   I I++ A +    K+  +  +   +   L+  GALGN+ D  + G+VID+
Sbjct: 65  AGWQRWLFALIAIVVSAVLVVWLKRLGRDDTWLAVALALVLGGALGNLYDRIVLGHVIDF 124

Query: 63  IMIHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQH 98
           I++H Q  W F  FN+AD  I++G  ++  D    + 
Sbjct: 125 ILVHWQNRWYFPAFNVADSAITVGAIMLALDMFKSKK 161


>gi|300310735|ref|YP_003774827.1| lipoprotein signal peptidase [Herbaspirillum seropedicae SmR1]
 gi|300073520|gb|ADJ62919.1| lipoprotein signal peptidase [Herbaspirillum seropedicae SmR1]
          Length = 171

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 52/97 (53%), Gaps = 1/97 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +  +I I    FI  + +K+P  + +F     LI  GA+GNV+D  +YG+VID++
Sbjct: 76  GWQRYLFTAIGIGAAVFIIHLLRKHP-GQRMFCWALALILGGAIGNVIDRVVYGHVIDFL 134

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
            ++   W +  FN+AD  I +G  + + D++    R+
Sbjct: 135 DVYVGNWHWPAFNIADSAICVGAVLFVVDELRRVSRK 171


>gi|311692987|gb|ADP95860.1| lipoprotein signal peptidase [marine bacterium HP15]
          Length = 171

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 27/105 (25%), Positives = 50/105 (47%), Gaps = 2/105 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  ++I +++ A +  + +     +    + Y ++  GALGNV+D    G+V+DY+
Sbjct: 67  GWQRYFFIAIAVVVSAVLVKLIR--DSHQRTEALAYAMVLGGALGNVIDRVFRGHVVDYL 124

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDFPQ 108
             H Q+W +  FNLAD+FI +G  +I+      +          Q
Sbjct: 125 DFHWQSWHWPAFNLADVFIVLGVIMILVTGFTAEKGVGNNTKNRQ 169


>gi|212213108|ref|YP_002304044.1| lipoprotein signal peptidase [Coxiella burnetii CbuG_Q212]
 gi|212011518|gb|ACJ18899.1| lipoprotein signal peptidase [Coxiella burnetii CbuG_Q212]
          Length = 165

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 26/98 (26%), Positives = 48/98 (48%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +        +I  ++  F+     +  +++ +  +G  LI  GALGN +D   + YV D+
Sbjct: 67  NGWQIIFFAAISFVVSIFLILWLSRTSRSEIMMSLGLSLIIGGALGNFIDRLRWSYVTDF 126

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
           I  H + W FA FN+AD  I +G  ++I   ++    +
Sbjct: 127 IDFHIKDWHFATFNVADSAICVGVFLLIVHMLLTPSSK 164


>gi|193222238|emb|CAL60730.2| Lipoprotein signal peptidase (Prolipoprotein signal peptidase)
           (Signal peptidase II) (SPase II) [Herminiimonas
           arsenicoxydans]
          Length = 180

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 23/100 (23%), Positives = 46/100 (46%), Gaps = 2/100 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  +++   +  ++    +K  +  ++    Y LI  GALGN +D  L G+V+DY+
Sbjct: 66  GWQRYFFITLAFGVSMWLALELRK--QLPTLSAWAYSLILGGALGNAIDRLLRGHVVDYL 123

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
             H  +W +  FN AD+ I  G  +++ + +        +
Sbjct: 124 DFHLGSWHWPAFNAADIGIVCGAVLLVVESLRPAVDDPKE 163


>gi|289662727|ref|ZP_06484308.1| lipoprotein signal peptidase [Xanthomonas campestris pv. vasculorum
           NCPPB702]
 gi|289670396|ref|ZP_06491471.1| lipoprotein signal peptidase [Xanthomonas campestris pv. musacearum
           NCPPB4381]
          Length = 172

 Score =  100 bits (251), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 21/99 (21%), Positives = 45/99 (45%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   ++ + I   + F   +  +      + Y L+  GA+GNV+D  ++G+V+D+I
Sbjct: 67  GWQLWFFTALAVGISGLLAFWLSRTARGHWRSALPYALVIGGAIGNVIDRLMHGHVVDFI 126

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
             +  + ++  FN+AD  I  G   I    +  +  ++ 
Sbjct: 127 QWYIGSHTWPSFNIADSAIVGGAIGIAVFGLFDKSGKQE 165


>gi|299529843|ref|ZP_07043275.1| lipoprotein signal peptidase [Comamonas testosteroni S44]
 gi|298722146|gb|EFI63071.1| lipoprotein signal peptidase [Comamonas testosteroni S44]
          Length = 168

 Score =  100 bits (251), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 28/104 (26%), Positives = 47/104 (45%), Gaps = 1/104 (0%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
               + LV++ I   AF+ ++  +         +GY  I  GALGNV+D   +G V+D++
Sbjct: 64  GWQRSFLVALGIAASAFLTWLIAREKTATP-EAVGYAAILGGALGNVIDRVRHGAVVDWL 122

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDFP 107
             H   W +  FN AD+ I++G   ++        R       P
Sbjct: 123 DFHWGDWHWPAFNAADIGITLGAGFLLIAAFRGHERNGADSHTP 166


>gi|167835731|ref|ZP_02462614.1| signal peptidase II [Burkholderia thailandensis MSMB43]
          Length = 166

 Score =  100 bits (251), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 30/95 (31%), Positives = 51/95 (53%), Gaps = 1/95 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   ++ I     I ++ K++   + +F +   LI  GALGNV+D  +YG+VID++
Sbjct: 70  GWQRWAFTALGIGATLAICYLLKRH-GHQRLFSLSLALILGGALGNVIDRLIYGHVIDFL 128

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
             H   W +  FNLAD  I++G  ++IYD++    
Sbjct: 129 DFHVGAWHWPAFNLADSAITVGAVLLIYDELRRVR 163


>gi|264678600|ref|YP_003278507.1| lipoprotein signal peptidase [Comamonas testosteroni CNB-2]
 gi|262209113|gb|ACY33211.1| lipoprotein signal peptidase [Comamonas testosteroni CNB-2]
          Length = 161

 Score =  100 bits (251), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 28/104 (26%), Positives = 48/104 (46%), Gaps = 1/104 (0%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
               + LV++ I   AF+ ++  +         +GY  I  GALGNV+D   +G V+D++
Sbjct: 57  GWQRSFLVALGIAASAFLTWLIAREKTATP-EAVGYAAILGGALGNVIDRVRHGAVVDWL 115

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDFP 107
             H   W +  FN AD+ I++G  +++        R       P
Sbjct: 116 DFHWGDWHWPAFNAADIGITLGAGVLLIAAFRGHERNGADSHTP 159


>gi|332305533|ref|YP_004433384.1| lipoprotein signal peptidase [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332172862|gb|AEE22116.1| lipoprotein signal peptidase [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 164

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 25/96 (26%), Positives = 50/96 (52%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +   I I +   + +  K+  + + +  + + LI  GALGNV D  ++G+VID++
Sbjct: 66  GWQRWLFTGIAIAVCGLVTWWLKETTRQQVMLPVAFCLIIGGALGNVFDRLMHGFVIDFL 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
           +++ Q W +  FN+AD  I +G  +++ D    +  
Sbjct: 126 VLYYQDWYWPAFNVADSAICLGAFLLVIDMFKNKDN 161


>gi|209547649|ref|YP_002279566.1| lipoprotein signal peptidase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209533405|gb|ACI53340.1| lipoprotein signal peptidase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 167

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 44/99 (44%), Positives = 69/99 (69%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           ML  +    +V +R++I+AF+ ++W +  K + +  +GY LI  GA+GN+VD   YG+VI
Sbjct: 66  MLEGMDGWFIVGMRLIIVAFVIWLWYRTAKDRWLAHLGYALIIAGAIGNLVDRFAYGHVI 125

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
           DYI+ +T +WSFAVFNLAD FI+IG   +I D+++L  +
Sbjct: 126 DYILFYTDSWSFAVFNLADSFITIGAGCVILDELLLPKK 164


>gi|71737215|ref|YP_273014.1| lipoprotein signal peptidase [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|71557768|gb|AAZ36979.1| signal peptidase II [Pseudomonas syringae pv. phaseolicola 1448A]
          Length = 168

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 49/97 (50%), Gaps = 1/97 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +     +   I I++ A +    K+  +  +   +   L+  GALGN+ D  + G+VID+
Sbjct: 65  AGWQRWLFALIAIVVSAVLVVWLKRLVRDDTWLAVALALVLGGALGNLYDRIVLGHVIDF 124

Query: 63  IMIHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQH 98
           I+IH Q  W F  FN+AD  I++G  ++  D    + 
Sbjct: 125 ILIHWQNRWYFPAFNVADSAITVGAIMLALDMFKSKK 161


>gi|209364145|ref|YP_001425007.2| lipoprotein signal peptidase [Coxiella burnetii Dugway 5J108-111]
 gi|207082078|gb|ABS77217.2| lipoprotein signal peptidase [Coxiella burnetii Dugway 5J108-111]
          Length = 165

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 26/98 (26%), Positives = 48/98 (48%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +        +I  ++  F+     +  +++ +  +G  LI  GALGN +D   + YV D+
Sbjct: 67  NGWQIIFFAAISFVVSIFLILWLSRTSRSEIMMSLGLSLIIGGALGNFIDRLRWSYVTDF 126

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
           I  H + W FA FN+AD  I +G  ++I   ++    +
Sbjct: 127 IDFHIKDWHFATFNVADSAICVGVFLLIVYMLLTPSSK 164


>gi|300715263|ref|YP_003740066.1| Lipoprotein signal peptidase [Erwinia billingiae Eb661]
 gi|299061099|emb|CAX58206.1| Lipoprotein signal peptidase [Erwinia billingiae Eb661]
          Length = 166

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 28/101 (27%), Positives = 48/101 (47%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I + I+  +  +  +   +  + +I Y LI  GALGN+ D   +G+V+D+I
Sbjct: 66  GWQRWFFAGIAVAIVVALLVMMYRTAASNKLNNIAYALIIGGALGNLFDRAYHGFVVDFI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
             +   W FA FN+AD  I IG  +I+ +  +    +  K 
Sbjct: 126 DFYVGDWHFATFNIADCAICIGAALIVLEGFLSPSGKPAKN 166


>gi|82703768|ref|YP_413334.1| lipoprotein signal peptidase [Nitrosospira multiformis ATCC 25196]
 gi|82411833|gb|ABB75942.1| signal peptidase II, Aspartic peptidase, MEROPS family A08
           [Nitrosospira multiformis ATCC 25196]
          Length = 160

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 24/95 (25%), Positives = 43/95 (45%), Gaps = 1/95 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   ++       I F+  ++     +F I   LI  GALGN+ D    G+V+D++
Sbjct: 60  GWQRWFFTTVSAGASVLIVFLLYRHAAD-KLFCIALSLILGGALGNLWDRATLGHVVDFL 118

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
             H   + +  FN+AD  IS+G  +++ D    + 
Sbjct: 119 DFHVAGYHWPAFNVADSAISLGAVLLVIDGFRRKD 153


>gi|220903665|ref|YP_002478977.1| lipoprotein signal peptidase [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
 gi|219867964|gb|ACL48299.1| lipoprotein signal peptidase [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
          Length = 178

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 20/99 (20%), Positives = 42/99 (42%), Gaps = 1/99 (1%)

Query: 5   VSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIM 64
               + +   ++ +  I  + + +     +F  G  L+  GALGN+VD   +  V+D++ 
Sbjct: 65  WQFWLFLGATVVAVWAILMLVRSSHDEPWLFA-GLGLVMGGALGNLVDRIRFRAVVDFLD 123

Query: 65  IHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
           ++   W +  FN+AD  I +G  +              +
Sbjct: 124 VYWGDWHWPAFNVADSAIFVGAALACVIMWRKPPENGNE 162


>gi|218671454|ref|ZP_03521124.1| lipoprotein signal peptidase protein [Rhizobium etli GR56]
          Length = 154

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 45/99 (45%), Positives = 71/99 (71%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           MLS +    +V +R++I+AF+ ++W +  K + +  +GY LI  GA+GN+VD   YG+VI
Sbjct: 53  MLSGMDGWFIVGMRLIIVAFVIWLWYRTAKDRWLAHLGYALIIAGAIGNLVDRFAYGHVI 112

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
           DYI+ +T++WSFAVFNLAD FI+IG   +I D+++L  +
Sbjct: 113 DYILFYTESWSFAVFNLADSFITIGAACVILDELLLPKK 151


>gi|120553795|ref|YP_958146.1| lipoprotein signal peptidase [Marinobacter aquaeolei VT8]
 gi|120323644|gb|ABM17959.1| signal peptidase II, Aspartic peptidase, MEROPS family A08
           [Marinobacter aquaeolei VT8]
          Length = 173

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 28/94 (29%), Positives = 49/94 (52%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +       V++ +++   +    +K    ++   I  +LI  GA+GNV D  ++GYV+D+
Sbjct: 68  AGWQRWFFVALAVVVSVVLVGWLRKLKADETWTAIAIVLILGGAIGNVYDRVVHGYVVDF 127

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIIL 96
           +  + Q W F  FNLAD  I+IG  ++I D    
Sbjct: 128 LHFYWQDWHFPAFNLADTAITIGAAMMIIDAFRK 161


>gi|296535778|ref|ZP_06897939.1| signal peptidase II [Roseomonas cervicalis ATCC 49957]
 gi|296263846|gb|EFH10310.1| signal peptidase II [Roseomonas cervicalis ATCC 49957]
          Length = 172

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 27/87 (31%), Positives = 45/87 (51%), Gaps = 2/87 (2%)

Query: 7   PTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIH 66
           P +L S+ + +IA +     ++ +      IG+  I  GALGNVVD   +G V D++  H
Sbjct: 73  PWLLSSLALAVIAGLVVWTTRDRRPGMAASIGF--IVGGALGNVVDRLRHGAVTDFLDFH 130

Query: 67  TQTWSFAVFNLADLFISIGTCIIIYDD 93
              + +  FNLAD  I +G  +++   
Sbjct: 131 VAGYHWPAFNLADSAIFVGVALLLLVS 157


>gi|21230614|ref|NP_636531.1| lipoprotein signal peptidase [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66769390|ref|YP_244152.1| lipoprotein signal peptidase [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|81304653|sp|Q4US41|LSPA_XANC8 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|81860360|sp|Q8PBG5|LSPA_XANCP RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|21112195|gb|AAM40455.1| lipoprotein signal peptidase [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66574722|gb|AAY50132.1| lipoprotein signal peptidase [Xanthomonas campestris pv. campestris
           str. 8004]
          Length = 167

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 22/99 (22%), Positives = 43/99 (43%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   ++ + I   + F   +  +      + Y L+  GA+GNV+D  ++G+V+D+I
Sbjct: 67  GWQLWFFTALAVGISGLLAFWLSRTARGDWRSAVPYALVIGGAIGNVIDRLMHGHVVDFI 126

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
             +    ++  FN+AD  I  G   I    +    R + 
Sbjct: 127 QWYVGEHTWPSFNIADSAIVGGAIGIALFGLFDGKRSRK 165


>gi|160895929|ref|YP_001561511.1| lipoprotein signal peptidase [Delftia acidovorans SPH-1]
 gi|160361513|gb|ABX33126.1| lipoprotein signal peptidase [Delftia acidovorans SPH-1]
          Length = 159

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 26/104 (25%), Positives = 46/104 (44%), Gaps = 1/104 (0%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + I +   AF+ ++  +         +GY  I  GALGNV+D   +G V+D++
Sbjct: 55  GWQRGFFIVIGVAASAFLTWLIAREKTATP-EAVGYAAILGGALGNVLDRVRHGAVVDWL 113

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDFP 107
             H   W +  FN AD+ I++G  +++      + R       P
Sbjct: 114 DFHWGDWHWPAFNAADVGITLGAGLLLIAAFRGRGRNGADSHSP 157


>gi|294627037|ref|ZP_06705627.1| signal peptidase II [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 11122]
 gi|292598699|gb|EFF42846.1| signal peptidase II [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 11122]
          Length = 172

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 21/98 (21%), Positives = 46/98 (46%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   ++ + I   + F   +  + +    + Y L+  GA+GNV+D  ++G+V+D+I
Sbjct: 67  GWQLWFFTALAVGISGLLAFWLSRTARGQWRSALPYALVIGGAIGNVIDRLMHGHVVDFI 126

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
             +  + ++  FN+AD  I  G   I    +  +  ++
Sbjct: 127 QWYIGSHTWPSFNIADSAIVGGAIGIAVFGLFDKSGKQ 164


>gi|329903783|ref|ZP_08273615.1| Lipoprotein signal peptidase [Oxalobacteraceae bacterium IMCC9480]
 gi|327548214|gb|EGF32916.1| Lipoprotein signal peptidase [Oxalobacteraceae bacterium IMCC9480]
          Length = 166

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 51/97 (52%), Gaps = 1/97 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S        ++      FI ++ K+N   + +F     LI  GA+GNV+D  ++GYVID+
Sbjct: 71  SGWQRYFFSALGTAAAVFIIYLLKRN-AGQRLFCWALTLILGGAVGNVIDRGMHGYVIDF 129

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
           + +H   W +  FN+AD  I IG  + + D++   ++
Sbjct: 130 LDVHVAGWHWPAFNVADSTICIGAILFVLDELRRVNK 166


>gi|237805333|ref|ZP_04592037.1| lipoprotein signal peptidase [Pseudomonas syringae pv. oryzae
          str. 1_6]
 gi|331026440|gb|EGI06495.1| lipoprotein signal peptidase [Pseudomonas syringae pv. oryzae
          str. 1_6]
          Length = 103

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 47/96 (48%), Gaps = 1/96 (1%)

Query: 4  NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
               +   I + + A +    K+  +  +   +   L+  GALGN+ D  + G+VID+I
Sbjct: 1  GWQRWLFALIAVAVSAVLVIWLKRLGRDDTWLAVALALVLGGALGNLYDRIVLGHVIDFI 60

Query: 64 MIHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQH 98
          ++H Q  W F  FN+AD  I++G  ++  D    + 
Sbjct: 61 LVHWQNRWYFPAFNVADSAITVGAIMLALDMFKSKK 96


>gi|206561063|ref|YP_002231828.1| lipoprotein signal peptidase [Burkholderia cenocepacia J2315]
 gi|238058046|sp|B4E8Z8|LSPA_BURCJ RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|198037105|emb|CAR53026.1| signal peptidase II [Burkholderia cenocepacia J2315]
          Length = 166

 Score =  100 bits (250), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 33/96 (34%), Positives = 52/96 (54%), Gaps = 1/96 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S        ++ +     I F+ K++   + +F +   LI  GALGNV+D  +YG+VID+
Sbjct: 69  SGWQRWAFTALGVGATLVICFLLKRH-GHQRLFSVSLALILGGALGNVIDRLVYGHVIDF 127

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
           +  H   W F  FNLAD  I+IG  ++IYD++    
Sbjct: 128 LDFHLGAWHFPAFNLADSAITIGAVLLIYDELRRVR 163


>gi|294666947|ref|ZP_06732177.1| signal peptidase II [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 10535]
 gi|292603319|gb|EFF46740.1| signal peptidase II [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 10535]
          Length = 172

 Score =  100 bits (250), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 21/98 (21%), Positives = 46/98 (46%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   ++ + I   + F   +  + +    + Y L+  GA+GNV+D  ++G+V+D+I
Sbjct: 67  GWQLWFFTALAVGISGLLAFWLSRTARGQWRSALPYALVIGGAIGNVIDRLMHGHVVDFI 126

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
             +  + ++  FN+AD  I  G   I    +  +  ++
Sbjct: 127 QWYIGSHTWPSFNIADSAIVGGAIGIAVFGLFDKSGKQ 164


>gi|90022210|ref|YP_528037.1| lipoprotein signal peptidase [Saccharophagus degradans 2-40]
 gi|89951810|gb|ABD81825.1| signal peptidase II. Aspartic peptidase. MEROPS family A08
           [Saccharophagus degradans 2-40]
          Length = 150

 Score =  100 bits (250), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 32/108 (29%), Positives = 54/108 (50%), Gaps = 3/108 (2%)

Query: 1   MLSNV---SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYG 57
           M ++        L ++   +   I     K  K++    +   L+  GA+GN+ D  L G
Sbjct: 42  MFADWGGAQRWGLGALAAGVSVAITIWIAKLDKSRWTEALALALVLGGAIGNLYDRMLLG 101

Query: 58  YVIDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
           +VID+I +H   + F  FN+AD  I++G  I+IYD + +Q + K   D
Sbjct: 102 HVIDFIEVHGWGYYFPAFNIADSAITVGAGILIYDALFIQPKLKKTAD 149


>gi|107023451|ref|YP_621778.1| lipoprotein signal peptidase [Burkholderia cenocepacia AU 1054]
 gi|116690533|ref|YP_836156.1| lipoprotein signal peptidase [Burkholderia cenocepacia HI2424]
 gi|170733874|ref|YP_001765821.1| lipoprotein signal peptidase [Burkholderia cenocepacia MC0-3]
 gi|254247425|ref|ZP_04940746.1| hypothetical protein BCPG_02223 [Burkholderia cenocepacia PC184]
 gi|123371360|sp|Q1BUA0|LSPA_BURCA RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|166232855|sp|A0K9T6|LSPA_BURCH RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|238688600|sp|B1JXC4|LSPA_BURCC RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|105893640|gb|ABF76805.1| signal peptidase II, Aspartic peptidase, MEROPS family A08
           [Burkholderia cenocepacia AU 1054]
 gi|116648622|gb|ABK09263.1| signal peptidase II, Aspartic peptidase, MEROPS family A08
           [Burkholderia cenocepacia HI2424]
 gi|124872201|gb|EAY63917.1| hypothetical protein BCPG_02223 [Burkholderia cenocepacia PC184]
 gi|169817116|gb|ACA91699.1| lipoprotein signal peptidase [Burkholderia cenocepacia MC0-3]
          Length = 166

 Score =  100 bits (250), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 32/96 (33%), Positives = 52/96 (54%), Gaps = 1/96 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S        ++ +     I F+ K++   + +F +   LI  GALGNV+D  +YG+VID+
Sbjct: 69  SGWQRWAFTALGVGATLVICFLLKRHG-HQRLFSVSLALILGGALGNVIDRLVYGHVIDF 127

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
           +  H   W F  FNLAD  I++G  ++IYD++    
Sbjct: 128 LDFHLGAWHFPAFNLADSAITVGAVLLIYDELRRVR 163


>gi|109899482|ref|YP_662737.1| lipoprotein signal peptidase [Pseudoalteromonas atlantica T6c]
 gi|123170847|sp|Q15R05|LSPA_PSEA6 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|109701763|gb|ABG41683.1| signal peptidase II, Aspartic peptidase, MEROPS family A08
           [Pseudoalteromonas atlantica T6c]
          Length = 164

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 50/96 (52%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +   I I +   + +  K+  + + +  + + LI  GALGNV D  L+G+VID++
Sbjct: 66  GWQRWLFTGIAIAVCGLVTWWLKETTRQQVMLPVAFCLIIGGALGNVFDRLLHGFVIDFL 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
           +++ Q W +  FN+AD  I +G  +++ D    +  
Sbjct: 126 VLYYQDWYWPAFNVADSAICLGAFLLVIDMFKNKDN 161


>gi|78067314|ref|YP_370083.1| signal peptidase II [Burkholderia sp. 383]
 gi|123567811|sp|Q39DM7|LSPA_BURS3 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|77968059|gb|ABB09439.1| signal peptidase II, Aspartic peptidase, MEROPS family A08
           [Burkholderia sp. 383]
          Length = 166

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 31/95 (32%), Positives = 51/95 (53%), Gaps = 1/95 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   ++ I     I F+ K++   + +F +   +I  GALGNV+D  +YG+VID++
Sbjct: 70  GWQRWAFTALGIAATLVICFLLKRHG-QQRLFSLSLAMILGGALGNVIDRLVYGHVIDFL 128

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
             H   W F  FNLAD  I++G  ++IYD++    
Sbjct: 129 DFHLGAWHFPAFNLADSAITVGAVLLIYDELRRVR 163


>gi|120599900|ref|YP_964474.1| lipoprotein signal peptidase [Shewanella sp. W3-18-1]
 gi|146292163|ref|YP_001182587.1| lipoprotein signal peptidase [Shewanella putrefaciens CN-32]
 gi|120559993|gb|ABM25920.1| signal peptidase II. Aspartic peptidase. MEROPS family A08
           [Shewanella sp. W3-18-1]
 gi|145563853|gb|ABP74788.1| lipoprotein signal peptidase [Shewanella putrefaciens CN-32]
 gi|319425459|gb|ADV53533.1| lipoprotein signal peptidase [Shewanella putrefaciens 200]
          Length = 171

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 24/102 (23%), Positives = 47/102 (46%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +   + +     +    +K   +    ++ Y L+  GALGN+VD  ++G+V+D+I
Sbjct: 66  GWQRWLFTIVAVGFSTLLTVWLRKQSASLWKLNLAYTLVIGGALGNLVDRLMHGFVVDFI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
                   +  FN+AD  I IG  +II+D  +    ++   +
Sbjct: 126 DFFWGKSHYPAFNIADSAICIGAVLIIWDAFLSGKSEQDTTE 167


>gi|189028644|sp|A9KEI7|LSPA_COXBN RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
          Length = 163

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 26/98 (26%), Positives = 48/98 (48%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +        +I  ++  F+     +  +++ +  +G  LI  GALGN +D   + YV D+
Sbjct: 65  NGWQIIFFAAISFVVSIFLILWLSRTSRSEIMMSLGLSLIIGGALGNFIDRLRWSYVTDF 124

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
           I  H + W FA FN+AD  I +G  ++I   ++    +
Sbjct: 125 IDFHIKDWHFATFNVADSAICVGVFLLIVYMLLTPSSK 162


>gi|237747478|ref|ZP_04577958.1| signal peptidase II [Oxalobacter formigenes HOxBLS]
 gi|229378829|gb|EEO28920.1| signal peptidase II [Oxalobacter formigenes HOxBLS]
          Length = 176

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 29/98 (29%), Positives = 54/98 (55%), Gaps = 1/98 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +         I ++ + FI ++ K++   + +F +   LI  GA+GN++D  LYG+VID+
Sbjct: 80  AGWQRYFFTVISVVAVIFIVYLLKRH-SHQKLFCLSLALILGGAIGNLIDRSLYGHVIDF 138

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
           + +H   W +  FN+AD  I+IG  + I D++    + 
Sbjct: 139 LDVHAFGWHWPTFNIADCGITIGAVLFIIDELKRVRKN 176


>gi|152979827|ref|YP_001352517.1| lipoprotein signal peptidase [Janthinobacterium sp. Marseille]
 gi|166232868|sp|A6SW70|LSPA_JANMA RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|151279904|gb|ABR88314.1| signal peptidase II [Janthinobacterium sp. Marseille]
          Length = 165

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 32/96 (33%), Positives = 50/96 (52%), Gaps = 1/96 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    + I    FI ++ KK+   + +F     LI  GA+GNV+D  LYG+VID++
Sbjct: 71  GWQRYFFTIMGIGAAIFIIYLLKKH-AGQRLFCWALALILGGAIGNVIDRVLYGHVIDFL 129

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
            +H   W +  FN+AD  I IG  + IYD++    +
Sbjct: 130 DVHIGGWHWPAFNIADSAICIGAVLFIYDELRRVGK 165


>gi|329922682|ref|ZP_08278234.1| signal peptidase II [Paenibacillus sp. HGF5]
 gi|328942024|gb|EGG38307.1| signal peptidase II [Paenibacillus sp. HGF5]
          Length = 166

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 53/97 (54%), Gaps = 1/97 (1%)

Query: 6   SPTILVSIRILIIAFIFFIWKK-NPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIM 64
                + + I+++  I +  +K + + + +      L+  GALGN +D  + G V+D++ 
Sbjct: 56  QLWFFIIVTIIVVGGIVWYLRKVSKEGRKLLPTALALVLGGALGNFIDRLIMGEVVDFLQ 115

Query: 65  IHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
            +  +++F +FN+AD  I IG  +II D ++   R+K
Sbjct: 116 FNFGSYTFPIFNIADSCIVIGVGLIILDTLLEGRREK 152


>gi|254780749|ref|YP_003065162.1| lipoprotein signal peptidase transmembrane [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040426|gb|ACT57222.1| lipoprotein signal peptidase transmembrane [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 108

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 108/108 (100%), Positives = 108/108 (100%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI
Sbjct: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDFPQ 108
           DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDFPQ
Sbjct: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDFPQ 108


>gi|238898021|ref|YP_002923701.1| prolipoprotein signal peptidase (SPase II) [Candidatus Hamiltonella
           defensa 5AT (Acyrthosiphon pisum)]
 gi|229465779|gb|ACQ67553.1| prolipoprotein signal peptidase (SPase II) [Candidatus Hamiltonella
           defensa 5AT (Acyrthosiphon pisum)]
          Length = 172

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 31/98 (31%), Positives = 47/98 (47%), Gaps = 1/98 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + + +LIIA +  +  ++ + K I    Y LI  GALGN+ D    G+VID+I
Sbjct: 69  GWQRWFFILVAVLIIAILMRLMYRSTENKWINA-AYALIIGGALGNLCDRIANGFVIDFI 127

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
             +   W +  FNLAD  I IG   I  +  +    +K
Sbjct: 128 DFYVNQWHWPTFNLADSAICIGALFIFLEGFLNPASKK 165


>gi|121609070|ref|YP_996877.1| lipoprotein signal peptidase [Verminephrobacter eiseniae EF01-2]
 gi|121553710|gb|ABM57859.1| signal peptidase II. Aspartic peptidase. MEROPS family A08
           [Verminephrobacter eiseniae EF01-2]
          Length = 167

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 28/98 (28%), Positives = 49/98 (50%), Gaps = 1/98 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +   I +    FI +    +P  + +F +    I  GA+GNV+D  + GYV+D++
Sbjct: 71  GWQRWLFTGIGVAAAIFILWQLHAHP-GQKLFSLALSSILGGAVGNVIDRLMRGYVVDFL 129

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
             H   W F  FNLAD  I++G   ++ D+++    Q+
Sbjct: 130 QWHYAGWYFPSFNLADAAITMGAACLVLDELLRVRGQR 167


>gi|118577291|ref|YP_899531.1| lipoprotein signal peptidase [Pelobacter propionicus DSM 2379]
 gi|118504796|gb|ABL01278.1| signal peptidase II. Aspartic peptidase. MEROPS family A08
           [Pelobacter propionicus DSM 2379]
          Length = 164

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 27/99 (27%), Positives = 49/99 (49%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S      L+S+ ++ +  I + ++K    ++   +G   I  GA+GN++D    G V+D+
Sbjct: 62  SGFRLHFLISVSLIAVIGIIYYYRKIRPDETHTAVGLTFILAGAVGNLMDRVRLGEVVDF 121

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
           +  H   + +  FNLAD  I  G  I++    I + R K
Sbjct: 122 LDAHWSGYHWPAFNLADSAIFAGVFILVVGMFIEERRLK 160


>gi|94311242|ref|YP_584452.1| signal peptidase II [Cupriavidus metallidurans CH34]
 gi|154253827|ref|YP_001414651.1| lipoprotein signal peptidase [Parvibaculum lavamentivorans DS-1]
 gi|218891423|ref|YP_002440290.1| putative lipoprotein signal peptidase LspA [Pseudomonas aeruginosa
           LESB58]
 gi|254241391|ref|ZP_04934713.1| hypothetical protein PA2G_02086 [Pseudomonas aeruginosa 2192]
 gi|24461618|gb|AAN62189.1|AF440523_96 putative lipoprotein signal peptidase LspA [Pseudomonas aeruginosa]
 gi|93355094|gb|ABF09183.1| prolipoprotein signal peptidase (signal peptidase II) [Cupriavidus
           metallidurans CH34]
 gi|126194769|gb|EAZ58832.1| hypothetical protein PA2G_02086 [Pseudomonas aeruginosa 2192]
 gi|154157777|gb|ABS64994.1| lipoprotein signal peptidase [Parvibaculum lavamentivorans DS-1]
 gi|218771649|emb|CAW27423.1| putative lipoprotein signal peptidase LspA [Pseudomonas aeruginosa
           LESB58]
          Length = 166

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 42/96 (43%), Gaps = 2/96 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  ++I   I A++ ++  +    +    + Y LI  GALGN  D    G+VIDYI
Sbjct: 65  GWQRWFFLAIAFAISAWLAWLLSR--PLRKTEGLSYSLILGGALGNAFDRATRGHVIDYI 122

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
             H   W +  FN+AD+ I  G   ++    +    
Sbjct: 123 DFHLHGWHWPAFNIADMAIVGGAIALVAQSFMSVEN 158


>gi|165918855|ref|ZP_02218941.1| signal peptidase II [Coxiella burnetii RSA 334]
 gi|165917487|gb|EDR36091.1| signal peptidase II [Coxiella burnetii RSA 334]
          Length = 163

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 26/98 (26%), Positives = 48/98 (48%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +        +I  ++  F+     +  +++ +  +G  LI  GALGN +D   + YV D+
Sbjct: 65  NGWQIIFFAAISFVVSIFLILWLSRTSRSEIMMSLGLSLIIGGALGNFIDRLRWSYVTDF 124

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
           I  H + W FA FN+AD  I +G  ++I   ++    +
Sbjct: 125 IDFHIKDWHFATFNVADSAICVGVFLLIVHMLLTPSSK 162


>gi|298485393|ref|ZP_07003483.1| Lipoprotein signal peptidase [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|298160091|gb|EFI01122.1| Lipoprotein signal peptidase [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
          Length = 168

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 49/97 (50%), Gaps = 1/97 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +     +   I I++ A +    K+  +  +   +   L+  GALGN+ D  + G+VID+
Sbjct: 65  AGWQRWLFALIAIVVSAVLVVWLKRLGRDDTWLAVALALVLGGALGNLYDRIVLGHVIDF 124

Query: 63  IMIHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQH 98
           I++H Q  W F  FN+AD  I++G  ++  D    + 
Sbjct: 125 ILVHWQNRWYFPAFNVADSAITVGAIMLALDMFKSKK 161


>gi|170723719|ref|YP_001751407.1| lipoprotein signal peptidase [Pseudomonas putida W619]
 gi|169761722|gb|ACA75038.1| lipoprotein signal peptidase [Pseudomonas putida W619]
          Length = 171

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 24/99 (24%), Positives = 50/99 (50%), Gaps = 1/99 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S     +   I +++ A +    K+  + ++   +   L+  GALGN+ D  + G+V+D+
Sbjct: 68  SGWQRWLFALIAVVVSAVLVVWLKRLGRNETWLAVALALVLGGALGNLYDRIVLGHVVDF 127

Query: 63  IMIHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
           I++H +    F  FN+AD  I++G  ++  D    +  +
Sbjct: 128 ILVHWKNVHHFPAFNVADSAITVGAVMLALDMFKSKKSE 166


>gi|330824417|ref|YP_004387720.1| lipoprotein signal peptidase [Alicycliphilus denitrificans K601]
 gi|329309789|gb|AEB84204.1| Lipoprotein signal peptidase [Alicycliphilus denitrificans K601]
          Length = 359

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 31/100 (31%), Positives = 50/100 (50%), Gaps = 2/100 (2%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S       +++ +L+  ++    K+         +GY LI  GALGNVVD  L G V+D+
Sbjct: 256 SGWQRYFFITLGLLVAVWLIRQLKQT--LPRFEAVGYSLILGGALGNVVDRLLRGQVVDF 313

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           +  H Q   +  FNLAD+ ISIG   +I   + ++ +   
Sbjct: 314 LDFHWQGMHWPAFNLADVAISIGVGCLIARFLEIRDKGNK 353


>gi|291614547|ref|YP_003524704.1| lipoprotein signal peptidase [Sideroxydans lithotrophicus ES-1]
 gi|291584659|gb|ADE12317.1| lipoprotein signal peptidase [Sideroxydans lithotrophicus ES-1]
          Length = 158

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 29/94 (30%), Positives = 51/94 (54%), Gaps = 1/94 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +  +I I+   +IF++ +K+   + +F      I  GALGN++D   YGYV+D++
Sbjct: 59  GSQRWLFSAIAIVASVWIFWLLRKHHA-QKLFCFALAFILGGALGNLIDRIAYGYVVDFL 117

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQ 97
             +   + FA FNLAD  I+ G  ++I+D    +
Sbjct: 118 DFYWGGYHFAAFNLADSAITCGAGLLIWDSFKGK 151


>gi|161830767|ref|YP_001596340.1| lipoprotein signal peptidase [Coxiella burnetii RSA 331]
 gi|189028645|sp|A9NBM6|LSPA_COXBR RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|161762634|gb|ABX78276.1| signal peptidase II [Coxiella burnetii RSA 331]
          Length = 163

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 26/98 (26%), Positives = 48/98 (48%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +        +I  ++  F+     +  +++ +  +G  LI  GALGN +D   + YV D+
Sbjct: 65  NGWQIIFFAAISFVVSIFLILWLSRTSRSEIMMSLGLSLIIGGALGNFIDRLRWSYVTDF 124

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
           I  H + W FA FN+AD  I +G  ++I   ++    +
Sbjct: 125 IDFHIKDWHFATFNVADSAICVGVFLLIVHMLLTPSSK 162


>gi|166713091|ref|ZP_02244298.1| lipoprotein signal peptidase [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 172

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 21/99 (21%), Positives = 45/99 (45%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   ++ + I   + F   +  +      + Y L+  GA+GNV+D  ++G+V+D+I
Sbjct: 67  GWQLWFFTALAMGISGLLAFWLSRTARGHWRSALPYALVIGGAIGNVIDRLMHGHVVDFI 126

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
             +  + ++  FN+AD  I  G   I    +  +  ++ 
Sbjct: 127 QWYIGSHTWPSFNIADSAIVGGAIGIAVFGLFDKSGKQA 165


>gi|153007506|ref|YP_001368721.1| lipoprotein signal peptidase [Ochrobactrum anthropi ATCC 49188]
 gi|151559394|gb|ABS12892.1| lipoprotein signal peptidase [Ochrobactrum anthropi ATCC 49188]
          Length = 160

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 41/102 (40%), Positives = 65/102 (63%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           ML+ +    LV+I   +I F+ ++W  N   +     G+ L+  GA+GN++D  ++GYV+
Sbjct: 57  MLAWLHDWGLVAITAAVILFVLYLWWTNAPDRIFARYGFALVVGGAIGNLIDRVMHGYVV 116

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           DYI+ H  TWSFAVFNLAD FI+IG  +II ++ +   R++ 
Sbjct: 117 DYILFHLPTWSFAVFNLADTFITIGAGLIILEEFLGWRRERA 158


>gi|328675586|gb|AEB28261.1| Lipoprotein signal peptidase [Francisella cf. novicida 3523]
          Length = 159

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 46/96 (47%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
           +    +   I +L    + ++  K P T+ I    + LI  GALGN  D    GYVID++
Sbjct: 63  SWQMVMFSIISLLAAIVLIYLIIKQPITEKINLFSFALILGGALGNFYDRAFQGYVIDFL 122

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
             H   + +  FN+AD  I+ G  +++   +  + +
Sbjct: 123 DFHIGNYHWPSFNIADSAITCGVILLVAASLFTKKK 158


>gi|254482867|ref|ZP_05096104.1| signal peptidase II [marine gamma proteobacterium HTCC2148]
 gi|214036948|gb|EEB77618.1| signal peptidase II [marine gamma proteobacterium HTCC2148]
          Length = 151

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 27/99 (27%), Positives = 46/99 (46%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    + ++I   +       P+   +  +   LI  GA+GNV D    GYV+D+I
Sbjct: 53  GWQRWFFTVVAVVISGVLTVWLFMAPRAHWLLGLSLALILGGAIGNVWDRVALGYVVDFI 112

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
            +H Q W F  FN+AD  I++G   ++ D    +H ++ 
Sbjct: 113 SVHYQGWYFPAFNIADSAITVGAICMLLDSFFNRHSEQA 151


>gi|149204471|ref|ZP_01881437.1| Peptidase A8, signal peptidase II [Roseovarius sp. TM1035]
 gi|149141970|gb|EDM30019.1| Peptidase A8, signal peptidase II [Roseovarius sp. TM1035]
          Length = 184

 Score = 99.3 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 23/88 (26%), Positives = 38/88 (43%), Gaps = 4/88 (4%)

Query: 23  FIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQTWSFAVFNLADLFI 82
               K P    +      LI  GALGN++D   Y  V D++  H  ++ +  FNLAD+ I
Sbjct: 93  IWLWKAP--DGLTGAALGLIIGGALGNILDRLRYQAVPDFLDFHYGSYHWPSFNLADVAI 150

Query: 83  SIGTCIIIYDDIILQH--RQKGKIDFPQ 108
             G  ++ +D         +  + D  +
Sbjct: 151 FCGAALLFWDSFRTSKVRPENREQDNRK 178


>gi|329895217|ref|ZP_08270881.1| Lipoprotein signal peptidase [gamma proteobacterium IMCC3088]
 gi|328922455|gb|EGG29797.1| Lipoprotein signal peptidase [gamma proteobacterium IMCC3088]
          Length = 157

 Score = 99.3 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 43/96 (44%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I + +   I     +    +        L+ +GA+GNV+D  L GYV+D+I
Sbjct: 61  GWQRYFFTGIAVGVSIIITVWMTRLKPEEYFLGWALALVLSGAVGNVIDRILLGYVVDFI 120

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
            +H Q W F  FN+AD  I++G   ++ D      +
Sbjct: 121 SVHWQHWYFPTFNIADSCITLGAIGLLVDGFKSPSK 156


>gi|325921004|ref|ZP_08182887.1| signal peptidase II Aspartic peptidase MEROPS family A08
           [Xanthomonas gardneri ATCC 19865]
 gi|325548511|gb|EGD19482.1| signal peptidase II Aspartic peptidase MEROPS family A08
           [Xanthomonas gardneri ATCC 19865]
          Length = 170

 Score = 99.3 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 21/99 (21%), Positives = 46/99 (46%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   ++ + I   + F   +  + +    + Y L+  GA+GNV+D  ++G+V+D+I
Sbjct: 67  GWQLWFFTALAVGISGLLAFWLSRTARGEWRSALPYALVIGGAIGNVIDRLMHGHVVDFI 126

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
             +  + ++  FN+AD  I  G   I    +  +  ++ 
Sbjct: 127 QWYIGSHTWPSFNIADSAIVGGAIGIAVFGLFDKSGKRE 165


>gi|254447496|ref|ZP_05060962.1| signal peptidase II [gamma proteobacterium HTCC5015]
 gi|198262839|gb|EDY87118.1| signal peptidase II [gamma proteobacterium HTCC5015]
          Length = 168

 Score = 99.3 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 19/98 (19%), Positives = 40/98 (40%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S        ++ ++    +     +    + +      L+  GA+GN++D   YG+V+D+
Sbjct: 66  SGWQRWFFAALALVAAVVLIVWIWRIKPAERLMSWPLSLVLGGAIGNLIDRLAYGHVVDF 125

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
           +      + +  FN+AD  I  G   +I+       R 
Sbjct: 126 LDFFYGRYHWPAFNVADSAIVCGAAWLIWLSFFPSARH 163


>gi|294339966|emb|CAZ88329.1| putative prolipoprotein signal peptidase (SPase II) LspA [Thiomonas
           sp. 3As]
          Length = 175

 Score = 99.3 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 29/103 (28%), Positives = 49/103 (47%), Gaps = 5/103 (4%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   ++ +    FI ++  +N   K +F++    I  GALGNV+D  L+G V D++
Sbjct: 74  GWQRWFFTALSLAASLFILWLMFRNR-GKPLFNLALACILGGALGNVIDRVLWGKVTDFL 132

Query: 64  MIHT----QTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
             +     Q W +  FNLAD  I IG  + I D++    + + 
Sbjct: 133 DFYITLNGQQWHWPAFNLADSAIFIGAMLAIVDELRRARQHRS 175


>gi|319941945|ref|ZP_08016266.1| lipoprotein signal peptidase [Sutterella wadsworthensis 3_1_45B]
 gi|319804598|gb|EFW01468.1| lipoprotein signal peptidase [Sutterella wadsworthensis 3_1_45B]
          Length = 183

 Score = 99.3 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 30/99 (30%), Positives = 55/99 (55%), Gaps = 1/99 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +  +I + +I     +  K+   +++F +   LI +GALGN++D  L+GYVID++
Sbjct: 86  GWQRWLFSAIALAVIVVALRLLWKH-SRQTLFALSLTLILSGALGNLIDRSLWGYVIDFL 144

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
             +  TW +  FN+AD  I +G   II D++I   +++ 
Sbjct: 145 DFYLGTWHWPAFNIADTAICLGAAGIIIDELIGVSKERS 183


>gi|167585705|ref|ZP_02378093.1| lipoprotein signal peptidase [Burkholderia ubonensis Bu]
          Length = 166

 Score = 99.3 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 31/94 (32%), Positives = 51/94 (54%), Gaps = 1/94 (1%)

Query: 5   VSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIM 64
                  ++ I     I ++ K++   + +F +   LI  GALGNV+D  +YG+VID++ 
Sbjct: 71  WQRWAFTALGIGATLVICYLLKRHG-HQRLFSLSLALILGGALGNVIDRLVYGHVIDFLD 129

Query: 65  IHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
            H   W F  FNLAD  I++G  ++IYD++    
Sbjct: 130 FHVGAWHFPAFNLADSAITVGAVLLIYDELRRVR 163


>gi|163851749|ref|YP_001639792.1| lipoprotein signal peptidase [Methylobacterium extorquens PA1]
 gi|226801494|sp|A9W565|LSPA_METEP RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|163663354|gb|ABY30721.1| lipoprotein signal peptidase [Methylobacterium extorquens PA1]
          Length = 171

 Score = 99.3 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 46/96 (47%), Gaps = 2/96 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
            +   +LV++ +  +  +    ++      +  +   LI  GALGN +D   YG V D++
Sbjct: 63  GLGRWLLVAVSLAAVIGLSVWMRR--AGSRLLAVALGLIVGGALGNAIDRAAYGAVFDFV 120

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
            +H   WS+ VFN+AD  I  G   +I D +    R
Sbjct: 121 HLHAGPWSWYVFNVADAAIVAGVVGLILDSLRPAPR 156


>gi|215918959|ref|NP_819436.2| lipoprotein signal peptidase [Coxiella burnetii RSA 493]
 gi|206583844|gb|AAO89950.2| lipoprotein signal peptidase [Coxiella burnetii RSA 493]
          Length = 165

 Score = 99.3 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 26/98 (26%), Positives = 48/98 (48%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +        +I  ++  F+     +  +++ +  +G  LI  GALGN +D   + YV D+
Sbjct: 67  NGWQIIFFAAISFVVSIFLILWLSRTSRSEIMMLLGLSLIIGGALGNFIDRLRWSYVTDF 126

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
           I  H + W FA FN+AD  I +G  ++I   ++    +
Sbjct: 127 IDFHIKDWHFATFNVADSAICVGVFLLIVHMLLTPSSK 164


>gi|212709130|ref|ZP_03317258.1| hypothetical protein PROVALCAL_00163 [Providencia alcalifaciens DSM
           30120]
 gi|212688042|gb|EEB47570.1| hypothetical protein PROVALCAL_00163 [Providencia alcalifaciens DSM
           30120]
          Length = 167

 Score = 99.3 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 28/98 (28%), Positives = 49/98 (50%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I   +  +  +    K + +I Y LI  GA+GN+ D  ++G+V+DYI
Sbjct: 66  GWQRWFFAGIAIAISIILMVMMYRQSVKKRLSNIAYALIIGGAIGNLFDRLVHGFVVDYI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
             +   W +  FNLAD+ I IG  ++I++  +    ++
Sbjct: 126 DFYVGNWHWPTFNLADMAICIGAALVIFEGFLPDKPKQ 163


>gi|163794894|ref|ZP_02188863.1| Peptidase A8, signal peptidase II [alpha proteobacterium BAL199]
 gi|159179713|gb|EDP64240.1| Peptidase A8, signal peptidase II [alpha proteobacterium BAL199]
          Length = 172

 Score = 99.3 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 47/97 (48%), Gaps = 5/97 (5%)

Query: 1   MLSN---VSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYG 57
           +LSN     P +L    +++   +     +      +   G  L+  GA+GN +D  LYG
Sbjct: 61  LLSNDSVWGPWLLGGFALVVAVALMIWLVR--AEGWVLGAGLGLVIGGAVGNAIDRALYG 118

Query: 58  YVIDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDI 94
            V+D+I  H     +  FN+AD  I++G  +++ D +
Sbjct: 119 AVVDFIDTHWGDLHWPAFNIADAAITLGVGLLLLDAL 155


>gi|167626616|ref|YP_001677116.1| lipoprotein signal peptidase [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|167596617|gb|ABZ86615.1| lipoprotein signal peptidase II [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
          Length = 182

 Score = 99.3 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 24/95 (25%), Positives = 45/95 (47%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
           +    +  +I ++    + ++  + P +  +  I + LI  GALGN  D    GYVID++
Sbjct: 87  SWQMIMFATISLIAAIVLIYLIVRQPTSARLNLISFSLILGGALGNFYDRAFQGYVIDFL 146

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
             H   + +  FN AD  I+ G  ++I   +  + 
Sbjct: 147 DFHIGNYHWPSFNTADSAITCGVILLILASLFTKK 181


>gi|322513352|ref|ZP_08066471.1| signal peptidase II [Actinobacillus ureae ATCC 25976]
 gi|322120842|gb|EFX92702.1| signal peptidase II [Actinobacillus ureae ATCC 25976]
          Length = 160

 Score = 99.3 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 23/99 (23%), Positives = 48/99 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + + I+I   +  +  +N   K + +  Y LI  GA+GN +D    GYV+D+ 
Sbjct: 62  GWQKYFFLGLAIVISLGLIVMLWRNQAVKKLENSAYALIIGGAIGNAIDRAYNGYVVDFF 121

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
             +   + + VFN+AD+ I +   ++I +  + + ++  
Sbjct: 122 DFYWDIYHYPVFNVADIAIVVSAGLLILEAFLDKKKKSD 160


>gi|241667175|ref|ZP_04754753.1| lipoprotein signal peptidase II [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254875727|ref|ZP_05248437.1| lipoprotein signal peptidase II [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254841748|gb|EET20162.1| lipoprotein signal peptidase II [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
          Length = 160

 Score = 99.3 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 24/95 (25%), Positives = 46/95 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
           +    +  +I ++    + ++  + P +  +  I + LI  GALGN  D    GYVID++
Sbjct: 65  SWQMIMFATISLIAAIVLIYLIVRQPTSARLNLISFSLILGGALGNFYDRAFQGYVIDFL 124

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
             H   + +  FN+AD  I+ G  ++I   +  + 
Sbjct: 125 DFHIGNYHWPSFNIADSAITCGVILLILASLFTKK 159


>gi|118581996|ref|YP_903246.1| lipoprotein signal peptidase [Pelobacter propionicus DSM 2379]
 gi|118504706|gb|ABL01189.1| signal peptidase II, Aspartic peptidase, MEROPS family A08
           [Pelobacter propionicus DSM 2379]
          Length = 161

 Score = 99.3 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 22/99 (22%), Positives = 49/99 (49%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           ++      +++ ++  A I   + +    + +      +I +GA+GN++D    G VID+
Sbjct: 60  ASWRLPFFIAVSLIASAVILVAFGRLRNDQKLAQASLAMIFSGAVGNLIDRVRMGEVIDF 119

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
           + ++     +  FN+AD FI +G  ++  D +  + R K
Sbjct: 120 LDVYWGNHHWPAFNVADSFICVGVALLALDMLREERRAK 158


>gi|212219166|ref|YP_002305953.1| lipoprotein signal peptidase [Coxiella burnetii CbuK_Q154]
 gi|212013428|gb|ACJ20808.1| lipoprotein signal peptidase [Coxiella burnetii CbuK_Q154]
          Length = 165

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 26/98 (26%), Positives = 47/98 (47%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +         I  ++  F+     +  +++ +  +G  LI  GALGN +D   + YV D+
Sbjct: 67  NGWQIIFFADISFVVSIFLILWLSRTSRSEIMMSLGLSLIIGGALGNFIDRLRWSYVTDF 126

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
           I  H + W FA FN+AD  I +G  ++I   ++    +
Sbjct: 127 IDFHIKDWHFATFNVADSAICVGVFLLIVHMLLTPSSK 164


>gi|261405685|ref|YP_003241926.1| lipoprotein signal peptidase [Paenibacillus sp. Y412MC10]
 gi|261282148|gb|ACX64119.1| lipoprotein signal peptidase [Paenibacillus sp. Y412MC10]
          Length = 166

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 25/97 (25%), Positives = 53/97 (54%), Gaps = 1/97 (1%)

Query: 6   SPTILVSIRILIIAFIFFIWKK-NPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIM 64
                + + ++++  I +  +K + + + +      L+  GALGN +D  + G V+D++ 
Sbjct: 56  QLWFFIVVTLIVVGGIVWYLQKVSKEGRKLLPTALALVLGGALGNFIDRLIMGEVVDFLQ 115

Query: 65  IHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
            +  +++F +FN+AD  I IG  +II D ++   R+K
Sbjct: 116 FNFGSYTFPIFNIADSCIVIGVGLIILDTLLEGRREK 152


>gi|194014837|ref|ZP_03053454.1| signal peptidase II [Bacillus pumilus ATCC 7061]
 gi|194013863|gb|EDW23428.1| signal peptidase II [Bacillus pumilus ATCC 7061]
          Length = 155

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 19/97 (19%), Positives = 44/97 (45%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
                  I +++IA I +  +K+ +   +  +   L+  GA+GN +D      V+D+   
Sbjct: 56  QMWFFYVITLVVIAGIVYYLQKHGQKDKLLGVALALMLGGAIGNFIDRVFRQEVVDFAHF 115

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
               + + +FN+AD  + +G  ++    ++   + K 
Sbjct: 116 VFGNYHYPIFNIADSSLCVGVILLFIQMLLDGKKTKE 152


>gi|239830998|ref|ZP_04679327.1| signal peptidase II [Ochrobactrum intermedium LMG 3301]
 gi|239823265|gb|EEQ94833.1| signal peptidase II [Ochrobactrum intermedium LMG 3301]
          Length = 160

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 41/102 (40%), Positives = 65/102 (63%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           ML+ +    LV+I   +I F+ ++W  N   +     G+ L+  GA+GN++D  ++GYV+
Sbjct: 57  MLAWLHDWGLVAITAAVILFVLYLWWTNAPDRIFARYGFALVVGGAIGNLIDRVMHGYVV 116

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           DYI+ H  TWSFAVFNLAD FI+IG  +II ++ +   R++ 
Sbjct: 117 DYILFHLPTWSFAVFNLADTFITIGAGLIILEEFLGWRRERA 158


>gi|229541181|ref|ZP_04430241.1| lipoprotein signal peptidase [Bacillus coagulans 36D1]
 gi|229325601|gb|EEN91276.1| lipoprotein signal peptidase [Bacillus coagulans 36D1]
          Length = 165

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 28/100 (28%), Positives = 55/100 (55%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
              +   I +++IA I +  +K  K +++  I   LI  GA+GN +D    G V+D++ +
Sbjct: 58  QMWLFYLITLIVIAGILYYIQKYAKDRALVGISLGLILGGAIGNFIDRLFRGEVVDFVHL 117

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
              ++ FA+FN+AD  ++IG  +++   ++   + K K D
Sbjct: 118 RFGSYDFAIFNVADASLTIGVVLLLISMLLEDRKTKEKTD 157


>gi|15615106|ref|NP_243409.1| lipoprotein signal peptidase [Bacillus halodurans C-125]
 gi|14194914|sp|Q9K9V2|LSPA_BACHD RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|10175163|dbj|BAB06262.1| signal peptidase II [Bacillus halodurans C-125]
          Length = 156

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 25/100 (25%), Positives = 49/100 (49%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
              +   I  +++  I +  +K  K   +F     LI  GA+GN +D    G V+D++  
Sbjct: 56  QMWLFYIITSIVVIGIVYYMEKEAKHDRVFATALALILGGAIGNFIDRIFRGEVVDFVNT 115

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
           +  T++F +FN+AD  + +G  I+    I  + + K + +
Sbjct: 116 YIFTYNFPIFNVADSALCVGVGILFLKMIRDERKAKKEKN 155


>gi|81839101|sp|Q83EC8|LSPA_COXBU RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
          Length = 163

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 26/98 (26%), Positives = 48/98 (48%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +        +I  ++  F+     +  +++ +  +G  LI  GALGN +D   + YV D+
Sbjct: 65  NGWQIIFFAAISFVVSIFLILWLSRTSRSEIMMLLGLSLIIGGALGNFIDRLRWSYVTDF 124

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
           I  H + W FA FN+AD  I +G  ++I   ++    +
Sbjct: 125 IDFHIKDWHFATFNVADSAICVGVFLLIVHMLLTPSSK 162


>gi|218516446|ref|ZP_03513286.1| lipoprotein signal peptidase protein [Rhizobium etli 8C-3]
          Length = 114

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 45/99 (45%), Positives = 70/99 (70%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           MLS +    +V +R++I+AF+ ++W +  K + +  +GY LI  GA+GN+VD   YG+VI
Sbjct: 13  MLSGMDGWFIVGMRLVIVAFVVWLWYRTAKDRWLAHLGYALIIAGAIGNLVDRFAYGHVI 72

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
           DYI+ +T +WSFAVFNLAD FI+IG   +I D+++L  +
Sbjct: 73  DYILFYTASWSFAVFNLADSFITIGAACVILDELLLPKK 111


>gi|33151333|ref|NP_872686.1| lipoprotein signal peptidase [Haemophilus ducreyi 35000HP]
 gi|71153813|sp|Q7VPK5|LSPA_HAEDU RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|33147553|gb|AAP95075.1| lipoprotein signal peptidase [Haemophilus ducreyi 35000HP]
          Length = 161

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 24/100 (24%), Positives = 53/100 (53%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S     + +++ I+I   +  + ++N   +   ++ Y LI  GA+GN +D    GYV+D+
Sbjct: 62  SGWQKYLFLTLAIIISFILANVLRRNQIDQKRENMAYALIIGGAIGNAIDRAYRGYVVDF 121

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
              +   + + VFN+AD+ I +G  ++I +  + + ++  
Sbjct: 122 FDFYWHIYHYPVFNIADVAIVMGAGLLILETFLDKKKKSD 161


>gi|254362743|ref|ZP_04978827.1| A08 family signal peptidase II [Mannheimia haemolytica PHL213]
 gi|261491883|ref|ZP_05988462.1| A08 family signal peptidase II [Mannheimia haemolytica serotype A2
           str. BOVINE]
 gi|261494647|ref|ZP_05991127.1| A08 family signal peptidase II [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|153094368|gb|EDN75223.1| A08 family signal peptidase II [Mannheimia haemolytica PHL213]
 gi|261309612|gb|EEY10835.1| A08 family signal peptidase II [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261312538|gb|EEY13662.1| A08 family signal peptidase II [Mannheimia haemolytica serotype A2
           str. BOVINE]
          Length = 159

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 28/100 (28%), Positives = 51/100 (51%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S       + + ++I + +     KN   K + +I Y LI  GA+GN +D    GYV+D+
Sbjct: 60  SGWQKYFFLGLAVVISSALVVALWKNQAVKKLENIAYALIIGGAIGNAIDRAYNGYVVDF 119

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           +  +   + + VFN+AD+ I +G  ++I +  I +   K 
Sbjct: 120 LHFYWDIYHYPVFNIADIAICVGAGLLILEAFITKKEPKK 159


>gi|257094116|ref|YP_003167757.1| lipoprotein signal peptidase [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
 gi|257046640|gb|ACV35828.1| lipoprotein signal peptidase [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
          Length = 170

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 25/91 (27%), Positives = 43/91 (47%), Gaps = 1/91 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    + + + A+I  I  ++     +  +   LI  GALGNV+D   +G V+D+I
Sbjct: 63  GWQRWFFTILALGVAAWIVSILPRHSAEFRL-SLALTLILGGALGNVIDRLRFGAVVDFI 121

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDI 94
             H   + +  FN+AD  I IG  ++ +D  
Sbjct: 122 QWHAAGFYWPAFNVADSAICIGAVLMAWDQF 152


>gi|197120434|ref|YP_002132385.1| lipoprotein signal peptidase [Anaeromyxobacter sp. K]
 gi|220915136|ref|YP_002490440.1| lipoprotein signal peptidase [Anaeromyxobacter dehalogenans 2CP-1]
 gi|196170283|gb|ACG71256.1| lipoprotein signal peptidase [Anaeromyxobacter sp. K]
 gi|219952990|gb|ACL63374.1| lipoprotein signal peptidase [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 206

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 21/87 (24%), Positives = 40/87 (45%), Gaps = 3/87 (3%)

Query: 9   ILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQ 68
               + +  +AFI   ++K  + +    +   L+  GA+GN VD     YVID++  +  
Sbjct: 99  FFTLVSLAAVAFILHYYRKLRQDQRYLQVALALVLAGAVGNFVDRLARRYVIDFVEWYWW 158

Query: 69  T---WSFAVFNLADLFISIGTCIIIYD 92
                 +  FN+AD  I +G  +++  
Sbjct: 159 NRPDLRWPTFNVADSLIVVGVAMLVLH 185


>gi|255065790|ref|ZP_05317645.1| signal peptidase II [Neisseria sicca ATCC 29256]
 gi|255050108|gb|EET45572.1| signal peptidase II [Neisseria sicca ATCC 29256]
          Length = 172

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 25/98 (25%), Positives = 54/98 (55%), Gaps = 1/98 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + + ++I A++     ++   +    IG  +I  GALGN +D  ++G+V+D++
Sbjct: 66  GWQKFFFLGLALVISAYLARAILRDEF-RLSGKIGAAMIIGGALGNAIDRLIHGHVVDFL 124

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
           + + + WS+  FN+AD FI +G  +++ D +  + + K
Sbjct: 125 LFYWKDWSYPAFNVADSFICVGAVLLVLDGLFHKKQPK 162


>gi|222111332|ref|YP_002553596.1| lipoprotein signal peptidase [Acidovorax ebreus TPSY]
 gi|221730776|gb|ACM33596.1| lipoprotein signal peptidase [Acidovorax ebreus TPSY]
          Length = 167

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 23/91 (25%), Positives = 44/91 (48%), Gaps = 2/91 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +L+++ +    ++ ++  +    + +  + Y LI  GA+GN  D  + G VIDY+
Sbjct: 72  GWQRWLLLAVAVGAAIWLVWLLAR--PARRLEALAYSLILGGAVGNAFDRAIRGQVIDYL 129

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDI 94
             H + W +  FN+AD+ I  G   +I    
Sbjct: 130 DFHLRQWHWPAFNVADMAIVGGAISLIVASF 160


>gi|58616709|ref|YP_195918.1| putative lipoprotein signal peptidase [Achromobacter xylosoxidans
           A8]
 gi|58416300|emb|CAI47896.1| putative lipoprotein signal peptidase [Achromobacter xylosoxidans]
          Length = 167

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 24/91 (26%), Positives = 44/91 (48%), Gaps = 2/91 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                 L+++ +    ++ ++  +    + +  + Y LI  GALGN  D  + G VIDY+
Sbjct: 72  GWQRWFLLAVAVGAAIWLVWLLAR--PARRLEALAYSLILGGALGNAFDRAIRGQVIDYL 129

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDI 94
             H + W +  FN+AD+ I  G   +I   +
Sbjct: 130 DFHLRQWHWPAFNVADMAIVGGAISLIVASL 160


>gi|153010526|ref|YP_001371740.1| lipoprotein signal peptidase [Ochrobactrum anthropi ATCC 49188]
 gi|151562414|gb|ABS15911.1| lipoprotein signal peptidase [Ochrobactrum anthropi ATCC 49188]
          Length = 154

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 21/102 (20%), Positives = 48/102 (47%), Gaps = 2/102 (1%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           +       +L++  + I+A +     +      +      L+  GALGN++D    G V 
Sbjct: 54  LFGQAPAWLLMAFTLAIVAGLLVWIHR--SDSRLTASALGLVVGGALGNLLDRLRQGAVA 111

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           D++  +  ++ +  FNLAD+ I  G  +++ + ++ + + K 
Sbjct: 112 DFLDFYIGSYHWPAFNLADVAIVCGVGLLLVESVLARGKTKA 153


>gi|74317876|ref|YP_315616.1| signal peptidase II [Thiobacillus denitrificans ATCC 25259]
 gi|74057371|gb|AAZ97811.1| peptidase A8, signal peptidase II [Thiobacillus denitrificans ATCC
           25259]
          Length = 157

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 22/100 (22%), Positives = 52/100 (52%), Gaps = 1/100 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  +++ I+    I  +  ++     +  +   L+  GALGNV+D  + G+V+D++
Sbjct: 58  GWQRWFFIAVGIVATVIIVRLLGRHGDEPRL-ALPLALVLGGALGNVIDRVVLGHVVDFL 116

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
             H +++++  FN+AD  I++G  ++I+D +  +     +
Sbjct: 117 YFHYRSFAWPAFNVADSAITVGAALLIWDSLRGKPSPAKE 156


>gi|126666688|ref|ZP_01737665.1| lipoprotein signal peptidase [Marinobacter sp. ELB17]
 gi|126628733|gb|EAZ99353.1| lipoprotein signal peptidase [Marinobacter sp. ELB17]
          Length = 176

 Score = 98.5 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 30/94 (31%), Positives = 49/94 (52%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +       V + +++   +    +K  + ++   I + LI  GALGNV D  ++GYV+D+
Sbjct: 74  AGWQRWFFVILALVVSVVLVLWLRKLERHETWSAIAFALILGGALGNVYDRVVHGYVVDF 133

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIIL 96
           +  + Q W F  FNLAD  I+IG  +II D    
Sbjct: 134 LHFYWQNWHFPAFNLADTAITIGAAMIILDTFRK 167


>gi|317484564|ref|ZP_07943471.1| signal peptidase II [Bilophila wadsworthia 3_1_6]
 gi|316924190|gb|EFV45369.1| signal peptidase II [Bilophila wadsworthia 3_1_6]
          Length = 168

 Score = 98.5 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 18/92 (19%), Positives = 42/92 (45%)

Query: 5   VSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIM 64
               +  +  ++    IF + +   + + +   G  ++  GA+GN+VD   +  V+D++ 
Sbjct: 70  WQFWLFFAATLVSAGVIFMLARSAQRGEKLLFWGLGMVLGGAVGNLVDRIRFRAVVDFLD 129

Query: 65  IHTQTWSFAVFNLADLFISIGTCIIIYDDIIL 96
            +   W +  FN+AD+ I  G  ++     + 
Sbjct: 130 FYVGQWHWPAFNVADIAICCGALLVCLSMWLK 161


>gi|296532636|ref|ZP_06895336.1| signal peptidase II [Roseomonas cervicalis ATCC 49957]
 gi|296267049|gb|EFH12974.1| signal peptidase II [Roseomonas cervicalis ATCC 49957]
          Length = 195

 Score = 98.5 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 28/88 (31%), Positives = 44/88 (50%), Gaps = 2/88 (2%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S  +P +L  +   I+  + +   K P  + +    + LI  G LGNVVD    G V D+
Sbjct: 81  SPATPILLSGLAFAILPLMGWWLAKEP--RPLHGAAFGLIAGGGLGNVVDRLRQGAVTDF 138

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIII 90
           I +H   + +  FNLAD  I +G  ++I
Sbjct: 139 IDVHAAGYHWPAFNLADTAIFLGAALLI 166


>gi|114564053|ref|YP_751567.1| lipoprotein signal peptidase [Shewanella frigidimarina NCIMB 400]
 gi|114335346|gb|ABI72728.1| signal peptidase II. Aspartic peptidase. MEROPS family A08
           [Shewanella frigidimarina NCIMB 400]
          Length = 170

 Score = 98.5 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 25/102 (24%), Positives = 48/102 (47%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +   I +     +    +K   +    ++ + L+  GALGN+VD  ++G+VID++
Sbjct: 69  GWQRWLFTIIAVGFSTLLTIWLRKQSYSLWRSNLAFTLVIGGALGNLVDRLMHGFVIDFV 128

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
             +  T  +  FN+AD  I IG  +II++      +   + D
Sbjct: 129 DFYWNTSHYPAFNIADAGIFIGAVLIIWESFRPDAKPSKEQD 170


>gi|120556181|ref|YP_960532.1| lipoprotein signal peptidase [Marinobacter aquaeolei VT8]
 gi|120326030|gb|ABM20345.1| signal peptidase II, Aspartic peptidase, MEROPS family A08
           [Marinobacter aquaeolei VT8]
          Length = 171

 Score = 98.5 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 27/105 (25%), Positives = 50/105 (47%), Gaps = 2/105 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  ++I +++ A +  + +     K    + Y ++  GA GNV+D    GYV+DY+
Sbjct: 67  GWQRYFFIAIAVVVSAVLVKLMR--DSHKRTEALAYAMVLGGAFGNVIDRVFRGYVVDYL 124

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDFPQ 108
             H Q+W +  FNLAD+FI +   +I+      +      ++  Q
Sbjct: 125 DFHWQSWHWPAFNLADVFILLSVAMILVTGFTAEKGAGNNMENRQ 169


>gi|325914854|ref|ZP_08177189.1| signal peptidase II Aspartic peptidase MEROPS family A08
           [Xanthomonas vesicatoria ATCC 35937]
 gi|325538945|gb|EGD10606.1| signal peptidase II Aspartic peptidase MEROPS family A08
           [Xanthomonas vesicatoria ATCC 35937]
          Length = 163

 Score = 98.5 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 21/99 (21%), Positives = 46/99 (46%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   ++ + I   + F   +  + +    + Y L+  GA+GNV+D  ++G+V+D+I
Sbjct: 58  GWQLWFFTALAVGISGLLAFWLSRTARGEWRSALPYALVIGGAIGNVIDRLMHGHVVDFI 117

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
             +  + ++  FN+AD  I  G   I    +  +  ++ 
Sbjct: 118 QWYIGSHTWPSFNIADSAIVGGAIGIALFGLFDKSGKRE 156


>gi|153207854|ref|ZP_01946431.1| signal peptidase II [Coxiella burnetii 'MSU Goat Q177']
 gi|120576280|gb|EAX32904.1| signal peptidase II [Coxiella burnetii 'MSU Goat Q177']
          Length = 163

 Score = 98.5 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 26/98 (26%), Positives = 47/98 (47%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +         I  ++  F+     +  +++ +  +G  LI  GALGN +D   + YV D+
Sbjct: 65  NGWQIIFFADISFVVSIFLILWLSRTSRSEIMMSLGLSLIIGGALGNFIDRLRWSYVTDF 124

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
           I  H + W FA FN+AD  I +G  ++I   ++    +
Sbjct: 125 IDFHIKDWHFATFNVADSAICVGVFLLIVHMLLTPSSK 162


>gi|119476948|ref|ZP_01617229.1| prolipoprotein signal peptidase (Signal peptidase II.) [marine
           gamma proteobacterium HTCC2143]
 gi|119449755|gb|EAW30992.1| prolipoprotein signal peptidase (Signal peptidase II.) [marine
           gamma proteobacterium HTCC2143]
          Length = 169

 Score = 98.5 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 27/107 (25%), Positives = 50/107 (46%)

Query: 2   LSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVID 61
           L      +   I I++   +     +    + +       I  GA+GNV      GYV+D
Sbjct: 63  LGGAQVWLFSIIAIVVSVVMVVWLGRLKPDQRLLSASLAFIVGGAIGNVWGRIELGYVVD 122

Query: 62  YIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDFPQ 108
           +I +H Q+  F  FN+AD+ I+IG  ++I D I+   + + + +  +
Sbjct: 123 FISLHYQSSYFPTFNIADIAINIGAGLMILDIILNPEKAESESEKAK 169


>gi|315646051|ref|ZP_07899172.1| lipoprotein signal peptidase [Paenibacillus vortex V453]
 gi|315278812|gb|EFU42126.1| lipoprotein signal peptidase [Paenibacillus vortex V453]
          Length = 166

 Score = 98.5 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 27/99 (27%), Positives = 54/99 (54%), Gaps = 1/99 (1%)

Query: 6   SPTILVSIRILIIAFIFFIWKKN-PKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIM 64
                + + ++++A I +  +K   + + +      L+  GALGN +D  + G V+D++ 
Sbjct: 56  QLWFFIVVTLIVVAGIIWYLQKVVKEGRRLLPTALALVLGGALGNFIDRLVMGEVVDFLQ 115

Query: 65  IHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
            +  +++F +FN+AD  I IG  +II D ++   R+K K
Sbjct: 116 FNFGSYTFPIFNIADSCIVIGVALIILDTLLDGRREKMK 154


>gi|301063387|ref|ZP_07203926.1| signal peptidase II [delta proteobacterium NaphS2]
 gi|300442550|gb|EFK06776.1| signal peptidase II [delta proteobacterium NaphS2]
          Length = 163

 Score = 98.5 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 26/103 (25%), Positives = 46/103 (44%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
           ++   ILV   I+ I  + F +       +   +G  LI  GA+GN++D      VID++
Sbjct: 58  DLGFWILVFATIVAIFLLLFWFYHMKGESNWTTLGLSLILGGAIGNLIDRIRLHEVIDFL 117

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDF 106
             H   W +  FN+AD  I++G  ++          +K   + 
Sbjct: 118 DFHVGAWHWPSFNVADAAITVGAFLVGLSLFFGGAPKKTASET 160


>gi|118497047|ref|YP_898097.1| lipoprotein signal peptidase II [Francisella tularensis subsp.
           novicida U112]
 gi|254372407|ref|ZP_04987897.1| lipoprotein signal peptidase II [Francisella tularensis subsp.
           novicida GA99-3549]
 gi|254373878|ref|ZP_04989360.1| lipoprotein signal peptidase II [Francisella novicida GA99-3548]
 gi|152032418|sp|A0Q528|LSPA_FRATN RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|118422953|gb|ABK89343.1| lipoprotein signal peptidase II [Francisella novicida U112]
 gi|151570135|gb|EDN35789.1| lipoprotein signal peptidase II [Francisella novicida GA99-3549]
 gi|151571598|gb|EDN37252.1| lipoprotein signal peptidase II [Francisella novicida GA99-3548]
          Length = 161

 Score = 98.1 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 47/96 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
           +    +  +I ++    + ++  K P T+ I    + LI  GALGN  D    GYVID++
Sbjct: 65  SWQMIMFSTISLIAAIVLIYLIIKQPITEKINLFSFALILGGALGNFYDRAFQGYVIDFL 124

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
             H   + +  FN+AD  I+ G  I+I   +  + +
Sbjct: 125 DFHIGNYHWPSFNIADSAITCGVVILIAASLFTKKK 160


>gi|209966834|ref|YP_002299749.1| Lipoprotein signal peptidase II, LspA, putative [Rhodospirillum
           centenum SW]
 gi|209960300|gb|ACJ00937.1| Lipoprotein signal peptidase II, LspA, putative [Rhodospirillum
           centenum SW]
          Length = 181

 Score = 98.1 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 25/96 (26%), Positives = 47/96 (48%), Gaps = 2/96 (2%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +   P +L+ + + I A +    ++    ++       L+  GALGNV+D   +G V D+
Sbjct: 85  AEFMPYVLIGVALAISAVLVLWLRRT--DRAFQAASIGLVIGGALGNVIDRLRFGAVADF 142

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
           +  H   W +  FN+AD  I +G  +I+ D +  + 
Sbjct: 143 LDFHLSGWHWPAFNVADSAIVVGVALIVADGLFPRP 178


>gi|194324281|ref|ZP_03058055.1| signal peptidase II [Francisella tularensis subsp. novicida FTE]
 gi|208780503|ref|ZP_03247843.1| signal peptidase II [Francisella novicida FTG]
 gi|194321728|gb|EDX19212.1| signal peptidase II [Francisella tularensis subsp. novicida FTE]
 gi|208743649|gb|EDZ89953.1| signal peptidase II [Francisella novicida FTG]
 gi|328676511|gb|AEB27381.1| Lipoprotein signal peptidase [Francisella cf. novicida Fx1]
          Length = 159

 Score = 98.1 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 47/96 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
           +    +  +I ++    + ++  K P T+ I    + LI  GALGN  D    GYVID++
Sbjct: 63  SWQMIMFSTISLIAAIVLIYLIIKQPITEKINLFSFALILGGALGNFYDRAFQGYVIDFL 122

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
             H   + +  FN+AD  I+ G  I+I   +  + +
Sbjct: 123 DFHIGNYHWPSFNIADSAITCGVVILIAASLFTKKK 158


>gi|56708015|ref|YP_169911.1| lipoprotein signal peptidase [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|89255845|ref|YP_513207.1| lipoprotein signal peptidase [Francisella tularensis subsp.
           holarctica LVS]
 gi|110670486|ref|YP_667043.1| lipoprotein signal peptidase II [Francisella tularensis subsp.
           tularensis FSC198]
 gi|115314332|ref|YP_763055.1| lipoprotein signal peptidase II [Francisella tularensis subsp.
           holarctica OSU18]
 gi|167010067|ref|ZP_02274998.1| signal peptidase II [Francisella tularensis subsp. holarctica
           FSC200]
 gi|187931313|ref|YP_001891297.1| signal peptidase II [Francisella tularensis subsp. mediasiatica
           FSC147]
 gi|224457096|ref|ZP_03665569.1| signal peptidase II [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|254367207|ref|ZP_04983237.1| lipoprotein signal peptidase II [Francisella tularensis subsp.
           holarctica 257]
 gi|254368673|ref|ZP_04984687.1| lipoprotein signal peptidase II [Francisella tularensis subsp.
           holarctica FSC022]
 gi|254370498|ref|ZP_04986503.1| lipoprotein signal peptidase II [Francisella tularensis subsp.
           tularensis FSC033]
 gi|254874814|ref|ZP_05247524.1| lipoprotein signal peptidase [Francisella tularensis subsp.
           tularensis MA00-2987]
 gi|290954400|ref|ZP_06559021.1| lipoprotein signal peptidase [Francisella tularensis subsp.
           holarctica URFT1]
 gi|295312177|ref|ZP_06802982.1| lipoprotein signal peptidase [Francisella tularensis subsp.
           holarctica URFT1]
 gi|81820781|sp|Q5NGD1|LSPA_FRATT RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|122325635|sp|Q0BNB6|LSPA_FRATO RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|122501136|sp|Q2A4Z5|LSPA_FRATH RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|123169404|sp|Q14HT3|LSPA_FRAT1 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|238691533|sp|B2SF87|LSPA_FRATM RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|56604507|emb|CAG45547.1| lipoprotein signal peptidase II [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|89143676|emb|CAJ78875.1| lipoprotein signal peptidase II [Francisella tularensis subsp.
           holarctica LVS]
 gi|110320819|emb|CAL08930.1| lipoprotein signal peptidase II [Francisella tularensis subsp.
           tularensis FSC198]
 gi|115129231|gb|ABI82418.1| signal peptidase II [Francisella tularensis subsp. holarctica
           OSU18]
 gi|134253027|gb|EBA52121.1| lipoprotein signal peptidase II [Francisella tularensis subsp.
           holarctica 257]
 gi|151568741|gb|EDN34395.1| lipoprotein signal peptidase II [Francisella tularensis subsp.
           tularensis FSC033]
 gi|157121588|gb|EDO65765.1| lipoprotein signal peptidase II [Francisella tularensis subsp.
           holarctica FSC022]
 gi|187712222|gb|ACD30519.1| signal peptidase II [Francisella tularensis subsp. mediasiatica
           FSC147]
 gi|254840813|gb|EET19249.1| lipoprotein signal peptidase [Francisella tularensis subsp.
           tularensis MA00-2987]
 gi|282159203|gb|ADA78594.1| signal peptidase II [Francisella tularensis subsp. tularensis
           NE061598]
          Length = 161

 Score = 98.1 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 47/96 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
           +    +  +I ++    + ++  K P T+ I    + LI  GALGN  D    GYVID++
Sbjct: 65  SWQMIMFSTISLIAAIVLIYLIIKQPITEKINLFSFALILGGALGNFYDRAFQGYVIDFL 124

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
             H   + +  FN+AD  I+ G  I+I   +  + +
Sbjct: 125 DFHIGNYHWPSFNIADSAITCGVVILIAASLFTKKK 160


>gi|134302195|ref|YP_001122164.1| lipoprotein signal peptidase II [Francisella tularensis subsp.
           tularensis WY96-3418]
 gi|134049972|gb|ABO47043.1| signal peptidase II [Francisella tularensis subsp. tularensis
           WY96-3418]
          Length = 159

 Score = 98.1 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 47/96 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
           +    +  +I ++    + ++  K P T+ I    + LI  GALGN  D    GYVID++
Sbjct: 63  SWQMIMFSTISLIAAIVLIYLIIKQPITEKINLFSFALILGGALGNFYDRAFQGYVIDFL 122

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
             H   + +  FN+AD  I+ G  I+I   +  + +
Sbjct: 123 DFHIGNYHWPSFNIADSAITCGVVILIAASLFTKKK 158


>gi|157692225|ref|YP_001486687.1| lipoprotein signal peptidase [Bacillus pumilus SAFR-032]
 gi|226740868|sp|A8FD10|LSPA_BACP2 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|157680983|gb|ABV62127.1| A8 family signal peptidase II [Bacillus pumilus SAFR-032]
          Length = 155

 Score = 98.1 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 19/97 (19%), Positives = 44/97 (45%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
                  I +++IA I +  +K+ +   +  +   L+  GA+GN +D      V+D+   
Sbjct: 56  QMWFFYVITLVVIAGIVYYLQKHGQKDKLLGVALALMLGGAIGNFIDRVFRQEVVDFAHF 115

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
               + + +FN+AD  + +G  ++    ++   + K 
Sbjct: 116 VFGNYHYPIFNIADSSLCVGVILLFIQMLLDGKKTKE 152


>gi|253998234|ref|YP_003050297.1| lipoprotein signal peptidase [Methylovorus sp. SIP3-4]
 gi|253984913|gb|ACT49770.1| lipoprotein signal peptidase [Methylovorus sp. SIP3-4]
          Length = 151

 Score = 98.1 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 26/94 (27%), Positives = 48/94 (51%), Gaps = 1/94 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   +I ++    I F+ +++  T+ +F     L+  GALGN+ D    GYV+D++
Sbjct: 58  GWQRVFFSAIALIASGIILFMLRRH-STQKLFCFALALVLGGALGNLYDRLTLGYVVDFL 116

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQ 97
             H Q++ +  FN+AD  I +G  ++I D    +
Sbjct: 117 FFHYQSFYWPAFNVADSAICVGVALLILDSFKKK 150


>gi|237809688|ref|YP_002894128.1| lipoprotein signal peptidase [Tolumonas auensis DSM 9187]
 gi|259495136|sp|C4LD11|LSPA_TOLAT RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|237501949|gb|ACQ94542.1| lipoprotein signal peptidase [Tolumonas auensis DSM 9187]
          Length = 164

 Score = 98.1 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 32/99 (32%), Positives = 52/99 (52%), Gaps = 1/99 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +   + I+I   +     K P   S+ ++ Y L+  GA+GN++D  +YG+V+D++
Sbjct: 66  GWQRWLFSGLAIVISGVLAVAMAKAPAKCSLSNLAYSLVIGGAIGNLIDRVVYGHVVDFL 125

Query: 64  MIHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
             H Q  + FA FN+AD+ IS G   II D  I +   K
Sbjct: 126 DFHWQDLYHFAAFNVADMAISCGAVFIILDGFIKKPADK 164


>gi|89098728|ref|ZP_01171610.1| signal peptidase II [Bacillus sp. NRRL B-14911]
 gi|89086690|gb|EAR65809.1| signal peptidase II [Bacillus sp. NRRL B-14911]
          Length = 167

 Score = 98.1 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 25/100 (25%), Positives = 45/100 (45%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
                  I + +I  I +  K   K K +  I   L+  GA+GN +D      V+D++  
Sbjct: 61  QMWFFYVITVAVIIGIVYYIKTAAKGKRLLGIALGLMLGGAIGNFIDRVFRKEVVDFVNT 120

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
           +   + F VFN+AD  + +G  I++   +  +   K K +
Sbjct: 121 YIFGYDFPVFNVADSSLVVGVIILMIQMLREEREAKEKSN 160


>gi|134102272|ref|YP_001107933.1| lipoprotein signal peptidase [Saccharopolyspora erythraea NRRL
           2338]
 gi|291003765|ref|ZP_06561738.1| lipoprotein signal peptidase [Saccharopolyspora erythraea NRRL
           2338]
 gi|133914895|emb|CAM05008.1| lipoprotein signal peptidase [Saccharopolyspora erythraea NRRL
           2338]
          Length = 244

 Score = 98.1 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 27/104 (25%), Positives = 48/104 (46%), Gaps = 9/104 (8%)

Query: 2   LSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLY----- 56
           L+     +L  + I+++  I ++ +K   T     IG  L+  GA GN+VD         
Sbjct: 128 LATGMTWLLALLAIVVVGVIVWLARKLRSTGW--AIGLGLVLGGACGNLVDRFFRAPGPM 185

Query: 57  -GYVIDYIM-IHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
            G+V+D+I         + VFNLAD  I  G  +++   ++ + 
Sbjct: 186 QGHVVDFISVFAPGGQYYPVFNLADSAIVCGGALVVLLSLLGRD 229


>gi|238549686|dbj|BAH66037.1| integral membrane protein fused with prolipoprotein signal
           peptidase [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
          Length = 403

 Score = 98.1 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 25/88 (28%), Positives = 44/88 (50%), Gaps = 2/88 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  +++ + + A++  +  +      +  +GY LI  GALGNV D  L G V+D++
Sbjct: 302 GWQRYFFITLGLAVSAWLGRMLCQQR--PRLEAMGYSLILGGALGNVADRVLRGQVVDFL 359

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIY 91
             H +   +  FNLAD+ I+IG   +  
Sbjct: 360 DFHWRLAHWPAFNLADVAITIGALCLFL 387


>gi|218530555|ref|YP_002421371.1| lipoprotein signal peptidase [Methylobacterium chloromethanicum
           CM4]
 gi|218522858|gb|ACK83443.1| lipoprotein signal peptidase [Methylobacterium chloromethanicum
           CM4]
          Length = 171

 Score = 98.1 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 43/96 (44%), Gaps = 2/96 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
            +   +LV + +     +     +      +  +   LI  GALGN +D   YG V D++
Sbjct: 63  GLGRWLLVGVSLAAAIGLSVWMHR--AGSRLLAVALGLIVGGALGNAIDRAAYGAVFDFV 120

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
            +H   WS+ VFN+AD  I  G   +I D +    R
Sbjct: 121 HLHAGPWSWYVFNVADAAIVAGVVGLILDSLRPAPR 156


>gi|38639699|ref|NP_943468.1| PbrB/PbrC [Klebsiella pneumoniae]
 gi|226807662|ref|YP_002791356.1| PbrB/PbrC [Enterobacter cloacae]
 gi|226809972|ref|YP_002791666.1| PbrB/PbrC [Enterobacter cloacae]
 gi|38016797|gb|AAR07818.1| PbrB/PbrC [Klebsiella pneumoniae]
 gi|226425887|gb|ACO53980.1| PbrB/PbrC [Enterobacter cloacae]
 gi|226426198|gb|ACO54290.1| PbrB/PbrC [Enterobacter cloacae]
          Length = 382

 Score = 98.1 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 25/88 (28%), Positives = 44/88 (50%), Gaps = 2/88 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  +++ + + A++  +  +      +  +GY LI  GALGNV D  L G V+D++
Sbjct: 281 GWQRYFFITLGLAVSAWLGRMLCQQR--PRLEAMGYSLILGGALGNVADRVLRGQVVDFL 338

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIY 91
             H +   +  FNLAD+ I+IG   +  
Sbjct: 339 DFHWRLAHWPAFNLADVAITIGALCLFL 366


>gi|309778679|ref|ZP_07673453.1| signal peptidase II [Ralstonia sp. 5_7_47FAA]
 gi|308922529|gb|EFP68152.1| signal peptidase II [Ralstonia sp. 5_7_47FAA]
          Length = 170

 Score = 97.8 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 24/87 (27%), Positives = 43/87 (49%), Gaps = 2/87 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  +++     A++ ++ ++N     +    Y LI  G LGNV D    G V+DY+
Sbjct: 69  GWQRYFFIALAFAASAWLIWMLRRN--LPRLEAAAYALILAGTLGNVADRVARGQVVDYL 126

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIII 90
             + + W +  FNLAD+ IS+G   ++
Sbjct: 127 DFYWRAWHWPAFNLADVAISLGAICLL 153


>gi|221065566|ref|ZP_03541671.1| lipoprotein signal peptidase [Comamonas testosteroni KF-1]
 gi|220710589|gb|EED65957.1| lipoprotein signal peptidase [Comamonas testosteroni KF-1]
          Length = 363

 Score = 97.8 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 28/95 (29%), Positives = 50/95 (52%), Gaps = 2/95 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + + + + A++  + K+  +  S+  +GY LI  GALGNV D  L G V+D++
Sbjct: 257 GWQRYFFIVLGLAVSAWLVRMLKQ--RLPSLEALGYSLILGGALGNVADRLLRGQVVDFL 314

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
             H +   +  FNLAD+ I+ G  ++I + +I   
Sbjct: 315 DFHWRHSHWPAFNLADVAITSGAVLLIINGLIQGR 349


>gi|15887692|ref|NP_353373.1| lipoprotein signal peptidase [Agrobacterium tumefaciens str. C58]
 gi|15155249|gb|AAK86158.1| lipoprotein signal peptidase [Agrobacterium tumefaciens str. C58]
          Length = 162

 Score = 97.8 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 44/102 (43%), Positives = 67/102 (65%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           ML ++    +VS+R++I+ F+ ++W+K    ++   +G+  I  GA GN++D   YG+VI
Sbjct: 61  MLEDMHGWFIVSMRLVIVVFVLWLWRKTAADRTFAHLGFAFIIAGAAGNLLDRFFYGHVI 120

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           DYI+ HTQTWSFAVFNLAD FI+IG   +I D+ +     K 
Sbjct: 121 DYILFHTQTWSFAVFNLADSFITIGAACVILDEFLHARAAKK 162


>gi|330722378|gb|EGH00229.1| Lipoprotein signal peptidase [gamma proteobacterium IMCC2047]
          Length = 169

 Score = 97.8 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 27/100 (27%), Positives = 48/100 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +   +  ++   +    K+    ++   I   L+  GALGN+ D  + GYV+D+I
Sbjct: 61  GWQRWLFALLAAVVSVVLVVWLKRLKAHETWLAIALALVLGGALGNLYDRVVLGYVVDFI 120

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
            +H Q + F  FNLAD  I++G  ++I D +    R   +
Sbjct: 121 SVHYQRYYFPAFNLADSGITVGAIMLIIDTLWFSRRSVAE 160


>gi|187928896|ref|YP_001899383.1| lipoprotein signal peptidase [Ralstonia pickettii 12J]
 gi|187725786|gb|ACD26951.1| lipoprotein signal peptidase [Ralstonia pickettii 12J]
          Length = 358

 Score = 97.8 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 21/100 (21%), Positives = 46/100 (46%), Gaps = 2/100 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                + + + +++  ++  + +K      +  + Y LI  GA GN+ D    G V+D++
Sbjct: 257 GWQRYLFMGLSLVVSVWLAHVLRKRLSN--MEALAYSLILGGAAGNLADRIWRGQVVDFL 314

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
            +H     +  FNLAD+ I+ G   ++   ++ +     K
Sbjct: 315 DLHWMQLHWPAFNLADVAITTGAGCLMLAVLMQRQGTTAK 354


>gi|26987341|ref|NP_742766.1| lipoprotein signal peptidase [Pseudomonas putida KT2440]
 gi|24981992|gb|AAN66230.1|AE016251_6 lipoprotein signal peptidase [Pseudomonas putida KT2440]
          Length = 176

 Score = 97.8 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 23/99 (23%), Positives = 50/99 (50%), Gaps = 1/99 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +     +   I +++ A +    K+  + ++   +   L+  GA+GN+ D  + G+V+D+
Sbjct: 73  AGWQRWLFALIAVVVSAVLVVWLKRLGRNETWLAVALALVLGGAIGNLYDRIVLGHVVDF 132

Query: 63  IMIHTQTWS-FAVFNLADLFISIGTCIIIYDDIILQHRQ 100
           I++H Q    F  FN+AD  I++G  ++  D    +  +
Sbjct: 133 ILVHWQNRHYFPAFNVADSAITVGAVMLALDMFKSKKSE 171


>gi|226939544|ref|YP_002794617.1| lipoprotein signal peptidase [Laribacter hongkongensis HLHK9]
 gi|226714470|gb|ACO73608.1| LspA [Laribacter hongkongensis HLHK9]
          Length = 169

 Score = 97.8 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 22/97 (22%), Positives = 50/97 (51%), Gaps = 1/97 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    + + +  ++  +  +  +++ + +    LI  GALGN++D   YG+V+D+I
Sbjct: 74  GWQRYFFSLLALAVTVWLGGLIWRGRQSQ-LMNCAASLIIGGALGNLIDRLAYGHVVDFI 132

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
            ++  ++ +  FNLAD  I +G  +++ D    + R+
Sbjct: 133 QLYYGSFVWPAFNLADSAICLGAALMVIDGFRKEKRR 169


>gi|301154957|emb|CBW14420.1| prolipoprotein signal peptidase (signal peptidase II) [Haemophilus
           parainfluenzae T3T1]
          Length = 163

 Score = 97.8 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 27/100 (27%), Positives = 46/100 (46%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + + I I   + +  KKN   + + +  Y LI  GAL N+VD    G+V+D++
Sbjct: 64  GWQKYFFIVLAIGISLMLTYFMKKNSAEQKLQNSAYALIIGGALANMVDRAYNGFVVDFL 123

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
             +     + VFN+AD+ I IG  ++  D      +   K
Sbjct: 124 DFYWDIHHYPVFNVADIAICIGAGLLALDAFKGDKKSGQK 163


>gi|119774062|ref|YP_926802.1| lipoprotein signal peptidase [Shewanella amazonensis SB2B]
 gi|166232875|sp|A1S426|LSPA_SHEAM RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|119766562|gb|ABL99132.1| signal peptidase II. Aspartic peptidase. MEROPS family A08
           [Shewanella amazonensis SB2B]
          Length = 168

 Score = 97.8 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 25/103 (24%), Positives = 45/103 (43%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +  ++ +     +    +K P      ++ Y L+  GALGN++D   +G+V+D++
Sbjct: 66  GWQRWLFTAVAVGFSVLLTIWLRKQPANMVRLNLAYTLVIGGALGNLIDRLQHGFVVDFL 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDF 106
             +  T  +  FN+AD  I IG  +II D           I  
Sbjct: 126 DFYWNTAHYPAFNIADAAIFIGAVLIIIDSFKASSSDDKAIKE 168


>gi|261346441|ref|ZP_05974085.1| signal peptidase II [Providencia rustigianii DSM 4541]
 gi|282565425|gb|EFB70960.1| signal peptidase II [Providencia rustigianii DSM 4541]
          Length = 167

 Score = 97.8 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 28/99 (28%), Positives = 50/99 (50%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I I   +  +  +    K + +I Y LI  GA+GN+ D  ++G+V+DYI
Sbjct: 66  GWQRWFFAGIAIAISIILMVMMYRQSVKKRLSNIAYALIIGGAIGNLFDRLVHGFVVDYI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
             +   W +  FNLAD+ I IG  ++I++  + +  ++ 
Sbjct: 126 DFYVGDWHWPTFNLADMAICIGAALVIFEGFLPEKPKQE 164


>gi|84623170|ref|YP_450542.1| lipoprotein signal peptidase [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188575773|ref|YP_001912702.1| lipoprotein signal peptidase [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|123522549|sp|Q2P5A9|LSPA_XANOM RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|148887167|sp|Q5H2E0|LSPA_XANOR RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|238058067|sp|B2STC5|LSPA_XANOP RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|84367110|dbj|BAE68268.1| lipoprotein signal peptidase [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188520225|gb|ACD58170.1| signal peptidase II [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 166

 Score = 97.8 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 21/99 (21%), Positives = 45/99 (45%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   ++ + I   + F   +  +      + Y L+  GA+GNV+D  ++G+V+D+I
Sbjct: 67  GWQLWFFTALAMGISGLLAFWLSRTARGHWRSALPYALVIGGAIGNVIDRLMHGHVVDFI 126

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
             +  + ++  FN+AD  I  G   I    +  +  ++ 
Sbjct: 127 QWYIGSHTWPSFNIADSAIVGGAIGIAVFGLFDKAGKQA 165


>gi|254490938|ref|ZP_05104120.1| signal peptidase II [Methylophaga thiooxidans DMS010]
 gi|224463847|gb|EEF80114.1| signal peptidase II [Methylophaga thiooxydans DMS010]
          Length = 155

 Score = 97.8 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 24/98 (24%), Positives = 47/98 (47%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   ++ +++   +    KK      +      LI  GA+GNV+D  ++GYVID++
Sbjct: 58  GWQRWFFAALAVVVSVALTIWMKKLKPNAKMEAAALALIIGGAVGNVIDRFVHGYVIDFL 117

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
            ++  ++ +  FN+AD  I IG  ++I D    +   +
Sbjct: 118 DVYYGSYHWPAFNIADSAICIGAVLLILDSFRNKTESQ 155


>gi|114797959|ref|YP_760434.1| signal peptidase II [Hyphomonas neptunium ATCC 15444]
 gi|114738133|gb|ABI76258.1| signal peptidase II [Hyphomonas neptunium ATCC 15444]
          Length = 154

 Score = 97.4 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 24/94 (25%), Positives = 44/94 (46%), Gaps = 2/94 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
           S   ++ I   I   + F + +  ++     +   LI  GALGN++D    G V D++  
Sbjct: 60  SAWPVIVITAAITVALAFWFWRTTRSG--EQLALALIVGGALGNLIDRVHRGAVTDFLDF 117

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
           H   W +  FNLAD  I  G  +++   +  +++
Sbjct: 118 HAAGWHWPAFNLADTAIVCGAVLLLCHSLSPRNQ 151


>gi|116624430|ref|YP_826586.1| signal peptidase II [Candidatus Solibacter usitatus Ellin6076]
 gi|122252934|sp|Q01VL4|LSPA_SOLUE RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|116227592|gb|ABJ86301.1| signal peptidase II. Aspartic peptidase. MEROPS family A08
           [Candidatus Solibacter usitatus Ellin6076]
          Length = 164

 Score = 97.4 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 49/97 (50%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S    TILV +    + FI  +     +       G  LI  GA GNV D  ++G V D+
Sbjct: 63  SEWRTTILVVLAGAAVIFIAAMLWNAQRLDRASFWGLSLILGGAAGNVFDRAMFGKVTDF 122

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
           + ++ + + +  FN+AD  I +G+C+++ D +  + +
Sbjct: 123 LDLYYRDYHWHTFNVADSAIVVGSCLLLIDLLRPKRQ 159


>gi|311068066|ref|YP_003972989.1| lipoprotein signal peptidase [Bacillus atrophaeus 1942]
 gi|310868583|gb|ADP32058.1| lipoprotein signal peptidase [Bacillus atrophaeus 1942]
          Length = 154

 Score = 97.4 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 20/99 (20%), Positives = 48/99 (48%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
                  I + +I  I +  ++  K + +  I   L+  GA+GN +D  +   V+D+I +
Sbjct: 56  QMWFFYLITVAVIIGIVYYIQRYTKGQKLLGISLGLMLGGAIGNFIDRAVRQEVVDFIHV 115

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
               +++ +FN+AD  + +G  ++    ++   ++K + 
Sbjct: 116 IIVNYNYPIFNIADSSLCVGVVLLFIQMLLDSGKKKKEQ 154


>gi|225626688|ref|ZP_03784727.1| signal peptidase II [Brucella ceti str. Cudo]
 gi|260563221|ref|ZP_05833707.1| lipoprotein signal peptidase [Brucella melitensis bv. 1 str. 16M]
 gi|260567213|ref|ZP_05837683.1| signal peptidase II, family A8 [Brucella suis bv. 4 str. 40]
 gi|261759263|ref|ZP_06002972.1| signal peptidase II [Brucella sp. F5/99]
 gi|265999667|ref|ZP_05467338.2| lipoprotein signal peptidase [Brucella melitensis bv. 2 str. 63/9]
 gi|225618345|gb|EEH15388.1| signal peptidase II [Brucella ceti str. Cudo]
 gi|260153237|gb|EEW88329.1| lipoprotein signal peptidase [Brucella melitensis bv. 1 str. 16M]
 gi|260156731|gb|EEW91811.1| signal peptidase II, family A8 [Brucella suis bv. 4 str. 40]
 gi|261739247|gb|EEY27243.1| signal peptidase II [Brucella sp. F5/99]
 gi|263095216|gb|EEZ18885.1| lipoprotein signal peptidase [Brucella melitensis bv. 2 str. 63/9]
          Length = 175

 Score = 97.4 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 40/101 (39%), Positives = 67/101 (66%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           ML+ +    L++I + +IAF+ ++W  N   +     G+ L+  GA+GN++D  ++GYV+
Sbjct: 72  MLAWLHDGGLIAITLAVIAFVLYLWWTNAPERVFARYGFALVIGGAIGNLIDRVMHGYVV 131

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
           DY++ H  TWSFAVFNLAD FI+IG  +II ++ +   R++
Sbjct: 132 DYVLFHLPTWSFAVFNLADAFITIGAGLIILEEFLGWRRER 172


>gi|297622633|ref|YP_003704067.1| lipoprotein signal peptidase [Truepera radiovictrix DSM 17093]
 gi|297163813|gb|ADI13524.1| lipoprotein signal peptidase [Truepera radiovictrix DSM 17093]
          Length = 173

 Score = 97.4 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 26/93 (27%), Positives = 51/93 (54%), Gaps = 2/93 (2%)

Query: 4   NVSPTILVSI--RILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVID 61
             + T+L+ +    + +A + ++ ++ P    +    + LI  GA+GN++D    GYV D
Sbjct: 55  GPTTTLLLGVLSAAVSLALLIYLLRRAPTLSRLQLSAFTLILAGAVGNMIDRFYLGYVRD 114

Query: 62  YIMIHTQTWSFAVFNLADLFISIGTCIIIYDDI 94
           +I  H   ++F VFN+AD+ + IG  ++I   +
Sbjct: 115 FIHFHLPNFNFPVFNVADMCVVIGAGLLILASL 147


>gi|319943229|ref|ZP_08017512.1| signal peptidase II [Lautropia mirabilis ATCC 51599]
 gi|319743771|gb|EFV96175.1| signal peptidase II [Lautropia mirabilis ATCC 51599]
          Length = 178

 Score = 97.4 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 26/100 (26%), Positives = 52/100 (52%), Gaps = 1/100 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S         I ++  A +  +   + + + +F +   LI  GA+GN+VD  + G+V D+
Sbjct: 78  SGWQRWFFAGIAVVASAVLISLLF-SARGQRMFSLALALILGGAIGNLVDRLVLGHVTDF 136

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           ++ +   W+F  FNLAD  I++G  ++I  +++   R + 
Sbjct: 137 LLFYQGVWAFPAFNLADCAITLGAILLICHELLPWLRPRK 176


>gi|281356181|ref|ZP_06242674.1| lipoprotein signal peptidase [Victivallis vadensis ATCC BAA-548]
 gi|281317550|gb|EFB01571.1| lipoprotein signal peptidase [Victivallis vadensis ATCC BAA-548]
          Length = 183

 Score = 97.4 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 24/100 (24%), Positives = 45/100 (45%), Gaps = 2/100 (2%)

Query: 2   LSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVID 61
           LS      L+ I  L+ A   + ++   +          +I  G +GN +D    G V+D
Sbjct: 74  LSGYG-WFLLLIAALVTAAALWFFRYLTEGYPERYFAIFIILGGVVGNSIDRIWRGAVVD 132

Query: 62  YIMIHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
           +  +H    + + VFN+AD+ I +G  I +   ++   R+
Sbjct: 133 FFDLHYYEAYHWPVFNIADIAICVGVGIFVLSSLLRPSRK 172


>gi|77920048|ref|YP_357863.1| lipoprotein signal peptidase [Pelobacter carbinolicus DSM 2380]
 gi|123573563|sp|Q3A1R4|LSPA_PELCD RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|77546131|gb|ABA89693.1| signal peptidase II, Aspartic peptidase, MEROPS family A08
           [Pelobacter carbinolicus DSM 2380]
          Length = 161

 Score = 97.0 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 18/95 (18%), Positives = 45/95 (47%)

Query: 8   TILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHT 67
              +    + + F+ + +++    + +      L+  GA+GN++D   +G V+D++ +H 
Sbjct: 67  PFFIITTSVAVVFLAWFYRQYRPDQVLGRCAVSLVLGGAIGNLIDRVRFGEVVDFLDVHW 126

Query: 68  QTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
             + +  FN+AD  I +G  +++        R + 
Sbjct: 127 YQYHWPAFNVADSAICVGVGMLLLAQWRDGIRHQA 161


>gi|86156443|ref|YP_463228.1| lipoprotein signal peptidase [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85772954|gb|ABC79791.1| signal peptidase II, Aspartic peptidase, MEROPS family A08
           [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 206

 Score = 97.0 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 22/93 (23%), Positives = 40/93 (43%), Gaps = 3/93 (3%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
                     + +  +AFI   ++K  + +    +   L+  GA+GN VD     YVID+
Sbjct: 93  QFFRNAFFTLVSVAAVAFILHYYRKLRQDQRYLQVALGLVLAGAVGNFVDRLARRYVIDF 152

Query: 63  IMIHTQT---WSFAVFNLADLFISIGTCIIIYD 92
           I  +        +  FN+AD  I +G  +++  
Sbjct: 153 IEWYWWNRPDIRWPTFNVADSLIVVGVAMLVLH 185


>gi|256828300|ref|YP_003157028.1| lipoprotein signal peptidase [Desulfomicrobium baculatum DSM 4028]
 gi|256577476|gb|ACU88612.1| lipoprotein signal peptidase [Desulfomicrobium baculatum DSM 4028]
          Length = 178

 Score = 97.0 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 22/96 (22%), Positives = 44/96 (45%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
           +      + + IL +  I+ + +        +  G  LI +GALGN++D    G V+D++
Sbjct: 77  DWQRPFFIVVSILAVGLIWVLARSQDDDGPFYVYGLGLILSGALGNLLDRARLGVVVDFL 136

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
             +     +  FN+AD+ I +G   ++      + R
Sbjct: 137 DFYIGDMHWPAFNVADMGICVGAASLLVSFYQQRRR 172


>gi|307941706|ref|ZP_07657061.1| signal peptidase II [Roseibium sp. TrichSKD4]
 gi|307775314|gb|EFO34520.1| signal peptidase II [Roseibium sp. TrichSKD4]
          Length = 176

 Score = 97.0 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 27/101 (26%), Positives = 45/101 (44%), Gaps = 2/101 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S++   +L  + ++    +               +   LI  GALGN  D   +G V+D+
Sbjct: 78  SDLGRWLLAGLTVVATIAL--WIWSVRTLDKFVALALALIIGGALGNGFDRIYHGAVVDF 135

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
           I  H  T+S+ VFNLAD++I  G   +++D          K
Sbjct: 136 IHFHVGTFSWYVFNLADVWIVAGVIGLLFDSFFRSPNSAAK 176


>gi|313496979|gb|ADR58345.1| LspA [Pseudomonas putida BIRD-1]
          Length = 171

 Score = 97.0 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 23/99 (23%), Positives = 50/99 (50%), Gaps = 1/99 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +     +   I +++ A +    K+  + ++   +   L+  GA+GN+ D  + G+V+D+
Sbjct: 68  AGWQRWLFALIAVVVSAVLVVWLKRLGRNETWLAVALALVLGGAIGNLYDRIVLGHVVDF 127

Query: 63  IMIHTQTWS-FAVFNLADLFISIGTCIIIYDDIILQHRQ 100
           I++H Q    F  FN+AD  I++G  ++  D    +  +
Sbjct: 128 ILVHWQNRHYFPAFNVADSAITVGAVMLALDMFKSKKSE 166


>gi|167031666|ref|YP_001666897.1| lipoprotein signal peptidase [Pseudomonas putida GB-1]
 gi|166858154|gb|ABY96561.1| lipoprotein signal peptidase [Pseudomonas putida GB-1]
          Length = 171

 Score = 97.0 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 23/99 (23%), Positives = 50/99 (50%), Gaps = 1/99 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +     +   I +++ A +    K+  + ++   +   L+  GA+GN+ D  + G+V+D+
Sbjct: 68  AGWQRWLFALIAVVVSAVLVVWLKRLGRNETWLAVALALVLGGAIGNLYDRIVLGHVVDF 127

Query: 63  IMIHTQTWS-FAVFNLADLFISIGTCIIIYDDIILQHRQ 100
           I++H Q    F  FN+AD  I++G  ++  D    +  +
Sbjct: 128 ILVHWQNRHYFPAFNVADSAITVGAVMLALDMFKSKKSE 166


>gi|91784673|ref|YP_559879.1| signal peptidase II [Burkholderia xenovorans LB400]
 gi|91688627|gb|ABE31827.1| signal peptidase II, Aspartic peptidase, MEROPS family A08
           [Burkholderia xenovorans LB400]
          Length = 173

 Score = 97.0 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 24/98 (24%), Positives = 48/98 (48%), Gaps = 2/98 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + I +++  F+  +  +N        I Y LI  GA+GN++D    GYV+D  
Sbjct: 67  GWQRYFFIGIAVVVSIFLIKLILENR--HKGEAIAYSLILGGAMGNLIDRVFRGYVVDSF 124

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
             + + W +  FNLAD+ I +G  + +   ++ ++ ++
Sbjct: 125 DFYWRDWHWPAFNLADIAIVLGALLFVSSSLLGKNERE 162


>gi|240138913|ref|YP_002963388.1| Lipoprotein signal peptidase (Prolipoprotein signal peptidase)
           (Signal peptidase II) (SPase II) [Methylobacterium
           extorquens AM1]
 gi|240008885|gb|ACS40111.1| Lipoprotein signal peptidase (Prolipoprotein signal peptidase)
           (Signal peptidase II) (SPase II) [Methylobacterium
           extorquens AM1]
          Length = 171

 Score = 97.0 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 46/96 (47%), Gaps = 2/96 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
            +   +LV++ +     +    ++      +  +   LI  GALGN +D   YG V D++
Sbjct: 63  GLGRWLLVAVSLAAAIGLSVWMRR--AGSRLLAVALGLIVGGALGNAIDRAAYGAVFDFV 120

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
            +H  TWS+ VFN+AD  I  G   +I D +    R
Sbjct: 121 HLHAGTWSWYVFNVADAAIVAGVVGLILDSLRPAPR 156


>gi|325577277|ref|ZP_08147761.1| signal peptidase II [Haemophilus parainfluenzae ATCC 33392]
 gi|325160859|gb|EGC72980.1| signal peptidase II [Haemophilus parainfluenzae ATCC 33392]
          Length = 163

 Score = 97.0 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 27/100 (27%), Positives = 46/100 (46%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + + I I   + +  KKN   + + +  Y LI  GAL N+VD    G+V+D++
Sbjct: 64  GWQKYFFIVLAIGISLMLAYFMKKNSAEQKLQNSAYALIIGGALANMVDRAYNGFVVDFL 123

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
             +     + VFN+AD+ I IG  ++  D      +   K
Sbjct: 124 DFYWDIHHYPVFNVADIAICIGAGLLALDAFKGDKKSGQK 163


>gi|188581533|ref|YP_001924978.1| lipoprotein signal peptidase [Methylobacterium populi BJ001]
 gi|179345031|gb|ACB80443.1| lipoprotein signal peptidase [Methylobacterium populi BJ001]
          Length = 171

 Score = 97.0 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 27/102 (26%), Positives = 46/102 (45%), Gaps = 5/102 (4%)

Query: 1   MLS---NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYG 57
           M      +   +LV++ +     +    ++      +  +   LI  GALGN +D   YG
Sbjct: 57  MFQQEGGLGRWLLVAVSLAAALGLSLWMRR--AGSRLLAVALGLIVGGALGNAIDRAAYG 114

Query: 58  YVIDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
            V D++ +H   WS+ VFN+AD  I  G   ++ D +    R
Sbjct: 115 AVFDFVHLHAGGWSWYVFNVADAAIVAGVVGLLIDSLRPTGR 156


>gi|237814619|ref|ZP_04593617.1| signal peptidase II [Brucella abortus str. 2308 A]
 gi|260546423|ref|ZP_05822163.1| lipoprotein signal peptidase [Brucella abortus NCTC 8038]
 gi|297247541|ref|ZP_06931259.1| signal peptidase II [Brucella abortus bv. 5 str. B3196]
 gi|237789456|gb|EEP63666.1| signal peptidase II [Brucella abortus str. 2308 A]
 gi|260096530|gb|EEW80406.1| lipoprotein signal peptidase [Brucella abortus NCTC 8038]
 gi|297174710|gb|EFH34057.1| signal peptidase II [Brucella abortus bv. 5 str. B3196]
          Length = 175

 Score = 97.0 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 40/101 (39%), Positives = 67/101 (66%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           ML+ +    L++I + +IAF+ ++W  N   +     G+ L+  GA+GN++D  ++GYV+
Sbjct: 72  MLAWLHDGGLIAITLAVIAFVLYLWWTNAPERVFARYGFALVIGGAIGNLIDRVMHGYVV 131

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
           DY++ H  TWSFAVFNLAD FI+IG  +II ++ +   R++
Sbjct: 132 DYVLFHLPTWSFAVFNLADAFITIGAGLIILEEFLGWRRER 172


>gi|104783645|ref|YP_610143.1| lipoprotein signal peptidase [Pseudomonas entomophila L48]
 gi|95112632|emb|CAK17360.1| prolipoprotein signal peptidase (Signal peptidase II.) [Pseudomonas
           entomophila L48]
          Length = 171

 Score = 97.0 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 26/100 (26%), Positives = 51/100 (51%), Gaps = 1/100 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S     +   I +++ A +    K+  + ++   +   L+  GALGN+ D  + G+V+D+
Sbjct: 68  SGWQRWLFAVIAVVVSAVLVVWLKRLGRDETWLAVALALVLGGALGNLYDRVVLGHVVDF 127

Query: 63  IMIHTQTWS-FAVFNLADLFISIGTCIIIYDDIILQHRQK 101
           I++H Q    F  FNLAD  I++G  ++  D    +  ++
Sbjct: 128 ILVHWQNRHYFPAFNLADSAITVGAVMLALDMFKSKKSEE 167


>gi|83594297|ref|YP_428049.1| lipoprotein signal peptidase [Rhodospirillum rubrum ATCC 11170]
 gi|83577211|gb|ABC23762.1| signal peptidase II. Aspartic peptidase. MEROPS family A08
           [Rhodospirillum rubrum ATCC 11170]
          Length = 160

 Score = 97.0 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 50/94 (53%), Gaps = 2/94 (2%)

Query: 5   VSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIM 64
            +  IL ++ ++I   + +  ++         +   LI  GA+GNV+D  ++G V+D++ 
Sbjct: 60  WNAAILSALALVIAGSLTWWLRR--AETRWQRLALPLIIGGAIGNVIDRLIHGAVVDFVD 117

Query: 65  IHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
           +    + +  FN+AD  I++G  +++ D ++ + 
Sbjct: 118 LSIAGYHWPAFNVADAAITVGAILLLIDTLVHRP 151


>gi|17988082|ref|NP_540716.1| lipoprotein signal peptidase [Brucella melitensis bv. 1 str. 16M]
 gi|17983832|gb|AAL52980.1| lipoprotein signal peptidase [Brucella melitensis bv. 1 str. 16M]
          Length = 171

 Score = 97.0 bits (241), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 40/101 (39%), Positives = 67/101 (66%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           ML+ +    L++I + +IAF+ ++W  N   +     G+ L+  GA+GN++D  ++GYV+
Sbjct: 68  MLAWLHDGGLIAITLAVIAFVLYLWWTNAPERVFARYGFALVIGGAIGNLIDRVMHGYVV 127

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
           DY++ H  TWSFAVFNLAD FI+IG  +II ++ +   R++
Sbjct: 128 DYVLFHLPTWSFAVFNLADAFITIGAGLIILEEFLGWRRER 168


>gi|298369538|ref|ZP_06980855.1| signal peptidase II [Neisseria sp. oral taxon 014 str. F0314]
 gi|298282095|gb|EFI23583.1| signal peptidase II [Neisseria sp. oral taxon 014 str. F0314]
          Length = 177

 Score = 96.6 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 26/105 (24%), Positives = 52/105 (49%), Gaps = 1/105 (0%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + +  +I  ++     ++   +    IG  +I  GA+GNV+D  LYG+V+D++
Sbjct: 74  GWQKFFFLVLAAVISLYLARAIWRDDFGRW-GKIGAAMIIGGAVGNVIDRLLYGHVVDFL 132

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDFPQ 108
           + + Q W +  FN+AD FI +G  +++ D +  +   +      Q
Sbjct: 133 LFYWQDWFYPAFNIADSFICVGAVLLVVDGLKNKKPSENGNKEKQ 177


>gi|303257731|ref|ZP_07343743.1| signal peptidase II [Burkholderiales bacterium 1_1_47]
 gi|331000984|ref|ZP_08324620.1| signal peptidase II [Parasutterella excrementihominis YIT 11859]
 gi|302859701|gb|EFL82780.1| signal peptidase II [Burkholderiales bacterium 1_1_47]
 gi|329569759|gb|EGG51523.1| signal peptidase II [Parasutterella excrementihominis YIT 11859]
          Length = 167

 Score = 96.6 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 23/96 (23%), Positives = 45/96 (46%), Gaps = 1/96 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +   + I++   I  I  +N  ++    +G  L+ +GALGN  D    G V+D++
Sbjct: 73  GWQRPLFAGLAIVVSLVICVIIARN-SSRKFLCLGLALVLSGALGNAWDRFTIGVVVDFL 131

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
             H  ++ +  FN+AD+ I  G  I++  +   +  
Sbjct: 132 DFHVGSYHWPAFNVADICICCGAGIVVLAEFFGKKN 167


>gi|156501824|ref|YP_001427890.1| lipoprotein signal peptidase [Francisella tularensis subsp.
           holarctica FTNF002-00]
 gi|156252427|gb|ABU60933.1| signal peptidase II [Francisella tularensis subsp. holarctica
           FTNF002-00]
          Length = 154

 Score = 96.6 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 47/96 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
           +    +  +I ++    + ++  K P T+ I    + LI  GALGN  D    GYVID++
Sbjct: 58  SWQMIMFSTISLIAAIVLIYLIIKQPITEKINLFSFALILGGALGNFYDRAFQGYVIDFL 117

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
             H   + +  FN+AD  I+ G  I+I   +  + +
Sbjct: 118 DFHIGNYHWPSFNIADSAITCGVVILIAASLFTKKK 153


>gi|294634956|ref|ZP_06713474.1| signal peptidase II [Edwardsiella tarda ATCC 23685]
 gi|291091665|gb|EFE24226.1| signal peptidase II [Edwardsiella tarda ATCC 23685]
          Length = 166

 Score = 96.6 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/99 (29%), Positives = 48/99 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   +I I I   +  +  +N  +  + +I Y LI  GALGN+ D   +G+V+D I
Sbjct: 67  GWQRWFFAAIAIAICLALLAMMYRNAASDRLNNIAYALIIGGALGNLFDRLWHGFVVDMI 126

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
             +   W FA FNLAD  I IG  +++ +  +    ++ 
Sbjct: 127 DFYVGNWHFATFNLADTAICIGAALVVLEGFLPARNKEK 165


>gi|254561521|ref|YP_003068616.1| lipoprotein signal peptidase [Methylobacterium extorquens DM4]
 gi|254268799|emb|CAX24760.1| Lipoprotein signal peptidase (Prolipoprotein signal peptidase)
           (Signal peptidase II) (SPase II) [Methylobacterium
           extorquens DM4]
          Length = 171

 Score = 96.6 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 45/96 (46%), Gaps = 2/96 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
            +   +LV + +     +    ++      +  +   LI  GALGN +D   YG V D++
Sbjct: 63  GLGRWLLVGVSLAAAIGLSVWMRR--AGSRLLAVALGLIVGGALGNAIDRAAYGAVFDFV 120

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
            +H  TWS+ VFN+AD  I  G   +I D +    R
Sbjct: 121 HLHAGTWSWYVFNVADAAIVAGVVGLILDSLRPAQR 156


>gi|330892152|gb|EGH24813.1| lipoprotein signal peptidase [Pseudomonas syringae pv. mori str.
           301020]
 gi|330892439|gb|EGH25100.1| lipoprotein signal peptidase [Pseudomonas syringae pv. mori str.
           301020]
          Length = 189

 Score = 96.6 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/91 (29%), Positives = 48/91 (52%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +   + I  I  +     K PK K  +     L+  GA+GN++D  +YG+V+D++
Sbjct: 89  GWQQILFSIVAICAIILLVGWIAKQPKHKIRYTFALALLLGGAIGNLIDRMVYGHVVDFV 148

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDI 94
           ++H Q  +F  FN+AD  I+IG  +++ D  
Sbjct: 149 LLHWQDHNFPNFNIADSAITIGVLLLMLDSF 179


>gi|296331121|ref|ZP_06873595.1| lipoprotein signal peptidase [Bacillus subtilis subsp. spizizenii
           ATCC 6633]
 gi|305674276|ref|YP_003865948.1| lipoprotein signal peptidase [Bacillus subtilis subsp. spizizenii
           str. W23]
 gi|296151765|gb|EFG92640.1| lipoprotein signal peptidase [Bacillus subtilis subsp. spizizenii
           ATCC 6633]
 gi|305412520|gb|ADM37639.1| lipoprotein signal peptidase [Bacillus subtilis subsp. spizizenii
           str. W23]
          Length = 154

 Score = 96.6 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 19/99 (19%), Positives = 47/99 (47%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
                  I   +I  I +  ++  K + +  +   L+  GA+GN +D  +   V+D+I +
Sbjct: 56  QMWFFYLITTAVIIGIVYYIQRYTKGQRLLGVALGLMLGGAIGNFIDRAVRQEVVDFIHV 115

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
               +++ +FN+AD  + +G  ++    ++   ++K + 
Sbjct: 116 IIVNYNYPIFNIADSSLCVGVMLLFIQMLLDSGKKKKEQ 154


>gi|239826542|ref|YP_002949166.1| lipoprotein signal peptidase [Geobacillus sp. WCH70]
 gi|239806835|gb|ACS23900.1| lipoprotein signal peptidase [Geobacillus sp. WCH70]
          Length = 155

 Score = 96.6 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 24/98 (24%), Positives = 47/98 (47%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
              +   I ++++  +    ++ P+ + +F I   L+  GA+GN +D      V+D+I  
Sbjct: 57  QFWLFYLITVIVVIGLVVYIQRLPRGERLFGIALGLMLGGAIGNFIDRVFRKEVVDFIHT 116

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
           +  T+SF VFN+AD  + IG  ++          +K  
Sbjct: 117 YIGTYSFPVFNIADSALCIGVALVFIKTFFAGKTEKEN 154


>gi|58039703|ref|YP_191667.1| lipoprotein signal peptidase [Gluconobacter oxydans 621H]
 gi|58002117|gb|AAW61011.1| Putative lipoprotein signal peptidase [Gluconobacter oxydans 621H]
          Length = 170

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/106 (25%), Positives = 51/106 (48%), Gaps = 5/106 (4%)

Query: 1   MLSNVS---PTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYG 57
           M   +    P I  ++ ++ +  + +   +  +T  +       I  GA+GNV+D   YG
Sbjct: 67  MFGGLGSRGPWIFCAVSLIAVGLLVWTLTRTKRT--LVAASCGAIAGGAIGNVIDRLRYG 124

Query: 58  YVIDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
            V+D++  H   WS+ VFN+AD  I  G  + + D ++ + +   K
Sbjct: 125 AVVDFLHAHAFGWSWYVFNIADSGIVCGVIVWLIDSLLAERQAAAK 170


>gi|311109779|ref|YP_003982631.1| lipoprotein signal peptidase 2 [Achromobacter xylosoxidans A8]
 gi|310764468|gb|ADP19916.1| lipoprotein signal peptidase 2 [Achromobacter xylosoxidans A8]
          Length = 158

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 24/91 (26%), Positives = 44/91 (48%), Gaps = 2/91 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                 L+++ +    ++ ++  +    + +  + Y LI  GALGN  D  + G VIDY+
Sbjct: 63  GWQRWFLLAVAVGAAIWLVWLLAR--PARRLEALAYSLILGGALGNAFDRAIRGQVIDYL 120

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDI 94
             H + W +  FN+AD+ I  G   +I   +
Sbjct: 121 DFHLRQWHWPAFNVADMAIVGGAISLIVASL 151


>gi|162452175|ref|YP_001614542.1| Signal peptidase II [Sorangium cellulosum 'So ce 56']
 gi|161162757|emb|CAN94062.1| Signal peptidase II [Sorangium cellulosum 'So ce 56']
          Length = 196

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 50/97 (51%), Gaps = 1/97 (1%)

Query: 5   VSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIM 64
           +     + + +  I FI  +++K   +++    G  L+  GALGN+VD   YGYVID+I 
Sbjct: 87  IRRPFFLVVSLAAIVFIVSLYRKLHPSQTALRWGLPLVLGGALGNLVDRIRYGYVIDFIQ 146

Query: 65  IHT-QTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
           +    T+ +  FN+AD+ I +G  ++  D       +
Sbjct: 147 VRLTSTFVWPTFNVADIAIVVGVGLMAIDMFSPHRPE 183


>gi|145224224|ref|YP_001134902.1| lipoprotein signal peptidase [Mycobacterium gilvum PYR-GCK]
 gi|145216710|gb|ABP46114.1| lipoprotein signal peptidase [Mycobacterium gilvum PYR-GCK]
          Length = 272

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 20/95 (21%), Positives = 43/95 (45%), Gaps = 12/95 (12%)

Query: 7   PTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYG------YVI 60
             +L  +   ++  I ++ ++       + +G  +I  GALGN+VD           +V+
Sbjct: 93  TWVLTLVATGVVIGIVWMGRRL--VSPWWALGLGMILGGALGNLVDRFFRSPGPLRGHVV 150

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDII 95
           D++ I      + VFN+AD  +  G  +++   + 
Sbjct: 151 DFLSIGW----WPVFNVADPAVVGGAILLVVLSLF 181


>gi|126173299|ref|YP_001049448.1| lipoprotein signal peptidase [Shewanella baltica OS155]
 gi|152999656|ref|YP_001365337.1| lipoprotein signal peptidase [Shewanella baltica OS185]
 gi|217974390|ref|YP_002359141.1| lipoprotein signal peptidase [Shewanella baltica OS223]
 gi|166232876|sp|A3D1G6|LSPA_SHEB5 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|166232877|sp|A6WKD5|LSPA_SHEB8 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|254810454|sp|B8EFC6|LSPA_SHEB2 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|125996504|gb|ABN60579.1| signal peptidase II. Aspartic peptidase. MEROPS family A08
           [Shewanella baltica OS155]
 gi|151364274|gb|ABS07274.1| lipoprotein signal peptidase [Shewanella baltica OS185]
 gi|217499525|gb|ACK47718.1| lipoprotein signal peptidase [Shewanella baltica OS223]
          Length = 171

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 23/102 (22%), Positives = 46/102 (45%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +   + +     +    ++   +    ++ Y L+  GALGN+VD  ++G+V+D+I
Sbjct: 66  GWQRWLFTIVAVGFSTLLTVWLRRQSASLLKLNLAYTLVIGGALGNLVDRLMHGFVVDFI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
                   +  FN+AD  I IG  +II+D  +    +    +
Sbjct: 126 DFFWAKSHYPAFNIADSAICIGAVLIIWDAFLSGKSETDSAE 167


>gi|325291776|ref|YP_004277640.1| Lipoprotein signal peptidase [Agrobacterium sp. H13-3]
 gi|325059629|gb|ADY63320.1| Lipoprotein signal peptidase [Agrobacterium sp. H13-3]
          Length = 162

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 43/102 (42%), Positives = 67/102 (65%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           ML+++    +VS+R++I+ F+ ++W+K    ++   +G+  I  GA GN++D   YG+VI
Sbjct: 61  MLADMHGWFIVSMRLVIVVFVLWLWRKTAADRTFAHLGFAFIIAGAAGNLLDRFFYGHVI 120

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           DYI+ HT TWSFAVFNLAD FI+IG   +I D+ +     K 
Sbjct: 121 DYILFHTDTWSFAVFNLADTFITIGAGCVILDEFLHARAAKK 162


>gi|296137627|ref|YP_003644868.1| lipoprotein signal peptidase [Thiomonas intermedia K12]
 gi|295797749|gb|ADG32538.1| lipoprotein signal peptidase [Thiomonas intermedia K12]
          Length = 363

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 48/96 (50%), Gaps = 2/96 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  +++ +++ A++  +  +      +  +GY LI  GALGNV D  L G V+D++
Sbjct: 257 GWQRYFFITLGLVVSAWLGRMLCQQR--PRLEAMGYSLILGGALGNVADRMLRGQVVDFL 314

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
             H +   +  FNLAD+ I+ G  ++I      + R
Sbjct: 315 DFHWRLAHWPAFNLADVAITSGAALLIMQMQTREKR 350


>gi|115373487|ref|ZP_01460784.1| signal peptidase II [Stigmatella aurantiaca DW4/3-1]
 gi|310825338|ref|YP_003957696.1| signal peptidase II [Stigmatella aurantiaca DW4/3-1]
 gi|115369493|gb|EAU68431.1| signal peptidase II [Stigmatella aurantiaca DW4/3-1]
 gi|309398410|gb|ADO75869.1| Signal peptidase II [Stigmatella aurantiaca DW4/3-1]
          Length = 201

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/106 (25%), Positives = 47/106 (44%), Gaps = 8/106 (7%)

Query: 1   MLSNVSP----TILVSIRILIIAFIFFIWKKNPKTK---SIFDIGYILITTGALGNVVDH 53
           M  ++ P     +   + I  +  I + + K   T         G  L+  GALGN +D 
Sbjct: 88  MFRSLPPSTRGPLFHVVSIGAVLLIGYYFTKLSGTDPAEKWALWGLSLVLGGALGNYIDR 147

Query: 54  CLYGYVIDYIMIHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQH 98
              G+V+D+I  H      +  FN+AD+ I +G  ++I D  + + 
Sbjct: 148 IARGFVVDFIQAHWMDKAYWPSFNVADMAICVGVGLLILDAFVRKE 193


>gi|85711062|ref|ZP_01042122.1| Lipoprotein signal peptidase [Idiomarina baltica OS145]
 gi|85694975|gb|EAQ32913.1| Lipoprotein signal peptidase [Idiomarina baltica OS145]
          Length = 170

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 24/95 (25%), Positives = 43/95 (45%), Gaps = 2/95 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + I + +  F+  +  +N        I Y LI  GA+GN++D    GYV+D  
Sbjct: 67  GWQRYFFIGIAVAVSIFLIKLILENR--HKGEAIAYSLILGGAMGNLIDRVFRGYVVDSF 124

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
             + + W +  FNLAD+ I +G  + +    + + 
Sbjct: 125 DFYWRDWHWPAFNLADIAIVLGALLFVSGSFLGKK 159


>gi|148545895|ref|YP_001265997.1| lipoprotein signal peptidase [Pseudomonas putida F1]
 gi|325272200|ref|ZP_08138623.1| lipoprotein signal peptidase [Pseudomonas sp. TJI-51]
 gi|32171426|sp|Q88Q91|LSPA_PSEPK RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|148509953|gb|ABQ76813.1| lipoprotein signal peptidase [Pseudomonas putida F1]
 gi|324102666|gb|EGC00090.1| lipoprotein signal peptidase [Pseudomonas sp. TJI-51]
          Length = 171

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 23/99 (23%), Positives = 50/99 (50%), Gaps = 1/99 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +     +   I +++ A +    K+  + ++   +   L+  GA+GN+ D  + G+V+D+
Sbjct: 68  AGWQRWLFALIAVVVSAVLVVWLKRLGRNETWLAVALALVLGGAIGNLYDRIVLGHVVDF 127

Query: 63  IMIHTQTWS-FAVFNLADLFISIGTCIIIYDDIILQHRQ 100
           I++H Q    F  FN+AD  I++G  ++  D    +  +
Sbjct: 128 ILVHWQNRHYFPAFNVADSAITVGAVMLALDMFKSKKSE 166


>gi|294851548|ref|ZP_06792221.1| signal peptidase II [Brucella sp. NVSL 07-0026]
 gi|294820137|gb|EFG37136.1| signal peptidase II [Brucella sp. NVSL 07-0026]
          Length = 175

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 40/101 (39%), Positives = 68/101 (67%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           ML+ +    L++I + +IAF+ ++W  N   +     G+ L+ +GA+GN++D  ++GYV+
Sbjct: 72  MLAWLHDGGLIAITLAVIAFVLYLWWTNAPERVFARYGFALVISGAIGNLIDRVMHGYVV 131

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
           DY++ H  TWSFAVFNLAD FI+IG  +II ++ +   R++
Sbjct: 132 DYVLFHLPTWSFAVFNLADAFITIGAGLIILEEFLGWRRER 172


>gi|319778239|ref|YP_004129152.1| Lipoprotein signal peptidase [Taylorella equigenitalis MCE9]
 gi|317108263|gb|ADU91009.1| Lipoprotein signal peptidase [Taylorella equigenitalis MCE9]
          Length = 184

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 30/107 (28%), Positives = 57/107 (53%), Gaps = 6/107 (5%)

Query: 1   MLS---NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYG 57
           M S        + + +   + A++ ++ +KN        I   LI  GALGN +D  +YG
Sbjct: 73  MFSNAGGWQKYLFLGLAFGVSAWLIYMIRKNV-LDKFACISMSLIIAGALGNAIDRIVYG 131

Query: 58  YVIDYIMIHTQTWSF--AVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           YV+D+++ +   W+F    FN+AD  I+IG  ++I+++  L  +++ 
Sbjct: 132 YVVDFLLFYWDDWNFYYPAFNIADSCITIGVILLIFNEFFLSRKKRE 178


>gi|16078609|ref|NP_389428.1| lipoprotein signal peptidase [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|221309419|ref|ZP_03591266.1| lipoprotein signal peptidase [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|221313744|ref|ZP_03595549.1| lipoprotein signal peptidase [Bacillus subtilis subsp. subtilis
           str. NCIB 3610]
 gi|221318668|ref|ZP_03599962.1| lipoprotein signal peptidase [Bacillus subtilis subsp. subtilis
           str. JH642]
 gi|221322941|ref|ZP_03604235.1| lipoprotein signal peptidase [Bacillus subtilis subsp. subtilis
           str. SMY]
 gi|321315310|ref|YP_004207597.1| lipoprotein signal peptidase [Bacillus subtilis BSn5]
 gi|2497629|sp|Q45479|LSPA_BACSU RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|1373156|gb|AAB57766.1| SPase II [Bacillus subtilis subsp. subtilis str. 168]
 gi|2633918|emb|CAB13419.1| signal peptidase II [Bacillus subtilis subsp. subtilis str. 168]
 gi|320021584|gb|ADV96570.1| lipoprotein signal peptidase [Bacillus subtilis BSn5]
          Length = 154

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 19/99 (19%), Positives = 47/99 (47%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
                  I   +I  I +  ++  K + +  +   L+  GA+GN +D  +   V+D+I +
Sbjct: 56  QMWFFYLITTAVIIGIVYYIQRYTKGQRLLGVALGLMLGGAIGNFIDRAVRQEVVDFIHV 115

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
               +++ +FN+AD  + +G  ++    ++   ++K + 
Sbjct: 116 IIVNYNYPIFNIADSSLCVGVMLLFIQMLLDSGKKKKEQ 154


>gi|160874277|ref|YP_001553593.1| lipoprotein signal peptidase [Shewanella baltica OS195]
 gi|304412577|ref|ZP_07394182.1| lipoprotein signal peptidase [Shewanella baltica OS183]
 gi|307303593|ref|ZP_07583346.1| lipoprotein signal peptidase [Shewanella baltica BA175]
 gi|189028665|sp|A9L4U8|LSPA_SHEB9 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|160859799|gb|ABX48333.1| lipoprotein signal peptidase [Shewanella baltica OS195]
 gi|304349053|gb|EFM13466.1| lipoprotein signal peptidase [Shewanella baltica OS183]
 gi|306912491|gb|EFN42914.1| lipoprotein signal peptidase [Shewanella baltica BA175]
 gi|315266510|gb|ADT93363.1| lipoprotein signal peptidase [Shewanella baltica OS678]
          Length = 171

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 24/102 (23%), Positives = 46/102 (45%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +   + +     +    +K   +    ++ Y L+  GALGN+VD  ++G+V+D+I
Sbjct: 66  GWQRWLFTIVAVGFSTLLTVWLRKQSASLLKLNLAYTLVIGGALGNLVDRLMHGFVVDFI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
                   +  FN+AD  I IG  +II+D  +    +    +
Sbjct: 126 DFFWAKSHYPAFNIADSAICIGAVLIIWDAFLSGKSETDSAE 167


>gi|46580337|ref|YP_011145.1| lipoprotein signal peptidase [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120602285|ref|YP_966685.1| lipoprotein signal peptidase [Desulfovibrio vulgaris DP4]
 gi|81830419|sp|Q72AR4|LSPA_DESVH RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|166232864|sp|A1VCU2|LSPA_DESVV RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|46449754|gb|AAS96404.1| lipoprotein signal peptidase [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120562514|gb|ABM28258.1| signal peptidase II, Aspartic peptidase, MEROPS family A08
           [Desulfovibrio vulgaris DP4]
 gi|311233684|gb|ADP86538.1| lipoprotein signal peptidase [Desulfovibrio vulgaris RCH1]
          Length = 165

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 23/101 (22%), Positives = 44/101 (43%), Gaps = 1/101 (0%)

Query: 5   VSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIM 64
               + +   +L + +      +  K + +    + LI  GALGN+VD   Y  V+D++ 
Sbjct: 66  WQFWLFLVATVLAV-WAILSLTRASKNEPVLYTAFGLIMGGALGNLVDRIRYRAVVDFLD 124

Query: 65  IHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
            +   W +  FN+AD+ I IG  +           ++G  +
Sbjct: 125 FYWGEWHWPAFNVADIAICIGAFLAFVAMYRQPSPERGNKE 165


>gi|163757827|ref|ZP_02164916.1| probable lipoprotein signal peptidase transmembrane [Hoeflea
           phototrophica DFL-43]
 gi|162285329|gb|EDQ35611.1| probable lipoprotein signal peptidase transmembrane [Hoeflea
           phototrophica DFL-43]
          Length = 167

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 47/102 (46%), Positives = 72/102 (70%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           +L ++  T L+ +  ++I F+ F+W + P  +SI  +G+ LI  GALGN+VD  +YG+V+
Sbjct: 60  LLKDLPDTGLLMLTAMVIVFVIFLWWRTPSDRSIAHLGFALIIGGALGNLVDRAIYGHVV 119

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           DYI+ +T TWSFAVFNLAD FISIG  +I+ D++I   R++ 
Sbjct: 120 DYILFYTSTWSFAVFNLADSFISIGAGLIVLDEVIAALRERK 161


>gi|241114346|ref|YP_002973821.1| lipoprotein signal peptidase [Ralstonia pickettii 12D]
 gi|309783167|ref|ZP_07677883.1| signal peptidase II [Ralstonia sp. 5_7_47FAA]
 gi|240868919|gb|ACS66577.1| lipoprotein signal peptidase [Ralstonia pickettii 12D]
 gi|308918045|gb|EFP63726.1| signal peptidase II [Ralstonia sp. 5_7_47FAA]
          Length = 357

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 22/92 (23%), Positives = 44/92 (47%), Gaps = 2/92 (2%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +     + + + + + A++    +K  +   +  + Y LI  GA GN+ D    G V+D+
Sbjct: 255 AGWQRYLFIGLGLAVSAWLAHTLRK--RLSRMEALAYSLILGGAAGNLTDRVWRGQVVDF 312

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDI 94
           + +H     +  FNLAD+ IS G   ++   +
Sbjct: 313 LDLHWMQLHWPAFNLADMAISAGAASLMLAVL 344


>gi|254718365|ref|ZP_05180176.1| signal peptidase II [Brucella sp. 83/13]
 gi|265983326|ref|ZP_06096061.1| lipoprotein signal peptidase [Brucella sp. 83/13]
 gi|306839596|ref|ZP_07472400.1| signal peptidase II [Brucella sp. NF 2653]
 gi|264661918|gb|EEZ32179.1| lipoprotein signal peptidase [Brucella sp. 83/13]
 gi|306405294|gb|EFM61569.1| signal peptidase II [Brucella sp. NF 2653]
          Length = 160

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 40/101 (39%), Positives = 67/101 (66%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           ML+ +    L++I + +IAF+ ++W  N   +     G+ L+  GA+GN++D  ++GYV+
Sbjct: 57  MLAWLHDGGLIAITLAVIAFVLYLWWTNAPERVFARYGFALVIGGAIGNLIDRVMHGYVV 116

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
           DY++ H  TWSFAVFNLAD FI+IG  +II ++ +   R++
Sbjct: 117 DYVLFHLPTWSFAVFNLADAFITIGAGLIILEEFLGWRRER 157


>gi|221067093|ref|ZP_03543198.1| lipoprotein signal peptidase [Comamonas testosteroni KF-1]
 gi|220712116|gb|EED67484.1| lipoprotein signal peptidase [Comamonas testosteroni KF-1]
          Length = 168

 Score = 95.8 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 28/104 (26%), Positives = 45/104 (43%), Gaps = 1/104 (0%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  V+I     A +F     + KT +   +GY  I  G LGNV+D   +G V+D++
Sbjct: 64  GWQRGFFVAIGFAASA-LFTWLIASEKTPAPEAVGYAAILGGGLGNVLDRVRHGAVVDWL 122

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDFP 107
             H   W +  FN AD+ I++G  +++        R       P
Sbjct: 123 DFHWGDWHWPAFNAADIGITLGAGVLLIAAFRGHERNGADSHTP 166


>gi|260576049|ref|ZP_05844043.1| lipoprotein signal peptidase [Rhodobacter sp. SW2]
 gi|259021748|gb|EEW25050.1| lipoprotein signal peptidase [Rhodobacter sp. SW2]
          Length = 161

 Score = 95.8 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 28/108 (25%), Positives = 53/108 (49%), Gaps = 5/108 (4%)

Query: 1   MLSNV---SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYG 57
           MLS V    P ++ ++   +      +  +      +  +G+  +T GALGN+VD    G
Sbjct: 54  MLSGVMAGRPLLMAALTGALTLIFAAMAFRTRAA--LERVGFAFVTGGALGNIVDRLRQG 111

Query: 58  YVIDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
            V D++ ++ + W +  FN+AD+ I++G   II   +    R++   D
Sbjct: 112 AVTDFLDLYWRDWHWPTFNVADIAITVGAACIIAASVPACRRKETAHD 159


>gi|222053499|ref|YP_002535861.1| lipoprotein signal peptidase [Geobacter sp. FRC-32]
 gi|221562788|gb|ACM18760.1| lipoprotein signal peptidase [Geobacter sp. FRC-32]
          Length = 163

 Score = 95.8 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 25/100 (25%), Positives = 48/100 (48%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
           +      + + ++ I  I  +  +  + +    +   LI  GALGN++D    G VID++
Sbjct: 62  SYRIPFFILVSVVAILVILSVVYRLRQDQKFAVVSLALIFAGALGNLIDRVRLGEVIDFL 121

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
            +H     +  FN+AD  I +G  ++  D  + + RQK +
Sbjct: 122 DVHWYRHHWPAFNVADSAICVGVFLLAVDMYLEERRQKKQ 161


>gi|83955782|ref|ZP_00964324.1| Peptidase A8, signal peptidase II [Sulfitobacter sp. NAS-14.1]
 gi|83839787|gb|EAP78964.1| Peptidase A8, signal peptidase II [Sulfitobacter sp. NAS-14.1]
          Length = 169

 Score = 95.8 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 23/88 (26%), Positives = 38/88 (43%), Gaps = 4/88 (4%)

Query: 23  FIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQTWSFAVFNLADLFI 82
               K P    +      LI  GALGN++D   Y  V D++  H  ++ +  FNLAD+ I
Sbjct: 78  IWLWKAP--DGLTGAALGLIIGGALGNILDRLRYQAVPDFLDFHYGSYHWPSFNLADVAI 135

Query: 83  SIGTCIIIYDDIILQH--RQKGKIDFPQ 108
             G  ++ +D         +  + D  +
Sbjct: 136 FCGAALLFWDSFRTSKVRPENREQDNRK 163


>gi|114327129|ref|YP_744286.1| lipoprotein signal peptidase [Granulibacter bethesdensis CGDNIH1]
 gi|114315303|gb|ABI61363.1| lipoprotein signal peptidase [Granulibacter bethesdensis CGDNIH1]
          Length = 184

 Score = 95.8 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 31/102 (30%), Positives = 52/102 (50%), Gaps = 2/102 (1%)

Query: 2   LSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVID 61
                  IL    ILI+A +    ++      +  I   +I  GA+GNV+D   +G V+D
Sbjct: 81  FGPAGIWILGGGAILIVAGLLLWMRR--AENRLIAIALGMIGGGAIGNVIDRFRFGAVVD 138

Query: 62  YIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
           +I  H    S+ VFN+AD  I IG  ++I D +I + +++ +
Sbjct: 139 FIHAHVGELSWFVFNVADAAIVIGVALLIIDTLIGRTQRETR 180


>gi|39998225|ref|NP_954176.1| lipoprotein signal peptidase [Geobacter sulfurreducens PCA]
 gi|81831953|sp|Q747Y0|LSPA_GEOSL RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|39985171|gb|AAR36526.1| lipoprotein signal peptidase [Geobacter sulfurreducens PCA]
 gi|298507161|gb|ADI85884.1| lipoprotein signal peptidase [Geobacter sulfurreducens KN400]
          Length = 160

 Score = 95.8 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 24/93 (25%), Positives = 49/93 (52%)

Query: 8   TILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHT 67
              + + ++ +  I   ++K    + +      LI +GALGN++D    G VID++ ++ 
Sbjct: 66  PFFILVSVVALGVIAVTFRKLRDDQHLAAAALALIFSGALGNLIDRVRLGEVIDFLDVYW 125

Query: 68  QTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
           +T+ +  FN+AD  I +G  ++  D I  + R+
Sbjct: 126 KTYHWPAFNVADSAICVGVALLAVDMIREERRK 158


>gi|54293913|ref|YP_126328.1| lipoprotein signal peptidase [Legionella pneumophila str. Lens]
 gi|53753745|emb|CAH15203.1| Lipoprotein signal peptidase [Legionella pneumophila str. Lens]
          Length = 154

 Score = 95.8 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/95 (30%), Positives = 48/95 (50%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
           +           L+   +     + P+      +G  LI  GA+GN++D  L+GYVID+I
Sbjct: 60  DWHRWFFAGFSFLMSIILVIWLVRTPEQARFQSVGISLILGGAIGNLIDRGLHGYVIDFI 119

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
            ++ +   FA FN+AD  I IG  I++ D +I + 
Sbjct: 120 DVYYKHHHFATFNVADSAICIGAAILVLDLLIRRE 154


>gi|299535888|ref|ZP_07049208.1| signal peptidase II [Lysinibacillus fusiformis ZC1]
 gi|298728640|gb|EFI69195.1| signal peptidase II [Lysinibacillus fusiformis ZC1]
          Length = 159

 Score = 95.8 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 27/106 (25%), Positives = 55/106 (51%), Gaps = 3/106 (2%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           ML      +   + + +I  I + + K  K K +F +G +L+  GA+GN +D    G V+
Sbjct: 53  MLEG-QMWLFSIVTVAVICAIVYFYHKEAKGKPVFQVGLMLLLGGAVGNFIDRLFRGEVV 111

Query: 61  DYIM--IHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
           D++   I    + F +FN+AD  ++I   +++   I+   ++K ++
Sbjct: 112 DFVDVLIPIINYDFPIFNVADAALTIAVVVLMIGLIMEDKKEKKQV 157


>gi|332188029|ref|ZP_08389760.1| signal peptidase II [Sphingomonas sp. S17]
 gi|332011877|gb|EGI53951.1| signal peptidase II [Sphingomonas sp. S17]
          Length = 176

 Score = 95.8 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 31/106 (29%), Positives = 49/106 (46%), Gaps = 6/106 (5%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +  +PTILV++ + + A +     K   T     I   +   GAL NVVD   +G V D+
Sbjct: 74  AFANPTILVAVGLALSAVLVVFLVKTEST--FEKIALGMAIGGALANVVDRLRFGAVRDF 131

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDFPQ 108
           I +H   W +  FN AD+FI +G    ++  +     Q+      Q
Sbjct: 132 IDVHLNDWHWPAFNFADVFIVLG----LFSLLFAGREQRRAAAERQ 173


>gi|168998669|ref|YP_001687937.1| lipoprotein signal peptidase [Klebsiella pneumoniae NTUH-K2044]
          Length = 358

 Score = 95.8 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 25/88 (28%), Positives = 44/88 (50%), Gaps = 2/88 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  +++ + + A++  +  +      +  +GY LI  GALGNV D  L G V+D++
Sbjct: 257 GWQRYFFITLGLAVSAWLGRMLCQQR--PRLEAMGYSLILGGALGNVADRVLRGQVVDFL 314

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIY 91
             H +   +  FNLAD+ I+IG   +  
Sbjct: 315 DFHWRLAHWPAFNLADVAITIGALCLFL 342


>gi|297039790|gb|ADH95744.1| putative lipoprotein signal peptidase [Pseudomonas sp. MDB-1]
          Length = 170

 Score = 95.5 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 24/95 (25%), Positives = 45/95 (47%), Gaps = 2/95 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + I +++  F+  +  +N        I Y LI  GA+GN++D    GYV+D  
Sbjct: 67  GWQRYFFIGIAVVVSIFLIKLILENR--HKGEAIAYSLILGGAMGNLIDRVFRGYVVDSF 124

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
             + + W +  FNLAD+ I +G  + +   ++ + 
Sbjct: 125 DFYWRDWHWPAFNLADIAIVLGALLFVSSSLLGKK 159


>gi|167630172|ref|YP_001680671.1| signal peptidase ii [Heliobacterium modesticaldum Ice1]
 gi|167592912|gb|ABZ84660.1| signal peptidase ii [Heliobacterium modesticaldum Ice1]
          Length = 171

 Score = 95.5 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/108 (26%), Positives = 56/108 (51%), Gaps = 5/108 (4%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           ML+N      +++ +L++A I + +++ P+ +    +G  L   GA+GN++D    G VI
Sbjct: 63  MLAN-KTFFFIAVTVLVVAAILYFYRRVPEDQIWLRLGLALQAGGAVGNLIDRFRTGLVI 121

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDFPQ 108
           D+         + VFN+AD  ISIG  +I+   ++    +K  +   +
Sbjct: 122 DFFDFRV----WPVFNVADTAISIGVALIMLSLLLAPDEEKKPVPSSE 165


>gi|54296959|ref|YP_123328.1| lipoprotein signal peptidase [Legionella pneumophila str. Paris]
 gi|53750744|emb|CAH12151.1| Lipoprotein signal peptidase [Legionella pneumophila str. Paris]
          Length = 154

 Score = 95.5 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 28/95 (29%), Positives = 48/95 (50%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
           +           L+   +     + P+      +G  LI  GA+GN++D  ++GYVID+I
Sbjct: 60  DWHRWFFAGFSFLMSIILLIWLVRTPEQARFQSVGISLILGGAIGNLIDRGIHGYVIDFI 119

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
            ++ +   FA FN+AD  I IG  I++ D +I + 
Sbjct: 120 DVYYKHHHFATFNVADSAICIGAAILVLDLLIRRE 154


>gi|90419235|ref|ZP_01227145.1| putative signal peptidase [Aurantimonas manganoxydans SI85-9A1]
 gi|90336172|gb|EAS49913.1| putative signal peptidase [Aurantimonas manganoxydans SI85-9A1]
          Length = 175

 Score = 95.5 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 22/107 (20%), Positives = 50/107 (46%), Gaps = 2/107 (1%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           +  + SP +L++  + ++  +     +      +  I   LI  GAL N++D   +G V 
Sbjct: 67  LFGDTSPWMLMTFTLAMVIGLIIWLMR--AANRLTAIALGLIIGGALANILDRLRHGAVT 124

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDFP 107
           D++  +   + +  FNLAD+ I  G  +++ + +  +   + +   P
Sbjct: 125 DFLDFYVAAYHWPAFNLADVGIVSGVSLLLLESVWPRGEGRVRKADP 171


>gi|222151015|ref|YP_002560169.1| lipoprotein signal peptidase [Macrococcus caseolyticus JCSC5402]
 gi|222120138|dbj|BAH17473.1| lipoprotein signal peptidase [Macrococcus caseolyticus JCSC5402]
          Length = 163

 Score = 95.5 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/102 (28%), Positives = 51/102 (50%), Gaps = 1/102 (0%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           ML N        I I+++  + + + K      +   G +LI  GA+GN +D    G V+
Sbjct: 59  MLQN-QMIFFYIITIIVLIALIYFYYKEAADNLLMQCGLMLIFAGAIGNFIDRLFRGNVV 117

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           D+I      + F +FN+AD  ++IG  I++Y+ +  Q  +K 
Sbjct: 118 DFIDTKIINYDFPIFNVADSCLTIGVFILLYELLFNQKEEKS 159


>gi|38638569|ref|NP_943155.1| lipoprotein signal peptidase [Pseudomonas sp. ND6]
 gi|91777227|ref|YP_552435.1| signal peptidase II [Burkholderia xenovorans LB400]
 gi|91778500|ref|YP_553708.1| signal peptidase II [Burkholderia xenovorans LB400]
 gi|91780440|ref|YP_555647.1| lipoprotein signal peptidase [Burkholderia xenovorans LB400]
 gi|91780903|ref|YP_556110.1| lipoprotein signal peptidase [Burkholderia xenovorans LB400]
 gi|91782918|ref|YP_558124.1| signal peptidase II [Burkholderia xenovorans LB400]
 gi|91784687|ref|YP_559893.1| signal peptidase II [Burkholderia xenovorans LB400]
 gi|220933657|ref|YP_002512556.1| lipoprotein signal peptidase [Thioalkalivibrio sp. HL-EbGR7]
 gi|295697862|ref|YP_003602519.1| Lipoprotein signal peptidase [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|8134556|sp|O52213|LSPA_SERMA RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|2688962|gb|AAC82524.1| LspA [IncL/M plasmid R471a]
 gi|34335357|gb|AAP44255.1| lipoprotein signal peptidase [Pseudomonas sp. ND6]
 gi|91686872|gb|ABE30072.1| signal peptidase II, Aspartic peptidase, MEROPS family A08
           [Burkholderia xenovorans LB400]
 gi|91688641|gb|ABE31841.1| signal peptidase II, Aspartic peptidase, MEROPS family A08
           [Burkholderia xenovorans LB400]
 gi|91689887|gb|ABE33085.1| signal peptidase II, Aspartic peptidase, MEROPS family A08
           [Burkholderia xenovorans LB400]
 gi|91691160|gb|ABE34358.1| signal peptidase II, Aspartic peptidase, MEROPS family A08
           [Burkholderia xenovorans LB400]
 gi|91693100|gb|ABE36297.1| signal peptidase II, Aspartic peptidase, MEROPS family A08
           [Burkholderia xenovorans LB400]
 gi|91693563|gb|ABE36760.1| signal peptidase II, Aspartic peptidase, MEROPS family A08
           [Burkholderia xenovorans LB400]
 gi|219994967|gb|ACL71569.1| lipoprotein signal peptidase [Thioalkalivibrio sp. HL-EbGR7]
 gi|223019533|gb|ACM78476.1| LspA [Pseudomonas stutzeri]
 gi|295059974|gb|ADF64711.1| Lipoprotein signal peptidase [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
          Length = 170

 Score = 95.5 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 24/95 (25%), Positives = 45/95 (47%), Gaps = 2/95 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + I +++  F+  +  +N        I Y LI  GA+GN++D    GYV+D  
Sbjct: 67  GWQRYFFIGIAVVVSIFLIKLILENR--HKGEAIAYSLILGGAMGNLIDRVFRGYVVDSF 124

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
             + + W +  FNLAD+ I +G  + +   ++ + 
Sbjct: 125 DFYWRDWHWPAFNLADIAIVLGALLFVSSSLLGKK 159


>gi|56459742|ref|YP_155023.1| lipoprotein signal peptidase [Idiomarina loihiensis L2TR]
 gi|56178752|gb|AAV81474.1| Lipoprotein signal peptidase [Idiomarina loihiensis L2TR]
          Length = 170

 Score = 95.5 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 24/95 (25%), Positives = 45/95 (47%), Gaps = 2/95 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + I +++  F+  +  +N        I Y LI  GA+GN++D    GYV+D  
Sbjct: 67  GWQRYFFIGIAVVVSIFLIKLILENR--HKGEAIAYSLILGGAMGNLIDRVFRGYVVDSF 124

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
             + + W +  FNLAD+ I +G  + +   ++ + 
Sbjct: 125 DFYWRDWHWPAFNLADIAIVLGALLFVSSSLLGKK 159


>gi|146305989|ref|YP_001186454.1| lipoprotein signal peptidase [Pseudomonas mendocina ymp]
 gi|167008961|sp|A4XQV6|LSPA_PSEMY RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|145574190|gb|ABP83722.1| signal peptidase II, Aspartic peptidase, MEROPS family A08
           [Pseudomonas mendocina ymp]
          Length = 169

 Score = 95.5 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 28/101 (27%), Positives = 52/101 (51%), Gaps = 1/101 (0%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +        +I I++   +    K+  + +++  +   ++  GALGN+ D  + G+V+D+
Sbjct: 66  AGWQRWFFAAIAIVVSVVLVVWLKRLKRHETLLAVALAMVLGGALGNLYDRVVLGHVVDF 125

Query: 63  IMIHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           I++H Q+ W F  FNLAD FI+IG  ++  D        K 
Sbjct: 126 ILVHWQSRWFFPAFNLADTFITIGAILLALDMFKSDKSAKE 166


>gi|323489510|ref|ZP_08094737.1| lipoprotein signal peptidase [Planococcus donghaensis MPA1U2]
 gi|323396641|gb|EGA89460.1| lipoprotein signal peptidase [Planococcus donghaensis MPA1U2]
          Length = 158

 Score = 95.5 bits (237), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 28/107 (26%), Positives = 56/107 (52%), Gaps = 3/107 (2%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           ML      +   I + +I  I + + K+ K + +F +  +++  GA+GN +D    G V+
Sbjct: 53  MLEG-QMWLFAIITVAVIIGILYYFHKHAKGQPLFQLSLMVLLGGAVGNFIDRMFRGEVV 111

Query: 61  DYIM--IHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
           D++   I    + F +FN+AD  ++IG  +++   I  + +QK K+ 
Sbjct: 112 DFVDVLIPVIGYDFPIFNVADAALTIGVVLMVIYIIYDEKQQKKKVS 158


>gi|153002893|ref|YP_001377218.1| lipoprotein signal peptidase [Anaeromyxobacter sp. Fw109-5]
 gi|254810429|sp|A7H688|LSPA_ANADF RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|152026466|gb|ABS24234.1| lipoprotein signal peptidase [Anaeromyxobacter sp. Fw109-5]
          Length = 211

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 22/87 (25%), Positives = 41/87 (47%), Gaps = 3/87 (3%)

Query: 9   ILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQ 68
               + +  +AFI   ++K    +    +   L+ +GA+GN +D    GYVID+I  +  
Sbjct: 101 FFTLVSLGAVAFILHYYRKLRAEQRYLQVALALVLSGAVGNFLDRLARGYVIDFIEWYWW 160

Query: 69  T---WSFAVFNLADLFISIGTCIIIYD 92
                 +  FN+AD  I +G  +++  
Sbjct: 161 NRPDIRWPTFNIADSLIVVGVALLVLH 187


>gi|317050216|ref|YP_004111332.1| lipoprotein signal peptidase [Desulfurispirillum indicum S5]
 gi|316945300|gb|ADU64776.1| lipoprotein signal peptidase [Desulfurispirillum indicum S5]
          Length = 170

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 24/95 (25%), Positives = 45/95 (47%), Gaps = 2/95 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + I +++  F+  +  +N        I Y LI  GA+GN++D    GYV+D  
Sbjct: 67  GWQRYFFIGIAVVVSIFLIKLILENR--HKGETIAYSLILGGAMGNLIDRVFRGYVVDSF 124

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
             + + W +  FNLAD+ I +G  + +   ++ + 
Sbjct: 125 DFYWRDWHWPAFNLADIAIVLGALLFVSSSLLGKK 159


>gi|144898683|emb|CAM75547.1| Lipoprotein signal peptidase [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 171

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 27/99 (27%), Positives = 47/99 (47%), Gaps = 2/99 (2%)

Query: 5   VSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIM 64
            +   L  + I+I+A +    K+      +  +    I  GALGNV+D   +G V D++ 
Sbjct: 75  WNAVALSVLSIVIVAGLLVWLKR--ADNGLMALALGSIIGGALGNVIDRARWGAVADFLD 132

Query: 65  IHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
           +H   W +  FNLAD  I+IG  +++ D +  +      
Sbjct: 133 VHAFGWHWPAFNLADSAITIGAILLVLDSLFTRRNSDKN 171


>gi|315444558|ref|YP_004077437.1| lipoprotein signal peptidase [Mycobacterium sp. Spyr1]
 gi|315262861|gb|ADT99602.1| lipoprotein signal peptidase [Mycobacterium sp. Spyr1]
          Length = 260

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 20/95 (21%), Positives = 43/95 (45%), Gaps = 12/95 (12%)

Query: 7   PTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYG------YVI 60
             +L  +   ++  I ++ ++       + +G  +I  GALGN+VD           +V+
Sbjct: 93  TWVLTLVATGVVIGIVWMGRRL--VSPWWALGLGMILGGALGNLVDRFFRSPGPLRGHVV 150

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDII 95
           D++ I      + VFN+AD  +  G  +++   + 
Sbjct: 151 DFLSIGW----WPVFNVADPAVVGGAILLVVLSLF 181


>gi|148360413|ref|YP_001251620.1| lipoprotein signal peptidase [Legionella pneumophila str. Corby]
 gi|296106521|ref|YP_003618221.1| signal peptidase II [Legionella pneumophila 2300/99 Alcoy]
 gi|148282186|gb|ABQ56274.1| lipoprotein signal peptidase [Legionella pneumophila str. Corby]
 gi|295648422|gb|ADG24269.1| signal peptidase II [Legionella pneumophila 2300/99 Alcoy]
 gi|307609731|emb|CBW99242.1| lipoprotein signal peptidase [Legionella pneumophila 130b]
          Length = 154

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 30/95 (31%), Positives = 48/95 (50%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
           +           L+   +     + P+      +G  LI  GA+GN++D  L+GYVID+I
Sbjct: 60  DWHRWFFAGFSFLMSIILLIWLVRTPEQARFQSVGISLILGGAIGNLIDRGLHGYVIDFI 119

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
            ++ +   FA FNLAD  I IG  I++ D +I + 
Sbjct: 120 DVYYKHHHFATFNLADSAICIGAAILVLDLLIRRE 154


>gi|284799405|ref|ZP_05983899.2| signal peptidase II [Neisseria subflava NJ9703]
 gi|284797763|gb|EFC53110.1| signal peptidase II [Neisseria subflava NJ9703]
          Length = 204

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 23/95 (24%), Positives = 51/95 (53%), Gaps = 1/95 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + + ++I  ++     ++   +    +G  +I  GA+GNVVD  ++G+V+D++
Sbjct: 102 GWQKFFFLGLAVVISLYLARAIWRDEFGRW-GKLGAAMIIGGAIGNVVDRLIHGHVVDFL 160

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
           + + Q W +  FN+AD FI +G   ++ D ++ + 
Sbjct: 161 LFYWQNWFYPAFNIADSFICVGAVCLVIDGLLHKK 195


>gi|229086458|ref|ZP_04218630.1| Lipoprotein signal peptidase [Bacillus cereus Rock3-44]
 gi|228696775|gb|EEL49588.1| Lipoprotein signal peptidase [Bacillus cereus Rock3-44]
          Length = 157

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 48/97 (49%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
                  I I+ + FI    KK  KT  +  +   LI  GA+GN +D      V+D+I +
Sbjct: 61  QMWFFYIITIVFVGFIVVYMKKYAKTDMLLGVSLGLILGGAIGNFIDRVFRQEVVDFIHV 120

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           +  ++++ VFN+AD  + IG  +II   ++   + K 
Sbjct: 121 YIFSYNYPVFNIADSALCIGVVLIIIQTLLEGKKMKE 157


>gi|148266324|ref|YP_001233030.1| lipoprotein signal peptidase [Geobacter uraniireducens Rf4]
 gi|146399824|gb|ABQ28457.1| signal peptidase II, Aspartic peptidase, MEROPS family A08
           [Geobacter uraniireducens Rf4]
          Length = 163

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 27/102 (26%), Positives = 48/102 (47%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
           N      + + ++ +  I  +  K    +    +   LI +GALGN++D    G VID++
Sbjct: 62  NYRIPFFILVSLVAVVVIISVIYKLRPDQKFAALSLSLILSGALGNLIDRVRLGEVIDFL 121

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
             H     +  FN+AD  I +G  ++  D  + + RQK + D
Sbjct: 122 DAHWYEHHWPAFNVADSAICVGVFLLAIDMFLEEQRQKKQKD 163


>gi|18150963|ref|NP_542900.1| putative lipoprotein signal peptidase [Pseudomonas putida]
 gi|120553821|ref|YP_958172.1| lipoprotein signal peptidase [Marinobacter aquaeolei VT8]
 gi|170721508|ref|YP_001749196.1| lipoprotein signal peptidase [Pseudomonas putida W619]
 gi|225023338|ref|ZP_03712530.1| hypothetical protein EIKCOROL_00196 [Eikenella corrodens ATCC
           23834]
 gi|237728543|ref|ZP_04559024.1| lipoprotein signal peptidase [Citrobacter sp. 30_2]
 gi|18077204|emb|CAC86840.1| putative lipoprotein signal peptidase [Pseudomonas putida]
 gi|22773653|gb|AAN05079.1| putative lipoprotein signal peptide-like protein [Pseudomonas
           putida]
 gi|24417803|gb|AAN60473.1| putative lipoprotein signal peptidase LspA [Pseudomonas putida]
 gi|120323670|gb|ABM17985.1| signal peptidase II, Aspartic peptidase, MEROPS family A08
           [Marinobacter aquaeolei VT8]
 gi|126635800|gb|ABO21777.1| putative lipoprotein signal peptidase [Pseudomonas putida]
 gi|169759511|gb|ACA72827.1| lipoprotein signal peptidase [Pseudomonas putida W619]
 gi|224943983|gb|EEG25192.1| hypothetical protein EIKCOROL_00196 [Eikenella corrodens ATCC
           23834]
 gi|226910021|gb|EEH95939.1| lipoprotein signal peptidase [Citrobacter sp. 30_2]
 gi|261402051|gb|ACX80153.1| putative lipoprotein signal peptidase LspA [Stenotrophomonas sp.
           SMSP-1]
 gi|296281101|gb|ADH04815.1| putative lipoprotein signal peptidase [Pseudomonas sp. k9]
 gi|319426940|gb|ADV55014.1| lipoprotein signal peptidase [Shewanella putrefaciens 200]
          Length = 170

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 24/95 (25%), Positives = 45/95 (47%), Gaps = 2/95 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + I +++  F+  +  +N        I Y LI  GA+GN++D    GYV+D  
Sbjct: 67  GWQRYFFIGIAVVVSIFLIKLILENR--HKGEAIAYSLILGGAMGNLIDRVFRGYVVDSF 124

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
             + + W +  FNLAD+ I +G  + +   ++ + 
Sbjct: 125 DFYWRDWHWPAFNLADIAIVLGALLFVSSSLLGKK 159


>gi|56551220|ref|YP_162059.1| lipoprotein signal peptidase [Zymomonas mobilis subsp. mobilis ZM4]
 gi|260753145|ref|YP_003226038.1| lipoprotein signal peptidase [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|56542794|gb|AAV88948.1| lipoprotein signal peptidase [Zymomonas mobilis subsp. mobilis ZM4]
 gi|258552508|gb|ACV75454.1| lipoprotein signal peptidase [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
          Length = 174

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 27/103 (26%), Positives = 47/103 (45%), Gaps = 3/103 (2%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S+V   +LV++   I   +  +  +         +   L+  GA+GN+ D    G V+D+
Sbjct: 73  SDVGRWLLVALTAAIALAVVILILREK--HFSSAMALGLVLGGAIGNITDRIRSGAVVDF 130

Query: 63  IMIHTQTWS-FAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
           + +H   W  F VFN+AD  IS G   +I   +  ++    K 
Sbjct: 131 LDLHFGNWHPFLVFNVADAAISCGVVFLILRSLWSKNEDDNKA 173


>gi|330501956|ref|YP_004378825.1| lipoprotein signal peptidase [Pseudomonas mendocina NK-01]
 gi|328916242|gb|AEB57073.1| lipoprotein signal peptidase [Pseudomonas mendocina NK-01]
          Length = 169

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 28/100 (28%), Positives = 51/100 (51%), Gaps = 1/100 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   +I I++   +    K+  + +++  +   ++  GALGN+ D  + G+V+D+I
Sbjct: 67  GWQRWFFAAIAIVVSVVLVVWLKRLKRHETLLAVALAMVLGGALGNLYDRVVLGHVVDFI 126

Query: 64  MIHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           ++H Q+ W F  FNLAD FI+IG  ++  D        K 
Sbjct: 127 LVHWQSRWFFPAFNLADTFITIGAILLALDMFKSDKSVKE 166


>gi|296117463|ref|ZP_06836050.1| lipoprotein signal peptidase [Gluconacetobacter hansenii ATCC
           23769]
 gi|295975984|gb|EFG82775.1| lipoprotein signal peptidase [Gluconacetobacter hansenii ATCC
           23769]
          Length = 168

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 48/96 (50%), Gaps = 2/96 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
           +    I   + + I+  +     + P  +         I  GA+GNV+D   +G V+D++
Sbjct: 74  SAGRVIFSVVALFIVVLLGLWASRTP--RPWVAGALGAIMGGAVGNVIDRLQFGAVVDFV 131

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
            +H   WS+ VFNLAD  I  G  I+I D+++ + R
Sbjct: 132 HLHAYGWSWPVFNLADAAIDCGVAILIIDNLLDRDR 167


>gi|118590686|ref|ZP_01548087.1| putative lipoprotein signal peptidase [Stappia aggregata IAM 12614]
 gi|118436662|gb|EAV43302.1| putative lipoprotein signal peptidase [Stappia aggregata IAM 12614]
          Length = 177

 Score = 94.7 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 27/101 (26%), Positives = 50/101 (49%), Gaps = 2/101 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S++   +L  + I +   ++    + P    +  +   L+  GA+GN +D   +G V+D+
Sbjct: 79  SDLGRWLLAGVTIAVTIGLWVWSARCPS--RLVALALALVIGGAIGNGIDRLAFGAVVDF 136

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
           +  H  T+S+ VFNLAD++I  G   ++YD          K
Sbjct: 137 VHFHVGTFSWYVFNLADVWIVAGVAGLLYDSFRNGPNSAAK 177


>gi|56460349|ref|YP_155630.1| lipoprotein signal peptidase [Idiomarina loihiensis L2TR]
 gi|85711104|ref|ZP_01042164.1| Lipoprotein signal peptidase [Idiomarina baltica OS145]
 gi|56179359|gb|AAV82081.1| Lipoprotein signal peptidase [Idiomarina loihiensis L2TR]
 gi|85695017|gb|EAQ32955.1| Lipoprotein signal peptidase [Idiomarina baltica OS145]
          Length = 170

 Score = 94.7 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 24/95 (25%), Positives = 43/95 (45%), Gaps = 2/95 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + I + +  F+  +  +N        I Y LI  GA+GN++D    GYV+D  
Sbjct: 67  GWQRYFFIGIAVAVSIFLIKLILENR--HKGEAIAYSLILGGAMGNLIDRVFRGYVVDSF 124

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
             + + W +  FNLAD+ I +G  + +    + + 
Sbjct: 125 DFYWRDWHWPAFNLADIAIVLGALLFVSGSFLGKK 159


>gi|167648018|ref|YP_001685681.1| lipoprotein signal peptidase [Caulobacter sp. K31]
 gi|167350448|gb|ABZ73183.1| lipoprotein signal peptidase [Caulobacter sp. K31]
          Length = 169

 Score = 94.7 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 31/104 (29%), Positives = 54/104 (51%), Gaps = 4/104 (3%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALG-NVVDHCLYGYVID 61
           S VS  +L      ++  +    +K    K +   G  LI  GA G N++D   YGYV+D
Sbjct: 65  SEVSRWLLTIFSAAVVVGLAIWARK--AVKPLMAAGLGLIIGGAFGNNLIDRIRYGYVVD 122

Query: 62  YIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
           +I +    + + VFN+AD  I++G C+++ D  + + ++ G  D
Sbjct: 123 FIDVSRMHFPW-VFNVADSAITVGVCLLLLDSFLSEEKKLGNPD 165


>gi|302036442|ref|YP_003796764.1| lipoprotein signal peptidase [Candidatus Nitrospira defluvii]
 gi|300604506|emb|CBK40838.1| Lipoprotein signal peptidase [Candidatus Nitrospira defluvii]
          Length = 173

 Score = 94.7 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 22/89 (24%), Positives = 42/89 (47%)

Query: 12  SIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQTWS 71
              +  +  +  I  + PK   +  +    I  GA+GN++D   YG VID++  +   + 
Sbjct: 74  VTSVFAVGLLGTILVRMPKDDWMGRLSVAAILGGAIGNLLDRLRYGEVIDFLDFYFNAYH 133

Query: 72  FAVFNLADLFISIGTCIIIYDDIILQHRQ 100
           F  FN+AD  I++G   +I    + +  +
Sbjct: 134 FPAFNVADSAITVGVAFLILHFALEKEPE 162


>gi|194097689|ref|YP_002000730.1| lipoprotein signal peptidase [Neisseria gonorrhoeae NCCP11945]
 gi|240122758|ref|ZP_04735714.1| lipoprotein signal peptidase [Neisseria gonorrhoeae PID332]
 gi|193932979|gb|ACF28803.1| signal peptidase II [Neisseria gonorrhoeae NCCP11945]
 gi|317163490|gb|ADV07031.1| lipoprotein signal peptidase [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 207

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 25/99 (25%), Positives = 53/99 (53%), Gaps = 1/99 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + + + + A++     ++    ++  IG  +I  GA GNV+D  ++G+V+D++
Sbjct: 109 GWQKYFFLVLAVAVSAYLVRAILRDEFA-ALGKIGAAMIIGGASGNVIDRLIHGHVVDFL 167

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           + + Q W +  FN+AD FI +G  + + D+I+ +   K 
Sbjct: 168 LFYWQNWFYPAFNIADSFICVGAVLAVLDNIVHRKDSKK 206


>gi|291533844|emb|CBL06957.1| lipoprotein signal peptidase [Megamonas hypermegale ART12/1]
          Length = 418

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 28/94 (29%), Positives = 50/94 (53%), Gaps = 4/94 (4%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
                + I +++I  I + + K  K   +F +G  ++ +GA+GN++D    G V+DYI  
Sbjct: 325 QRFFFIFIAVILIFAIVYFYSKIIKLNKLFQLGIAMLFSGAIGNMIDRIFIGKVVDYIDF 384

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
                 + +FNLAD+ I  G  IIIY+ + +  +
Sbjct: 385 RI----WPIFNLADIAIVCGCIIIIYELLFITDK 414


>gi|154685961|ref|YP_001421122.1| lipoprotein signal peptidase [Bacillus amyloliquefaciens FZB42]
 gi|226740862|sp|A7Z4G5|LSPA_BACA2 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|154351812|gb|ABS73891.1| LspA [Bacillus amyloliquefaciens FZB42]
          Length = 153

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 21/98 (21%), Positives = 44/98 (44%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
                  I I +I  I +  ++  K + +  I   L+  GA GN +D      V+D+I +
Sbjct: 56  QMWFFYVITIAVIIGIVYYIQRYAKGQMLLGISLGLMLGGAAGNFIDRAARQEVVDFIHV 115

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
               + + +FN+AD  + +G  ++    +    ++K +
Sbjct: 116 IIVDYHYPIFNIADSSLCVGVILLFIHMLFDSGKKKEQ 153


>gi|319781459|ref|YP_004140935.1| lipoprotein signal peptidase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317167347|gb|ADV10885.1| lipoprotein signal peptidase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 162

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 42/102 (41%), Positives = 68/102 (66%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           M S+   T L+ I + ++AF+ F+  +   ++ +   G+ LI  GALGN++D  +YG+VI
Sbjct: 55  MFSSFGDTGLIVISLAVVAFVLFLATRIAPSQILARTGFALIVGGALGNLIDRAVYGHVI 114

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           DYI+ HT  WSFAVFNLAD FIS+G  ++++D+++   R+  
Sbjct: 115 DYILFHTPVWSFAVFNLADAFISVGAALVVFDELVGWRREPK 156


>gi|169797519|ref|YP_001715312.1| prolipoprotein signal peptidase (SPase II) [Acinetobacter baumannii
           AYE]
 gi|184156556|ref|YP_001844895.1| lipoprotein signal peptidase [Acinetobacter baumannii ACICU]
 gi|301347632|ref|ZP_07228373.1| lipoprotein signal peptidase [Acinetobacter baumannii AB056]
 gi|301597193|ref|ZP_07242201.1| lipoprotein signal peptidase [Acinetobacter baumannii AB059]
 gi|90265414|emb|CAJ77096.1| Lipoprotein signal poeptidase [Acinetobacter baumannii]
 gi|169150446|emb|CAM88344.1| prolipoprotein signal peptidase (SPase II) [Acinetobacter baumannii
           AYE]
 gi|183208150|gb|ACC55548.1| Lipoprotein signal peptidase [Acinetobacter baumannii ACICU]
 gi|225121208|gb|ACN81031.1| lipoprotein signal peptidase [Acinetobacter baumannii]
 gi|325301751|gb|ADZ05771.1| lipoprotein signal peptidase [Acinetobacter baumannii]
          Length = 170

 Score = 94.3 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 24/95 (25%), Positives = 45/95 (47%), Gaps = 2/95 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + I +++  F+  +  +N        I Y LI  GA+GN++D    GYV+D  
Sbjct: 67  GWQRYFFIGIAVVVSIFLIKLILENR--HKGEAIAYSLILGGAMGNLIDRVFRGYVVDSF 124

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
             + + W +  FNLAD+ I +G  + +   ++ + 
Sbjct: 125 DFYWRDWHWPAFNLADIAIVLGALLFVSSSLLGKK 159


>gi|241760885|ref|ZP_04758974.1| lipoprotein signal peptidase [Zymomonas mobilis subsp. mobilis ATCC
           10988]
 gi|241374504|gb|EER63965.1| lipoprotein signal peptidase [Zymomonas mobilis subsp. mobilis ATCC
           10988]
          Length = 174

 Score = 94.3 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 27/103 (26%), Positives = 47/103 (45%), Gaps = 3/103 (2%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S+V   +LV++   I   +  +  +         +   L+  GA+GN+ D    G V+D+
Sbjct: 73  SDVGRWLLVALTAAIALAVVILILREK--HFSSAMALGLVLGGAIGNITDRIRSGAVVDF 130

Query: 63  IMIHTQTWS-FAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
           + +H   W  F VFN+AD  IS G   +I   +  ++    K 
Sbjct: 131 LDLHFGNWHPFLVFNVADAAISCGVVFLILRSLWSKNEDDNKA 173


>gi|301513538|ref|ZP_07238775.1| lipoprotein signal peptidase [Acinetobacter baumannii AB058]
          Length = 170

 Score = 94.3 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 24/95 (25%), Positives = 45/95 (47%), Gaps = 2/95 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + I +++  F+  +  +N        I Y LI  GA+GN++D    GYV+D  
Sbjct: 67  GWQRYFFIGIAVVVSIFLIKLIFENR--HKGEAIAYSLILGGAMGNLIDRVFRGYVVDSF 124

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
             + + W +  FNLAD+ I +G  + +   ++ + 
Sbjct: 125 DFYWRDWHWPAFNLADIAIVLGALLFVSSSLLGKK 159


>gi|297537732|ref|YP_003673501.1| lipoprotein signal peptidase [Methylotenera sp. 301]
 gi|297257079|gb|ADI28924.1| lipoprotein signal peptidase [Methylotenera sp. 301]
          Length = 159

 Score = 94.3 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 25/95 (26%), Positives = 47/95 (49%), Gaps = 1/95 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
            +       + ++ I  I ++ +K+     +F +G  L+  GA+GN+ D    GYVID++
Sbjct: 66  GIQRWFFAGVSVIAIIVISYLIQKHRTE-KLFCVGLALVLGGAIGNLYDRVTLGYVIDFL 124

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
             H Q   +  FN+AD  I +G  +++ D     +
Sbjct: 125 NFHYQQMYWPAFNVADSAICVGVGLLLLDSFKKPN 159


>gi|302879261|ref|YP_003847825.1| lipoprotein signal peptidase [Gallionella capsiferriformans ES-2]
 gi|302582050|gb|ADL56061.1| lipoprotein signal peptidase [Gallionella capsiferriformans ES-2]
          Length = 158

 Score = 94.3 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 29/95 (30%), Positives = 50/95 (52%), Gaps = 1/95 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
            +   +   I ++    I  +  K+ K  ++F +   LI  GALGN++D   YGYVID++
Sbjct: 59  GMQRWLFSGIAVIASVSITLLLYKHAKE-TLFALALSLILGGALGNLIDRIAYGYVIDFL 117

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
           + H     F  FNLAD  I+ G  ++I++  + + 
Sbjct: 118 LFHWNEHYFPAFNLADSAITSGAALMIWESFMEKK 152


>gi|114320014|ref|YP_741697.1| signal peptidase II [Alkalilimnicola ehrlichii MLHE-1]
 gi|114226408|gb|ABI56207.1| signal peptidase II [Alkalilimnicola ehrlichii MLHE-1]
          Length = 155

 Score = 94.3 bits (234), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 25/97 (25%), Positives = 53/97 (54%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   +I + +  +I +   +    +     G  L+  GA+GN++D  ++GYVID+I
Sbjct: 58  GWQRWFFSAIALGVSLYILWWLHQIRGRRHFLACGLALVLGGAVGNLIDRLVHGYVIDFI 117

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
            ++ + W + +FN+AD+ I++G  +++   I L+ +Q
Sbjct: 118 HVYWRDWHYPIFNVADIGITVGVVMVMVYMIFLEPKQ 154


>gi|71908243|ref|YP_285830.1| peptidase A8, signal peptidase II [Dechloromonas aromatica RCB]
 gi|71847864|gb|AAZ47360.1| Peptidase A8, signal peptidase II [Dechloromonas aromatica RCB]
          Length = 166

 Score = 93.9 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 23/99 (23%), Positives = 47/99 (47%), Gaps = 1/99 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                + +++ +++   +  +  K          GY L+  GA+GN+VD  + G V+DY+
Sbjct: 67  GWQRYVFIALALVVSVGLTVMLLKGVA-NRWQGWGYSLLLGGAVGNLVDRLVQGAVVDYL 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
             H   W +  FNLAD  + +   I+++  ++   + K 
Sbjct: 126 DFHAGGWHWPAFNLADTALCLSALILLWGTLLSSAQSKA 164


>gi|304392319|ref|ZP_07374260.1| signal peptidase II [Ahrensia sp. R2A130]
 gi|303295423|gb|EFL89782.1| signal peptidase II [Ahrensia sp. R2A130]
          Length = 159

 Score = 93.9 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 36/102 (35%), Positives = 63/102 (61%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           ML +  P  LV + ++II F+ ++W++  K      +G+ L+  GA+GN++D    GYV+
Sbjct: 53  MLDSFGPMFLVLLSVVIIIFMGWLWRQTAKQDYFAHLGFALVMAGAIGNLIDRANLGYVV 112

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           D+ ++HT +W+FAVFN+AD +I+ G   II  + +   R + 
Sbjct: 113 DFFLVHTDSWAFAVFNVADSYITCGAIAIILQEFLNWRRNRA 154


>gi|261393179|emb|CAX50797.1| lipoprotein signal peptidase (prolipoprotein signal peptidase;
           signal peptidase II; SPase II) [Neisseria meningitidis
           8013]
          Length = 168

 Score = 93.9 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 25/102 (24%), Positives = 55/102 (53%), Gaps = 1/102 (0%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + + + + A++     ++    ++   G  +I  GALGNV+D  ++G+V+D++
Sbjct: 66  GWQKYFFLVLAVAVSAYLVRAILRDEFA-TLGKTGAAMIIGGALGNVIDRLIHGHVVDFL 124

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
           + + Q W +  FN+AD FI +G  + + D+I+ +   K  ++
Sbjct: 125 LFYWQNWFYPAFNIADSFICVGAVLAVLDNIVHRKDSKKNVN 166


>gi|329118301|ref|ZP_08247010.1| signal peptidase II [Neisseria bacilliformis ATCC BAA-1200]
 gi|327465525|gb|EGF11801.1| signal peptidase II [Neisseria bacilliformis ATCC BAA-1200]
          Length = 171

 Score = 93.9 bits (233), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 25/95 (26%), Positives = 51/95 (53%), Gaps = 1/95 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  V++  +I  ++    +K     ++   G  ++  GALGNV+D  ++G V+D++
Sbjct: 65  GWQKYFFVALAAVISVWLVRAVRKGEFG-ALGSWGAAMVVGGALGNVIDRFVHGKVVDFL 123

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
           + + +TWS+  FN+AD FI +G  +++ D    + 
Sbjct: 124 LFYGETWSYPAFNVADSFICVGAALLVLDSFTHKK 158


>gi|257074490|ref|YP_003162888.1| lipoprotein signal peptidase [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
 gi|257074516|ref|YP_003162913.1| lipoprotein signal peptidase [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
 gi|257091644|ref|YP_003165287.1| hypothetical protein CAP2UW1_4717 [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257048653|gb|ACV37840.1| hypothetical protein CAP2UW1_4717 [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257048711|gb|ACV37897.1| lipoprotein signal peptidase [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
 gi|257048737|gb|ACV37922.1| lipoprotein signal peptidase [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
          Length = 359

 Score = 93.9 bits (233), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 28/88 (31%), Positives = 47/88 (53%), Gaps = 2/88 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                 L+++ +++ A++  +  +      +  +GY LI  GALGNVVD  L G V+D++
Sbjct: 258 GWQRYFLMALGLVVSAWLGRMLCQQR--PRLEAVGYSLILGGALGNVVDRVLRGSVVDFL 315

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIY 91
             H Q   +  FNLAD+ I+IG   +  
Sbjct: 316 DFHWQLVHWPAFNLADVAITIGALCLFL 343


>gi|294648327|ref|ZP_06725836.1| lipoprotein signal peptidase [Acinetobacter haemolyticus ATCC
           19194]
 gi|292825769|gb|EFF84463.1| lipoprotein signal peptidase [Acinetobacter haemolyticus ATCC
           19194]
          Length = 358

 Score = 93.9 bits (233), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 25/88 (28%), Positives = 46/88 (52%), Gaps = 2/88 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  +++ +++ A++  +  +  +   +  +GY LI  GALGNV D  L G V+D++
Sbjct: 257 GWQRYFFITLGLVVSAWLGRMLCQ--QLPRLEAMGYSLILGGALGNVADRVLRGQVVDFL 314

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIY 91
             H +   +  FNLAD+ I+IG   +  
Sbjct: 315 DFHWRLAHWPAFNLADVAITIGALCLFL 342


>gi|218281134|ref|ZP_03487669.1| hypothetical protein EUBIFOR_00230 [Eubacterium biforme DSM 3989]
 gi|218217648|gb|EEC91186.1| hypothetical protein EUBIFOR_00230 [Eubacterium biforme DSM 3989]
          Length = 187

 Score = 93.9 bits (233), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 24/103 (23%), Positives = 53/103 (51%), Gaps = 2/103 (1%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           M +        ++ ++ +  + +++ K   ++  + I   L+ +GA+GN +D    GYV 
Sbjct: 82  MFAQAGMGFFAALTLIALVAMVYMFFKTDDSR--YQICLSLVFSGAIGNFIDRMSLGYVR 139

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
           D+   +   + F VFN+AD+ I++G  +I+    I   +++ K
Sbjct: 140 DFFSFYIFGYPFPVFNVADICITVGIALILISMFIDDKKEQAK 182


>gi|56130718|ref|YP_145621.1| PbrB/pbrC lead resistance fusion protein [Ralstonia metallidurans
           CH34]
 gi|94152350|ref|YP_581757.1| undecaprenyl pyrophosphate phosphatase /lipoprotein signal
           peptidase involved in Pb(II) resistance PbrB/C
           [Cupriavidus metallidurans CH34]
 gi|56068708|emb|CAI11270.1| PbrB/pbrC lead resistance fusion protein [Cupriavidus metallidurans
           CH34]
 gi|93358720|gb|ABF12807.1| undecaprenyl pyrophosphate phosphatase /lipoprotein signal
           peptidase involved in Pb(II) resistance PbrB/C
           [Cupriavidus metallidurans CH34]
          Length = 358

 Score = 93.9 bits (233), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 26/94 (27%), Positives = 42/94 (44%), Gaps = 1/94 (1%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKT-KSIFDIGYILITTGALGNVVDHCLYGYV 59
           +L+       V    L +    ++  +  +        GY LI  GALGN  D  L G V
Sbjct: 252 LLAGAGVWARVGFAALAMCISLWLIDQLRRGAPRWEAAGYCLILGGALGNAADRLLRGAV 311

Query: 60  IDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDD 93
           +D++  H +   +  FNLAD+ I++G   +I   
Sbjct: 312 VDFLDFHWRGTHWPAFNLADVAITVGAVCLIVAT 345


>gi|126649706|ref|ZP_01721942.1| signal peptidase II [Bacillus sp. B14905]
 gi|126593425|gb|EAZ87370.1| signal peptidase II [Bacillus sp. B14905]
          Length = 161

 Score = 93.9 bits (233), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 28/106 (26%), Positives = 55/106 (51%), Gaps = 3/106 (2%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           ML      +   + + +I  I + + +  K K IF +G +L+  GA+GN +D    G V+
Sbjct: 55  MLEG-QMWLFSIVTVAVICAIVYFYHREAKGKPIFQVGLMLLLGGAIGNFIDRIFRGEVV 113

Query: 61  DYIM--IHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
           D++   I    + F +FN+AD  ++I   I++   I+   ++K ++
Sbjct: 114 DFVDVLIPIIKYDFPIFNVADAALTIAVVILMIGLIMEDKKEKKQV 159


>gi|253995906|ref|YP_003047970.1| lipoprotein signal peptidase [Methylotenera mobilis JLW8]
 gi|253982585|gb|ACT47443.1| lipoprotein signal peptidase [Methylotenera mobilis JLW8]
          Length = 153

 Score = 93.9 bits (233), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 23/95 (24%), Positives = 45/95 (47%), Gaps = 1/95 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   ++  +    I ++ KK+ +   +F +G  L+  GA+GN+ D    GYV+D++
Sbjct: 58  GWQKWFFTAVTAVAAIVISYLIKKHHQE-KLFSLGLALVLGGAIGNLYDRLTLGYVVDFL 116

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
             H     +  FN+AD  I +G  +++ D     +
Sbjct: 117 FFHIDQLYWPAFNVADSAICVGVGLLLADSFKKSN 151


>gi|158521203|ref|YP_001529073.1| lipoprotein signal peptidase [Desulfococcus oleovorans Hxd3]
 gi|158510029|gb|ABW66996.1| lipoprotein signal peptidase [Desulfococcus oleovorans Hxd3]
          Length = 160

 Score = 93.5 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 23/95 (24%), Positives = 50/95 (52%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
             V   + + +  L  AF+ +++K  P+T         LI  GA+GN++D   +G V+D+
Sbjct: 63  QGVRAVLFLVVSTLAAAFVLYLYKTTPRTLPWLLGALALIFGGAVGNLIDRIRFGVVVDF 122

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQ 97
           +  + +   +  FN+AD  I++G  ++++  +  +
Sbjct: 123 LDFYVKGLHWPAFNVADSAITVGMTVLVFHILFKK 157


>gi|306842564|ref|ZP_07475215.1| signal peptidase II [Brucella sp. BO2]
 gi|306844417|ref|ZP_07477007.1| signal peptidase II [Brucella sp. BO1]
 gi|306275230|gb|EFM56980.1| signal peptidase II [Brucella sp. BO1]
 gi|306287420|gb|EFM58900.1| signal peptidase II [Brucella sp. BO2]
          Length = 160

 Score = 93.5 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 40/101 (39%), Positives = 67/101 (66%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           ML+ +    L++I + +IAF+ ++W  N   +     G+ L+  GA+GN++D  ++GYV+
Sbjct: 57  MLAWLHDGGLIAITLAVIAFVLYLWWTNAPERVFARYGFALVIGGAIGNLIDRVMHGYVV 116

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
           DY++ H  TWSFAVFNLAD FI+IG  +II ++ +   R++
Sbjct: 117 DYVLFHLPTWSFAVFNLADAFITIGAGLIILEEFLGWRRER 157


>gi|330878965|gb|EGH13114.1| lipoprotein signal peptidase [Pseudomonas syringae pv. morsprunorum
           str. M302280PT]
 gi|330966380|gb|EGH66640.1| lipoprotein signal peptidase [Pseudomonas syringae pv. actinidiae
           str. M302091]
          Length = 173

 Score = 93.5 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 49/97 (50%), Gaps = 1/97 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +     +   I +++ A +    K+  +  +   I   L+  GALGN+ D  + G+VID+
Sbjct: 70  AGWQRWLFALIAVVVSAVLVVWLKRLGRDDTWLAIALALVLGGALGNLYDRVVLGHVIDF 129

Query: 63  IMIHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQH 98
           I++H Q  W F  FN+AD  I++G  ++  D    + 
Sbjct: 130 ILVHWQNRWYFPAFNVADSAITVGAIMLALDMFKSKK 166


>gi|322421575|ref|YP_004200798.1| lipoprotein signal peptidase [Geobacter sp. M18]
 gi|320127962|gb|ADW15522.1| lipoprotein signal peptidase [Geobacter sp. M18]
          Length = 175

 Score = 93.5 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 27/102 (26%), Positives = 48/102 (47%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S       + +  + +  I     K    +++      LI +GALGN++D    G VID+
Sbjct: 68  SAYRLPFFLLVSTVAVIVILVAVSKMRDDQTLNVASLSLIFSGALGNMIDRVRLGEVIDF 127

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
           + +H +   +  FN+AD  I +G   +  D ++   R+K KI
Sbjct: 128 LDVHWKGHHWPAFNIADSAICVGVFALAIDMLLEDRREKQKI 169


>gi|28868035|ref|NP_790654.1| lipoprotein signal peptidase [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213971062|ref|ZP_03399182.1| lipoprotein signal peptidase [Pseudomonas syringae pv. tomato T1]
 gi|301384215|ref|ZP_07232633.1| lipoprotein signal peptidase [Pseudomonas syringae pv. tomato
           Max13]
 gi|302060861|ref|ZP_07252402.1| lipoprotein signal peptidase [Pseudomonas syringae pv. tomato K40]
 gi|302132874|ref|ZP_07258864.1| lipoprotein signal peptidase [Pseudomonas syringae pv. tomato NCPPB
           1108]
 gi|32171415|sp|Q889E3|LSPA_PSESM RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|28851271|gb|AAO54349.1| lipoprotein signal peptidase [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213924170|gb|EEB57745.1| lipoprotein signal peptidase [Pseudomonas syringae pv. tomato T1]
 gi|331018369|gb|EGH98425.1| lipoprotein signal peptidase [Pseudomonas syringae pv. lachrymans
           str. M302278PT]
          Length = 173

 Score = 93.5 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 49/97 (50%), Gaps = 1/97 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +     +   I +++ A +    K+  +  +   I   L+  GALGN+ D  + G+VID+
Sbjct: 70  AGWQRWLFALIAVVVSAVLVVWLKRLGRDDTWLAIALALVLGGALGNLYDRVVLGHVIDF 129

Query: 63  IMIHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQH 98
           I++H Q  W F  FN+AD  I++G  ++  D    + 
Sbjct: 130 ILVHWQNRWYFPAFNVADSAITVGAIMLALDMFKSKK 166


>gi|311029947|ref|ZP_07708037.1| lipoprotein signal peptidase [Bacillus sp. m3-13]
          Length = 155

 Score = 93.5 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 47/97 (48%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
                  I + ++  +    +K PK +    +   L+  GA+GN +D  L+  VID+I  
Sbjct: 55  QMYFFYIITVGVVIGLIVYLQKLPKDQPWMKLALSLMLGGAIGNFIDRLLHQEVIDFINT 114

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
              T+ F +FN+AD  + IG  II+   I+   ++K 
Sbjct: 115 FIFTYDFPIFNVADSALVIGVGIILILTILEGKKEKE 151


>gi|295706352|ref|YP_003599427.1| signal peptidase II [Bacillus megaterium DSM 319]
 gi|294804011|gb|ADF41077.1| signal peptidase II [Bacillus megaterium DSM 319]
          Length = 155

 Score = 93.5 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 22/100 (22%), Positives = 45/100 (45%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
                  I ++++  +    +K  K    F I   L+  GA+GN +D  +   V+D++  
Sbjct: 56  QMWFFYLITVVVVVGLIIYIQKLKKQDKWFGIALALMLGGAIGNFIDRVVRKEVVDFVNT 115

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
           +  T+ F +FN+AD  + +G  I+    +     +K   +
Sbjct: 116 YIFTYDFPIFNVADSALVVGVIIMFIMTLFEGKMKKEHKE 155


>gi|253702344|ref|YP_003023533.1| lipoprotein signal peptidase [Geobacter sp. M21]
 gi|251777194|gb|ACT19775.1| lipoprotein signal peptidase [Geobacter sp. M21]
          Length = 164

 Score = 93.5 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 22/101 (21%), Positives = 49/101 (48%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S       + +  + +  I  +  +    +    +   LI +GALGN++D    G VID+
Sbjct: 61  SAWRLPFFLLVSAVAVLVILVVVSRLRDDQKGSAVSLSLIFSGALGNLIDRVRLGEVIDF 120

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
           + ++ +   +  FN+AD  I +G  ++  + ++ + R+K +
Sbjct: 121 LDVYWKGHHWPAFNVADSAICVGVFMLAIEMVLEERREKAQ 161


>gi|121593648|ref|YP_985544.1| signal peptidase II [Acidovorax sp. JS42]
 gi|120605728|gb|ABM41468.1| signal peptidase II [Acidovorax sp. JS42]
          Length = 364

 Score = 93.5 bits (232), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 26/91 (28%), Positives = 42/91 (46%), Gaps = 1/91 (1%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKT-KSIFDIGYILITTGALGNVVDHCLYGYV 59
           +L+            L +    ++ +   +       +GY LI  GALGN VD  L G V
Sbjct: 252 LLAGAGSWARFGFAALALGVSIWLIRLLRQGVSKWEGVGYSLILGGALGNAVDRLLRGAV 311

Query: 60  IDYIMIHTQTWSFAVFNLADLFISIGTCIII 90
           +D++  H     +  FNLAD+ IS+G   ++
Sbjct: 312 VDFLDFHWHGAHWPAFNLADVAISLGAICLL 342


>gi|304404033|ref|ZP_07385695.1| lipoprotein signal peptidase [Paenibacillus curdlanolyticus YK9]
 gi|304347011|gb|EFM12843.1| lipoprotein signal peptidase [Paenibacillus curdlanolyticus YK9]
          Length = 179

 Score = 93.5 bits (232), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 24/98 (24%), Positives = 48/98 (48%), Gaps = 1/98 (1%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDI-GYILITTGALGNVVDHCLYGYVIDYIM 64
                + + +++   + +   K  K+     + G  ++  GALGN  D    G V+D++ 
Sbjct: 62  QRVFFLIVTVIVTTGLIWYMAKMRKSGRAILLTGLGMVLGGALGNFSDRARTGEVVDFLQ 121

Query: 65  IHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
            +  +++F +FN+AD+ I IG  +I+ D  I    +K 
Sbjct: 122 FNFGSYTFPIFNVADMGICIGVGLILLDAFIGAREEKA 159


>gi|134094761|ref|YP_001099836.1| prolipoprotein signal peptidase [Herminiimonas arsenicoxydans]
 gi|133738664|emb|CAL61709.1| Lipoprotein signal peptidase (Prolipoprotein signal peptidase)
           (Signal peptidase II) (SPase II) [Herminiimonas
           arsenicoxydans]
          Length = 174

 Score = 93.5 bits (232), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 24/91 (26%), Positives = 43/91 (47%), Gaps = 2/91 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  ++I   +  ++ F  +K     ++    Y LI  GALGN +D  + G+V+DY+
Sbjct: 75  GWQRYFFIAIAFGVSLWLAFELRK--PLPALSAWAYSLILGGALGNAIDRLIRGHVVDYL 132

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDI 94
             H   W +  FN AD+ I  G  +++   +
Sbjct: 133 DFHLGGWHWPAFNAADIGIVCGAALLVMASL 163


>gi|85058393|ref|YP_454095.1| lipoprotein signal peptidase [Sodalis glossinidius str.
           'morsitans']
 gi|123520108|sp|Q2NVY5|LSPA_SODGM RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|84778913|dbj|BAE73690.1| prolipoprotein signal peptidase (SPase II) [Sodalis glossinidius
           str. 'morsitans']
          Length = 168

 Score = 93.5 bits (232), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 25/91 (27%), Positives = 46/91 (50%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   +I ++I   +  +  ++ K   + +  Y +I  GALGN+ D  ++G VID+I
Sbjct: 66  GWQRWAFSAIAVVIAVVLLVMMYRSDKRARLSNAAYAMIIGGALGNLFDRMVHGVVIDFI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDI 94
             +   W +  FN+AD+ I IG  +I+ +  
Sbjct: 126 DFYVGNWHWPTFNVADVGICIGAVLIVLEGF 156


>gi|294501003|ref|YP_003564703.1| signal peptidase II [Bacillus megaterium QM B1551]
 gi|294350940|gb|ADE71269.1| signal peptidase II [Bacillus megaterium QM B1551]
          Length = 155

 Score = 93.5 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 22/100 (22%), Positives = 45/100 (45%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
                  I ++++  +    +K  K    F I   L+  GA+GN +D  +   V+D++  
Sbjct: 56  QMWFFYLITVVVVIGLIIYIQKLKKQDKWFGIALALMLGGAIGNFIDRVVRKEVVDFVNT 115

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
           +  T+ F +FN+AD  + +G  I+    +     +K   +
Sbjct: 116 YIFTYDFPIFNVADSALVVGVIIMFIMTLFEGKMKKEHKE 155


>gi|224369584|ref|YP_002603748.1| LspA [Desulfobacterium autotrophicum HRM2]
 gi|259495131|sp|C0QGT5|LSPA_DESAH RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|223692301|gb|ACN15584.1| LspA [Desulfobacterium autotrophicum HRM2]
          Length = 162

 Score = 93.5 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 23/93 (24%), Positives = 48/93 (51%)

Query: 5   VSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIM 64
           V     + +  L+   I +++++  +T  +   G   I  GA+GN++D   +G V+D++ 
Sbjct: 66  VRKFFFLFVSSLVALMILWLYQRTAQTHRVLSFGLAAIFAGAVGNLIDRFRFGMVVDFLD 125

Query: 65  IHTQTWSFAVFNLADLFISIGTCIIIYDDIILQ 97
            +   + +  FN+AD  I+IG  + +Y  I  +
Sbjct: 126 FYLGAYHWPAFNVADSAITIGMVVFVYHVIFNK 158


>gi|256060291|ref|ZP_05450464.1| lipoprotein signal peptidase [Brucella neotomae 5K33]
 gi|261324263|ref|ZP_05963460.1| lipoprotein signal peptidase [Brucella neotomae 5K33]
 gi|261300243|gb|EEY03740.1| lipoprotein signal peptidase [Brucella neotomae 5K33]
          Length = 160

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 40/101 (39%), Positives = 67/101 (66%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           ML+ +    L++I + +IAF+ ++W  N   +     G+ L+  GA+GN++D  ++GYV+
Sbjct: 57  MLAWLHDGGLIAITLAVIAFVLYLWWTNAPERVFARYGFALVIGGAIGNLIDRVMHGYVV 116

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
           DY++ H  TWSFAVFNLAD FI+IG  +II ++ +   R++
Sbjct: 117 DYVLFHLPTWSFAVFNLADAFITIGAGLIILEEFLSWRRER 157


>gi|120554332|ref|YP_958683.1| lipoprotein signal peptidase [Marinobacter aquaeolei VT8]
 gi|120324181|gb|ABM18496.1| signal peptidase II, Aspartic peptidase, MEROPS family A08
           [Marinobacter aquaeolei VT8]
          Length = 170

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 49/95 (51%), Gaps = 2/95 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                 L+++ +++   +  +  +    +    I Y LI  GA+GN++D    GYV+D  
Sbjct: 67  GWQRYFLITVAVVVSFVLIRLILQCR--RRGEAIAYSLILGGAMGNLIDRIFRGYVVDSF 124

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
            ++ Q+W +  FNLAD+ I +GT + +Y   I + 
Sbjct: 125 DVYWQSWHWPAFNLADIAIVLGTVLFLYVSFIPEK 159


>gi|304388364|ref|ZP_07370475.1| signal peptidase II [Neisseria meningitidis ATCC 13091]
 gi|254671602|emb|CBA09281.1| Lipoprotein signal peptidase [Neisseria meningitidis alpha153]
 gi|304337630|gb|EFM03788.1| signal peptidase II [Neisseria meningitidis ATCC 13091]
          Length = 168

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 26/102 (25%), Positives = 55/102 (53%), Gaps = 1/102 (0%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + + + + A++     ++    ++  IG  +I  GALGNV D  ++G+V+D++
Sbjct: 66  GWQKYFFLVLAVAVSAYLVRAILRDEFA-TLGKIGAAMIIGGALGNVADRLIHGHVVDFL 124

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
           + + Q W +  FN+AD FI +G  + + D+I+ +   K  ++
Sbjct: 125 LFYWQNWFYPAFNIADSFICVGAVLAVLDNIVHRKDSKKNVN 166


>gi|42741715|gb|AAS45113.1| signal peptidase [Alcaligenes faecalis]
          Length = 359

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 25/88 (28%), Positives = 46/88 (52%), Gaps = 2/88 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  +++ +++ A++  +  +  +   +  +GY LI  GALGNV D  L G V+D++
Sbjct: 258 GWQRYFFITLGLVVSAWLGRMLCQ--QLPRLEAMGYSLILGGALGNVADRVLRGQVVDFL 315

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIY 91
             H +   +  FNLAD+ I+IG   +  
Sbjct: 316 DFHWRLAHWPAFNLADVAITIGALCLFL 343


>gi|206603462|gb|EDZ39942.1| Signal peptidase II [Leptospirillum sp. Group II '5-way CG']
          Length = 179

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 21/88 (23%), Positives = 37/88 (42%)

Query: 7   PTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIH 66
             I + + I  I  I +   +  +   +      +I  GALGN+ D  L G V+D++   
Sbjct: 77  RLIFIVLTIAAIVLILYYSYRRKRECGLEFYPLSIILGGALGNLSDRILKGRVVDFLDFS 136

Query: 67  TQTWSFAVFNLADLFISIGTCIIIYDDI 94
                +  FN+AD  I +G   ++    
Sbjct: 137 FHGHHWPAFNVADSAIVVGVLFLLLIQF 164


>gi|254428346|ref|ZP_05042053.1| signal peptidase II [Alcanivorax sp. DG881]
 gi|196194515|gb|EDX89474.1| signal peptidase II [Alcanivorax sp. DG881]
          Length = 136

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 23/95 (24%), Positives = 45/95 (47%), Gaps = 2/95 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + I +++   +  + +   K  +   I Y LI  GA+GN++D    GYV+D  
Sbjct: 33  GWQRYFFIGIAVVVSVVLIKLIR--EKGHNGDAIAYSLILGGAMGNLIDRIFRGYVVDSF 90

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
             + + W +  FNLAD+ I +G  + +   ++ + 
Sbjct: 91  DFYWRDWHWPAFNLADIAIVLGALLFVSSSLLGKK 125


>gi|315500446|ref|YP_004089249.1| lipoprotein signal peptidase [Asticcacaulis excentricus CB 48]
 gi|315418458|gb|ADU15098.1| lipoprotein signal peptidase [Asticcacaulis excentricus CB 48]
          Length = 181

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 25/100 (25%), Positives = 50/100 (50%), Gaps = 3/100 (3%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
            +   +L    +++ AF+    ++    + I  +G  L+  GA+GN +D  +YG V+D++
Sbjct: 84  GIGRWLLTLFSLVVSAFLIDWVRRT--NRRILGLGLALVAGGAIGNAIDRIIYGGVVDFL 141

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
                 + + VFN+AD  I+IG  ++  D   L   +  +
Sbjct: 142 DFSGLGFPW-VFNIADAAINIGVALLFIDVFFLNREESKQ 180


>gi|52841173|ref|YP_094972.1| lipoprotein signal peptidase [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|52628284|gb|AAU27025.1| lipoprotein signal peptidase [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
          Length = 121

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 30/95 (31%), Positives = 48/95 (50%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
           +           L+   +     + P+      +G  LI  GA+GN++D  L+GYVID+I
Sbjct: 27  DWHRWFFAGFSFLMSIILLIWLVRTPEQARFQSVGISLILGGAIGNLIDRGLHGYVIDFI 86

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
            ++ +   FA FNLAD  I IG  I++ D +I + 
Sbjct: 87  DVYYKHHHFATFNLADSAICIGAAILVLDLLIRRE 121


>gi|297569150|ref|YP_003690494.1| lipoprotein signal peptidase [Desulfurivibrio alkaliphilus AHT2]
 gi|296925065|gb|ADH85875.1| lipoprotein signal peptidase [Desulfurivibrio alkaliphilus AHT2]
          Length = 169

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 19/97 (19%), Positives = 42/97 (43%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  +   +L +  +  +++       ++     LIT+GALGN++D    G V D++
Sbjct: 66  GWRRFFFIGATVLALILLAVLYRHVRYQGRLYLYALALITSGALGNLLDRIRLGEVTDFL 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
             + + + +  FN+AD  I++G  +           +
Sbjct: 126 DFYWRDYHWPAFNIADSAITVGVLLFFVATWRHPPEE 162


>gi|23501060|ref|NP_697187.1| lipoprotein signal peptidase [Brucella suis 1330]
 gi|62289125|ref|YP_220918.1| lipoprotein signal peptidase [Brucella abortus bv. 1 str. 9-941]
 gi|82699064|ref|YP_413638.1| lipoprotein signal peptidase [Brucella melitensis biovar Abortus
           2308]
 gi|148559708|ref|YP_001258182.1| lipoprotein signal peptidase [Brucella ovis ATCC 25840]
 gi|161618137|ref|YP_001592024.1| signal peptidase II [Brucella canis ATCC 23365]
 gi|163842419|ref|YP_001626823.1| signal peptidase II [Brucella suis ATCC 23445]
 gi|189023402|ref|YP_001934170.1| lipoprotein signal peptidase [Brucella abortus S19]
 gi|225851683|ref|YP_002731916.1| lipoprotein signal peptidase [Brucella melitensis ATCC 23457]
 gi|254690453|ref|ZP_05153707.1| lipoprotein signal peptidase [Brucella abortus bv. 6 str. 870]
 gi|254694942|ref|ZP_05156770.1| lipoprotein signal peptidase [Brucella abortus bv. 3 str. Tulya]
 gi|254696573|ref|ZP_05158401.1| lipoprotein signal peptidase [Brucella abortus bv. 2 str. 86/8/59]
 gi|254700958|ref|ZP_05162786.1| lipoprotein signal peptidase [Brucella suis bv. 5 str. 513]
 gi|254705328|ref|ZP_05167156.1| lipoprotein signal peptidase [Brucella suis bv. 3 str. 686]
 gi|254707159|ref|ZP_05168987.1| lipoprotein signal peptidase [Brucella pinnipedialis M163/99/10]
 gi|254709298|ref|ZP_05171109.1| lipoprotein signal peptidase [Brucella pinnipedialis B2/94]
 gi|254713279|ref|ZP_05175090.1| lipoprotein signal peptidase [Brucella ceti M644/93/1]
 gi|254716368|ref|ZP_05178179.1| lipoprotein signal peptidase [Brucella ceti M13/05/1]
 gi|254731486|ref|ZP_05190064.1| lipoprotein signal peptidase [Brucella abortus bv. 4 str. 292]
 gi|256030821|ref|ZP_05444435.1| lipoprotein signal peptidase [Brucella pinnipedialis M292/94/1]
 gi|256045940|ref|ZP_05448812.1| lipoprotein signal peptidase [Brucella melitensis bv. 1 str. Rev.1]
 gi|256112653|ref|ZP_05453574.1| lipoprotein signal peptidase [Brucella melitensis bv. 3 str. Ether]
 gi|256158846|ref|ZP_05456703.1| lipoprotein signal peptidase [Brucella ceti M490/95/1]
 gi|256254227|ref|ZP_05459763.1| lipoprotein signal peptidase [Brucella ceti B1/94]
 gi|256258709|ref|ZP_05464245.1| lipoprotein signal peptidase [Brucella abortus bv. 9 str. C68]
 gi|256368613|ref|YP_003106119.1| lipoprotein signal peptidase [Brucella microti CCM 4915]
 gi|260169725|ref|ZP_05756536.1| lipoprotein signal peptidase [Brucella sp. F5/99]
 gi|260756005|ref|ZP_05868353.1| signal peptidase II [Brucella abortus bv. 6 str. 870]
 gi|260759229|ref|ZP_05871577.1| signal peptidase II [Brucella abortus bv. 4 str. 292]
 gi|260760951|ref|ZP_05873294.1| signal peptidase II [Brucella abortus bv. 2 str. 86/8/59]
 gi|260885025|ref|ZP_05896639.1| lipoprotein signal peptidase [Brucella abortus bv. 9 str. C68]
 gi|261215281|ref|ZP_05929562.1| signal peptidase II [Brucella abortus bv. 3 str. Tulya]
 gi|261218150|ref|ZP_05932431.1| lipoprotein signal peptidase [Brucella ceti M13/05/1]
 gi|261221376|ref|ZP_05935657.1| lipoprotein signal peptidase [Brucella ceti B1/94]
 gi|261314636|ref|ZP_05953833.1| lipoprotein signal peptidase [Brucella pinnipedialis M163/99/10]
 gi|261316807|ref|ZP_05956004.1| lipoprotein signal peptidase [Brucella pinnipedialis B2/94]
 gi|261321002|ref|ZP_05960199.1| lipoprotein signal peptidase [Brucella ceti M644/93/1]
 gi|261751477|ref|ZP_05995186.1| lipoprotein signal peptidase [Brucella suis bv. 5 str. 513]
 gi|261756039|ref|ZP_05999748.1| lipoprotein signal peptidase [Brucella suis bv. 3 str. 686]
 gi|265987877|ref|ZP_06100434.1| lipoprotein signal peptidase [Brucella pinnipedialis M292/94/1]
 gi|265992351|ref|ZP_06104908.1| lipoprotein signal peptidase [Brucella melitensis bv. 1 str. Rev.1]
 gi|265994094|ref|ZP_06106651.1| lipoprotein signal peptidase [Brucella melitensis bv. 3 str. Ether]
 gi|265997337|ref|ZP_06109894.1| lipoprotein signal peptidase [Brucella ceti M490/95/1]
 gi|81309480|sp|Q57FM7|LSPA_BRUAB RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|81847198|sp|Q8G308|LSPA_BRUSU RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|123546777|sp|Q2YNY8|LSPA_BRUA2 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|152032413|sp|Q8YES8|LSPA_BRUME RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|166232854|sp|A5VN85|LSPA_BRUO2 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|189028643|sp|B0CIQ7|LSPA_BRUSI RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|189028777|sp|A9M794|LSPA_BRUC2 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|238689408|sp|B2S8E3|LSPA_BRUA1 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|254810439|sp|C0RGK4|LSPA_BRUMB RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|23346927|gb|AAN29102.1| lipoprotein signal peptidase [Brucella suis 1330]
 gi|62195257|gb|AAX73557.1| LspA, lipoprotein signal peptidase [Brucella abortus bv. 1 str.
           9-941]
 gi|82615165|emb|CAJ10104.1| Signal peptidase II, family A8 [Brucella melitensis biovar Abortus
           2308]
 gi|148370965|gb|ABQ60944.1| signal peptidase II [Brucella ovis ATCC 25840]
 gi|161334948|gb|ABX61253.1| signal peptidase II [Brucella canis ATCC 23365]
 gi|163673142|gb|ABY37253.1| signal peptidase II [Brucella suis ATCC 23445]
 gi|189018974|gb|ACD71696.1| Signal peptidase II, family A8 [Brucella abortus S19]
 gi|225640048|gb|ACN99961.1| signal peptidase II [Brucella melitensis ATCC 23457]
 gi|255998771|gb|ACU47170.1| lipoprotein signal peptidase [Brucella microti CCM 4915]
 gi|260669547|gb|EEX56487.1| signal peptidase II [Brucella abortus bv. 4 str. 292]
 gi|260671383|gb|EEX58204.1| signal peptidase II [Brucella abortus bv. 2 str. 86/8/59]
 gi|260676113|gb|EEX62934.1| signal peptidase II [Brucella abortus bv. 6 str. 870]
 gi|260874553|gb|EEX81622.1| lipoprotein signal peptidase [Brucella abortus bv. 9 str. C68]
 gi|260916888|gb|EEX83749.1| signal peptidase II [Brucella abortus bv. 3 str. Tulya]
 gi|260919960|gb|EEX86613.1| lipoprotein signal peptidase [Brucella ceti B1/94]
 gi|260923239|gb|EEX89807.1| lipoprotein signal peptidase [Brucella ceti M13/05/1]
 gi|261293692|gb|EEX97188.1| lipoprotein signal peptidase [Brucella ceti M644/93/1]
 gi|261296030|gb|EEX99526.1| lipoprotein signal peptidase [Brucella pinnipedialis B2/94]
 gi|261303662|gb|EEY07159.1| lipoprotein signal peptidase [Brucella pinnipedialis M163/99/10]
 gi|261741230|gb|EEY29156.1| lipoprotein signal peptidase [Brucella suis bv. 5 str. 513]
 gi|261745792|gb|EEY33718.1| lipoprotein signal peptidase [Brucella suis bv. 3 str. 686]
 gi|262551805|gb|EEZ07795.1| lipoprotein signal peptidase [Brucella ceti M490/95/1]
 gi|262765075|gb|EEZ10996.1| lipoprotein signal peptidase [Brucella melitensis bv. 3 str. Ether]
 gi|263003417|gb|EEZ15710.1| lipoprotein signal peptidase [Brucella melitensis bv. 1 str. Rev.1]
 gi|264660074|gb|EEZ30335.1| lipoprotein signal peptidase [Brucella pinnipedialis M292/94/1]
 gi|326408170|gb|ADZ65235.1| Signal peptidase II, family A8 [Brucella melitensis M28]
 gi|326537883|gb|ADZ86098.1| signal peptidase II [Brucella melitensis M5-90]
          Length = 160

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 40/101 (39%), Positives = 67/101 (66%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           ML+ +    L++I + +IAF+ ++W  N   +     G+ L+  GA+GN++D  ++GYV+
Sbjct: 57  MLAWLHDGGLIAITLAVIAFVLYLWWTNAPERVFARYGFALVIGGAIGNLIDRVMHGYVV 116

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
           DY++ H  TWSFAVFNLAD FI+IG  +II ++ +   R++
Sbjct: 117 DYVLFHLPTWSFAVFNLADAFITIGAGLIILEEFLGWRRER 157


>gi|229918561|ref|YP_002887207.1| lipoprotein signal peptidase [Exiguobacterium sp. AT1b]
 gi|229469990|gb|ACQ71762.1| lipoprotein signal peptidase [Exiguobacterium sp. AT1b]
          Length = 157

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 23/103 (22%), Positives = 48/103 (46%), Gaps = 1/103 (0%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           ML          I IL++A + +   K      +      L+  GA+GN +D    G V+
Sbjct: 53  MLEG-QMAFFFIITILVVAGLVYFLHKEVNGYQLLGYSVGLLLAGAIGNFIDRLFRGEVV 111

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
           D++  +   ++F +FN+AD+ ++ G  +++   +  +   K +
Sbjct: 112 DFVDTYPFGYNFPIFNVADMALTFGVILMVIGILFEEKLHKER 154


>gi|114564619|ref|YP_752133.1| lipoprotein signal peptidase [Shewanella frigidimarina NCIMB 400]
 gi|117676259|ref|YP_863835.1| signal peptidase II [Shewanella sp. ANA-3]
 gi|114335912|gb|ABI73294.1| signal peptidase II. Aspartic peptidase. MEROPS family A08
           [Shewanella frigidimarina NCIMB 400]
 gi|117615083|gb|ABK50536.1| signal peptidase II. Aspartic peptidase. MEROPS family A08
           [Shewanella sp. ANA-3]
          Length = 359

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 25/88 (28%), Positives = 46/88 (52%), Gaps = 2/88 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  +++ +++ A++  +  +  +   +  +GY LI  GALGNV D  L G V+D++
Sbjct: 258 GWQRYFFITLGLVVSAWLGRMLCQ--QLPRLEAMGYSLILGGALGNVADRVLRGQVVDFL 315

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIY 91
             H +   +  FNLAD+ I+IG   +  
Sbjct: 316 DFHWRLAHWPAFNLADVAITIGALCLFL 343


>gi|319639053|ref|ZP_07993810.1| lipoprotein signal peptidase [Neisseria mucosa C102]
 gi|317399631|gb|EFV80295.1| lipoprotein signal peptidase [Neisseria mucosa C102]
          Length = 168

 Score = 92.8 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 23/95 (24%), Positives = 51/95 (53%), Gaps = 1/95 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + + ++I  ++     ++   +    +G  +I  GA+GNVVD  ++G+V+D++
Sbjct: 66  GWQKFFFLGLAVIISLYLARAIWRDEFGRW-GKLGAAMIIGGAIGNVVDRLIHGHVVDFL 124

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
           + + Q W +  FN+AD FI +G   ++ D ++ + 
Sbjct: 125 LFYWQNWFYPAFNIADSFICVGAVCLVLDGLLHKK 159


>gi|294669424|ref|ZP_06734502.1| signal peptidase II [Neisseria elongata subsp. glycolytica ATCC
           29315]
 gi|291308677|gb|EFE49920.1| signal peptidase II [Neisseria elongata subsp. glycolytica ATCC
           29315]
          Length = 171

 Score = 92.8 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 22/100 (22%), Positives = 52/100 (52%), Gaps = 1/100 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + +  ++  ++    +KN         G +++  GA+GNV+D  ++G V+D++
Sbjct: 66  GWQKYFFIVLAAIVCLWLVNAVRKNEFGPW-GSWGAVMVIGGAVGNVIDRFIHGKVVDFL 124

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
           + + + W++  FN+AD FI +G  +++ D  I +   + +
Sbjct: 125 LFYGEGWAYPAFNVADSFICVGAVLLVIDGFINKRPSEKE 164


>gi|270159966|ref|ZP_06188622.1| lipoprotein signal peptidase LspA [Legionella longbeachae D-4968]
 gi|289165290|ref|YP_003455428.1| Lipoprotein signal peptidase [Legionella longbeachae NSW150]
 gi|269988305|gb|EEZ94560.1| lipoprotein signal peptidase LspA [Legionella longbeachae D-4968]
 gi|288858463|emb|CBJ12341.1| Lipoprotein signal peptidase [Legionella longbeachae NSW150]
          Length = 154

 Score = 92.8 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 43/95 (45%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
           +       +   ++   +     K      +   G  LI  GA+GN+ D  L+GYVID+I
Sbjct: 60  DWHRWFFAAFSFIVSIILAVWLYKGENQTCLLSTGISLILGGAIGNLFDRALHGYVIDFI 119

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
            ++ +   FA FN+AD  I +G    + D  I + 
Sbjct: 120 DLYYKNHHFATFNIADSAICLGAGFFVLDVFINKK 154


>gi|110834230|ref|YP_693089.1| lipoprotein signal peptidase [Alcanivorax borkumensis SK2]
 gi|110647341|emb|CAL16817.1| signal peptidase II [Alcanivorax borkumensis SK2]
          Length = 136

 Score = 92.8 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 24/95 (25%), Positives = 44/95 (46%), Gaps = 2/95 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                 L+ I +++  F+  +  +N          Y LI  GA+GN++D    GYV+D  
Sbjct: 33  GWQRYFLIGIAVVVSIFLIKLILENR--HKGEAFAYSLILGGAMGNLIDRIFRGYVVDSF 90

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
             + + W +  FNLAD+ I  G  + +   ++ + 
Sbjct: 91  DFYWRDWHWPAFNLADIAIVTGALLFVSGSLLGEK 125


>gi|217978993|ref|YP_002363140.1| lipoprotein signal peptidase [Methylocella silvestris BL2]
 gi|254810450|sp|B8ETD6|LSPA_METSB RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|217504369|gb|ACK51778.1| lipoprotein signal peptidase [Methylocella silvestris BL2]
          Length = 171

 Score = 92.8 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 27/95 (28%), Positives = 43/95 (45%), Gaps = 2/95 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
           +     L+ + +    F+     +   T  +      LI  GALGN  D   YG+V D+ 
Sbjct: 63  DFQRYALLGLTLAATIFMILWLWR--STSKLIACALGLIIGGALGNAYDRAAYGFVADFY 120

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
             H  ++S+ VFNLAD  I  G  +++YD +    
Sbjct: 121 HFHVGSFSWYVFNLADAAIVAGVALLLYDSLFSAR 155


>gi|108760550|ref|YP_632124.1| signal peptidase II [Myxococcus xanthus DK 1622]
 gi|3717985|emb|CAA11250.1| SPase II [Myxococcus xanthus]
 gi|108464430|gb|ABF89615.1| signal peptidase II [Myxococcus xanthus DK 1622]
          Length = 171

 Score = 92.8 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 22/105 (20%), Positives = 42/105 (40%), Gaps = 5/105 (4%)

Query: 1   MLSN----VSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLY 56
           + S+            +  + I  +   +   P T  +       +  GALGN VD    
Sbjct: 63  LFSSFGEEWRMPFFYVVGAICIVLLIGYYFYTPPTMKLQRWSLATMIGGALGNYVDRVRL 122

Query: 57  GYVIDYIMIHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
            YV+D++  H    + +  FN+AD  + +G  ++I +      +Q
Sbjct: 123 RYVVDFVSWHVGDRFYWPSFNIADTAVVVGAALMILESFREPRQQ 167


>gi|258541834|ref|YP_003187267.1| lipoprotein signal peptidase [Acetobacter pasteurianus IFO 3283-01]
 gi|256632912|dbj|BAH98887.1| lipoprotein signal peptidase [Acetobacter pasteurianus IFO 3283-01]
 gi|256635969|dbj|BAI01938.1| lipoprotein signal peptidase [Acetobacter pasteurianus IFO 3283-03]
 gi|256639024|dbj|BAI04986.1| lipoprotein signal peptidase [Acetobacter pasteurianus IFO 3283-07]
 gi|256642078|dbj|BAI08033.1| lipoprotein signal peptidase [Acetobacter pasteurianus IFO 3283-22]
 gi|256645133|dbj|BAI11081.1| lipoprotein signal peptidase [Acetobacter pasteurianus IFO 3283-26]
 gi|256648188|dbj|BAI14129.1| lipoprotein signal peptidase [Acetobacter pasteurianus IFO 3283-32]
 gi|256651241|dbj|BAI17175.1| lipoprotein signal peptidase [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256654232|dbj|BAI20159.1| lipoprotein signal peptidase [Acetobacter pasteurianus IFO 3283-12]
          Length = 171

 Score = 92.8 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 25/100 (25%), Positives = 47/100 (47%), Gaps = 2/100 (2%)

Query: 7   PTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIH 66
             +  +I + +   +     + P    +       IT GA+GNV+D   YG V+D++  H
Sbjct: 73  RIVFSAIALAVACCLLVWIFRTPS--KLTAACVGAITGGAIGNVMDRVRYGAVVDFLHAH 130

Query: 67  TQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDF 106
              WS+ VFN+AD  I    C+++  + +   +Q+  +  
Sbjct: 131 AFGWSWYVFNVADSAIVCAVCMLLVQNFLAGGQQQDNVKT 170


>gi|124516588|gb|EAY58096.1| Signal peptidase II [Leptospirillum rubarum]
          Length = 179

 Score = 92.8 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 21/98 (21%), Positives = 40/98 (40%), Gaps = 4/98 (4%)

Query: 1   MLSNVSPT----ILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLY 56
           +  + +      I + + I  I  I +   +  +   +      +I  GALGN+ D  L 
Sbjct: 67  LFQDPNGWVHRLIFIVLTIAAIGLILYYSHRRKRECGLEFYPLSIILGGALGNLSDRILK 126

Query: 57  GYVIDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDI 94
           G V+D++        +  FN+AD  I +G   ++    
Sbjct: 127 GRVVDFLDFSFHGHHWPAFNVADSAIVVGVLFLLLIQF 164


>gi|262197670|ref|YP_003268879.1| lipoprotein signal peptidase [Haliangium ochraceum DSM 14365]
 gi|262081017|gb|ACY16986.1| lipoprotein signal peptidase [Haliangium ochraceum DSM 14365]
          Length = 180

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 23/108 (21%), Positives = 51/108 (47%), Gaps = 1/108 (0%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           + S      L  + +L +  +F++  +    ++   +G  L+  GA+GN+VD  L+G V 
Sbjct: 66  LFSG-ERVFLTVVGLLAVGIVFYMVYRARNDQTKLALGLGLVAGGAIGNLVDRILFGKVT 124

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDFPQ 108
           D+++       +  FN+AD+ + IG  ++  D       +  + +  +
Sbjct: 125 DFVVWKYYETEWPTFNIADVALVIGVGLLFLDMWSEMKLEAQENEKAK 172


>gi|308173507|ref|YP_003920212.1| signal peptidase II [Bacillus amyloliquefaciens DSM 7]
 gi|307606371|emb|CBI42742.1| signal peptidase II [Bacillus amyloliquefaciens DSM 7]
 gi|328553561|gb|AEB24053.1| lipoprotein signal peptidase [Bacillus amyloliquefaciens TA208]
 gi|328911646|gb|AEB63242.1| signal peptidase II [Bacillus amyloliquefaciens LL3]
          Length = 153

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 21/98 (21%), Positives = 44/98 (44%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
                  I I +I  I +  ++  K + +  I   L+  GA GN +D      V+D+I +
Sbjct: 56  QMWFFYVITIAVIIGIVYYIQRYAKGQMLLGISLGLMLGGAAGNFIDRAARQEVVDFIHV 115

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
               + + +FN+AD  + +G  ++    +    ++K +
Sbjct: 116 IIVNYQYPIFNIADSSLCVGVILLFIHMLFDSGKKKEQ 153


>gi|242279475|ref|YP_002991604.1| lipoprotein signal peptidase [Desulfovibrio salexigens DSM 2638]
 gi|259495130|sp|C6BV90|LSPA_DESAD RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|242122369|gb|ACS80065.1| lipoprotein signal peptidase [Desulfovibrio salexigens DSM 2638]
          Length = 156

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 21/93 (22%), Positives = 41/93 (44%)

Query: 5   VSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIM 64
                 V + I+ +  I  + K   +      +G   +  GA+GN++D  LY  V D++ 
Sbjct: 64  WQRNFFVVVTIIALGAIGMLLKSAEEKDKFQILGLGFVLGGAIGNLIDRILYHQVTDFLD 123

Query: 65  IHTQTWSFAVFNLADLFISIGTCIIIYDDIILQ 97
            +  +  +  FN+AD+ I +G   +I      +
Sbjct: 124 FYYGSHHYPAFNVADIAICLGAFAMIVSFYKNK 156


>gi|229588315|ref|YP_002870434.1| lipoprotein signal peptidase [Pseudomonas fluorescens SBW25]
 gi|229360181|emb|CAY47038.1| lipoprotein signal peptidase [Pseudomonas fluorescens SBW25]
          Length = 170

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 25/96 (26%), Positives = 45/96 (46%), Gaps = 1/96 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +   I +++ A +    K+  +  +   +   L+  GALGN+ D    G+VID+I
Sbjct: 68  GWQRWLFAVIALVVSAVLVVWLKRLGRDDTWLAVALALVLGGALGNLYDRIALGHVIDFI 127

Query: 64  MIHTQTWS-FAVFNLADLFISIGTCIIIYDDIILQH 98
           ++H Q    F  FN AD  I++G  ++  D    + 
Sbjct: 128 LVHWQNRHYFPAFNFADSAITVGAIMLALDMFKSKK 163


>gi|121634250|ref|YP_974495.1| lipoprotein signal peptidase [Neisseria meningitidis FAM18]
 gi|218767583|ref|YP_002342095.1| lipoprotein signal peptidase [Neisseria meningitidis Z2491]
 gi|54037759|sp|P65265|LSPA_NEIMB RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|54041423|sp|P65264|LSPA_NEIMA RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|152032421|sp|A1KS63|LSPA_NEIMF RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|120865956|emb|CAM09693.1| putative lipoprotein signal peptidase [Neisseria meningitidis
           FAM18]
 gi|121051591|emb|CAM07889.1| putative lipoprotein signal peptidase [Neisseria meningitidis
           Z2491]
 gi|316984439|gb|EFV63412.1| signal peptidase II [Neisseria meningitidis H44/76]
 gi|325127581|gb|EGC50504.1| signal peptidase II [Neisseria meningitidis N1568]
 gi|325133567|gb|EGC56229.1| signal peptidase II [Neisseria meningitidis M13399]
 gi|325137585|gb|EGC60166.1| signal peptidase II [Neisseria meningitidis ES14902]
 gi|325141636|gb|EGC64098.1| signal peptidase II [Neisseria meningitidis 961-5945]
 gi|325197665|gb|ADY93121.1| signal peptidase II [Neisseria meningitidis G2136]
 gi|325200893|gb|ADY96348.1| signal peptidase II [Neisseria meningitidis H44/76]
          Length = 165

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 26/100 (26%), Positives = 55/100 (55%), Gaps = 1/100 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + + + + A++     ++    ++   G  +I  GALGNV+D  ++G+V+D++
Sbjct: 66  GWQKYFFLVLAVAVSAYLVRAILRDEFA-TLGKTGAAMIIGGALGNVIDRLIHGHVVDFL 124

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
           + + Q W +  FN+AD FI +G  + + D+I+ +  Q+ K
Sbjct: 125 LFYWQNWFYPAFNIADSFICVGAVLAVLDNIVHRKTQEEK 164


>gi|182677993|ref|YP_001832139.1| lipoprotein signal peptidase [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|238058043|sp|B2II67|LSPA_BEII9 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|182633876|gb|ACB94650.1| lipoprotein signal peptidase [Beijerinckia indica subsp. indica
           ATCC 9039]
          Length = 167

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 44/96 (45%), Gaps = 2/96 (2%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S +   ILV++ +  I  +     +   T  +  +    I  GALGN +D    G V D+
Sbjct: 62  SAMGRWILVALTLFAILLLSIWLWR--ATNRLVALALGCIIGGALGNAIDRIAAGAVADF 119

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
              H  ++S+ VFNLAD  I  G  ++I D    + 
Sbjct: 120 YYFHIGSFSWYVFNLADAAIVAGVALLILDAFTSEE 155


>gi|213155623|ref|YP_002317668.1| ISPpu12 lipoprotein signal peptidase [Acinetobacter baumannii
           AB0057]
 gi|213155666|ref|YP_002317711.1| ISPpu12 lipoprotein signal peptidase [Acinetobacter baumannii
           AB0057]
 gi|213054783|gb|ACJ39685.1| ISPpu12 lipoprotein signal peptidase [Acinetobacter baumannii
           AB0057]
 gi|213054826|gb|ACJ39728.1| ISPpu12 lipoprotein signal peptidase [Acinetobacter baumannii
           AB0057]
          Length = 136

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 24/95 (25%), Positives = 45/95 (47%), Gaps = 2/95 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + I +++  F+  +  +N        I Y LI  GA+GN++D    GYV+D  
Sbjct: 33  GWQRYFFIGIAVVVSIFLIKLILENR--HKGEAIAYSLILGGAMGNLIDRVFRGYVVDSF 90

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
             + + W +  FNLAD+ I +G  + +   ++ + 
Sbjct: 91  DFYWRDWHWPAFNLADIAIVLGALLFVSSSLLGKK 125


>gi|283850383|ref|ZP_06367672.1| lipoprotein signal peptidase [Desulfovibrio sp. FW1012B]
 gi|283574409|gb|EFC22380.1| lipoprotein signal peptidase [Desulfovibrio sp. FW1012B]
          Length = 163

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 19/99 (19%), Positives = 45/99 (45%)

Query: 5   VSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIM 64
                  +   L +  I  + +       +  +G   I  GA+GN++D    G V+D++ 
Sbjct: 65  WQTYFFFAATALAVMIIVHLLRMARDDDKLLVMGLGSILGGAIGNLIDRIKTGQVVDFLD 124

Query: 65  IHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
            + +++ +  FN+AD+ I +G+  ++     ++    G+
Sbjct: 125 FYWKSYHWPAFNVADIAIFLGSLALLVAFYRMRRPASGR 163


>gi|308389935|gb|ADO32255.1| lipoprotein signal peptidase [Neisseria meningitidis alpha710]
          Length = 175

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 26/100 (26%), Positives = 55/100 (55%), Gaps = 1/100 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + + + + A++     ++    ++   G  +I  GALGNV+D  ++G+V+D++
Sbjct: 76  GWQKYFFLVLAVAVSAYLVRAILRDEFA-TLGKTGAAMIIGGALGNVIDRLIHGHVVDFL 134

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
           + + Q W +  FN+AD FI +G  + + D+I+ +  Q+ K
Sbjct: 135 LFYWQNWFYPAFNIADSFICVGAVLAVLDNIVHRKTQEEK 174


>gi|116747574|ref|YP_844261.1| lipoprotein signal peptidase [Syntrophobacter fumaroxidans MPOB]
 gi|116696638|gb|ABK15826.1| signal peptidase II. Aspartic peptidase. MEROPS family A08
           [Syntrophobacter fumaroxidans MPOB]
          Length = 153

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 27/101 (26%), Positives = 51/101 (50%), Gaps = 4/101 (3%)

Query: 1   MLSN----VSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLY 56
           ML+           V++ ++++  I + ++K  + +      Y LI  GALGN+ D   +
Sbjct: 53  MLAGADATWRLPFFVAMTLIVVGIIVWAYRKIDRRELWTRTAYALICGGALGNLSDRLRF 112

Query: 57  GYVIDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQ 97
           G V+D++  H  T+S+  FN+ D  IS G  ++I   +  +
Sbjct: 113 GEVVDFLEFHIGTYSWPAFNVGDSAISAGAVMLIIALLRGK 153


>gi|288941694|ref|YP_003443934.1| lipoprotein signal peptidase [Allochromatium vinosum DSM 180]
 gi|288897066|gb|ADC62902.1| lipoprotein signal peptidase [Allochromatium vinosum DSM 180]
          Length = 161

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 21/100 (21%), Positives = 46/100 (46%), Gaps = 6/100 (6%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  V + +++   +    ++ P  + +      LI  GA+GN++D  L G+V+D+I
Sbjct: 58  GWQRWFFVVLALIVSGVLVGWLRRLPAHERLHAAALALIIGGAVGNLIDRALLGHVVDFI 117

Query: 64  MIHTQTW------SFAVFNLADLFISIGTCIIIYDDIILQ 97
            ++           +  FN+AD  I+IG  +++   +  +
Sbjct: 118 QVYLPVIPLAIFNPWPAFNIADSAITIGVVLLLLATLRTE 157


>gi|254468865|ref|ZP_05082271.1| signal peptidase II [beta proteobacterium KB13]
 gi|207087675|gb|EDZ64958.1| signal peptidase II [beta proteobacterium KB13]
          Length = 151

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 25/97 (25%), Positives = 52/97 (53%), Gaps = 1/97 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S       + + + I+ ++ +++++N        I  +LI +GA+GN++D  L G+V D+
Sbjct: 56  SGWQNNFFILLTLAILTYLIYLYRQNIS-SPYGSISIMLIISGAIGNLIDRFLNGHVTDF 114

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
           I +H   + +  FN+AD  I+IG  I +   +  + +
Sbjct: 115 IYLHINEYYWPAFNVADSAITIGAIIYLLGLLKGKIK 151


>gi|240124951|ref|ZP_04737837.1| lipoprotein signal peptidase [Neisseria gonorrhoeae SK-92-679]
          Length = 188

 Score = 92.0 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 25/99 (25%), Positives = 53/99 (53%), Gaps = 1/99 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + + + + A++     ++    ++  IG  +I  GA GNV+D  ++G+V+D++
Sbjct: 90  GWQKYFFLVLAVAVSAYLVRAILRDEFA-ALGKIGAAMIIGGASGNVIDRLIHGHVVDFL 148

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           + + Q W +  FN+AD FI +G  + + D+I+ +   K 
Sbjct: 149 LFYWQNWFYPAFNIADSFICVGAVLAVLDNIVHRKDSKK 187


>gi|146329202|ref|YP_001209015.1| signal peptidase II [Dichelobacter nodosus VCS1703A]
 gi|172047323|sp|A5EWT1|LSPA_DICNV RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|146232672|gb|ABQ13650.1| signal peptidase II [Dichelobacter nodosus VCS1703A]
          Length = 154

 Score = 92.0 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 24/91 (26%), Positives = 46/91 (50%), Gaps = 1/91 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +      ++  ++            +  + Y  I  GA+GN+ D  +YGYVID+I
Sbjct: 62  GWQRWLFAGFAGIVALWLIMTLL-TKSHHWLMSVSYACILGGAVGNLYDRVVYGYVIDFI 120

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDI 94
             H +T+ + VFNLAD+ I++G  +++  ++
Sbjct: 121 QWHYRTFYWPVFNLADVAITLGVILMLIAEL 151


>gi|119385441|ref|YP_916497.1| lipoprotein signal peptidase [Paracoccus denitrificans PD1222]
 gi|119375208|gb|ABL70801.1| signal peptidase II, Aspartic peptidase, MEROPS family A08
           [Paracoccus denitrificans PD1222]
          Length = 227

 Score = 92.0 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 24/89 (26%), Positives = 41/89 (46%), Gaps = 2/89 (2%)

Query: 5   VSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIM 64
           V   +L+ I + +  ++     +  K      +   L+  GALGNVVD   YG V D++ 
Sbjct: 89  VMRWVLIGIALAVCLWVGIWIGRA-KPSRFAQVSAGLLIGGALGNVVDRLTYGAVADFLN 147

Query: 65  IHTQTWSFA-VFNLADLFISIGTCIIIYD 92
           +    W     FN+AD+ I +G   ++  
Sbjct: 148 MSLPGWRNPYSFNVADIAIFLGAMGLVLL 176


>gi|325204794|gb|ADZ00248.1| signal peptidase II [Neisseria meningitidis M01-240355]
          Length = 165

 Score = 92.0 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 26/100 (26%), Positives = 55/100 (55%), Gaps = 1/100 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + + + + A++     ++    ++   G  +I  GALGNV+D  ++G+V+D++
Sbjct: 66  GWQKYFFLVLAVAVSAYLVRAILRDEFA-ALGKTGAAMIIGGALGNVIDRLIHGHVVDFL 124

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
           + + Q W +  FN+AD FI +G  + + D+I+ +  Q+ K
Sbjct: 125 LFYWQNWFYPAFNIADSFICVGAVLAVLDNIVHRKTQEEK 164


>gi|157964489|ref|YP_001499313.1| lipoprotein signal peptidase [Rickettsia massiliae MTU5]
 gi|157844265|gb|ABV84766.1| Lipoprotein signal peptidase [Rickettsia massiliae MTU5]
          Length = 302

 Score = 92.0 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 35/108 (32%), Positives = 57/108 (52%), Gaps = 6/108 (5%)

Query: 5   VSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIM 64
            S  I +    +I+ +++++  ++    S   +GY  +  GA+GN++D    G V D+I 
Sbjct: 156 YSNAIFLITNTIIVCYLYYLMIRSKTIGSF--VGYSFVIGGAVGNLIDRFFRGAVFDFIH 213

Query: 65  IHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH----RQKGKIDFPQ 108
            H Q +SF VFNLAD FI+IG  I+I D    +     + KG  D  +
Sbjct: 214 FHYQNYSFPVFNLADCFITIGVIILIEDYYSTKKVIEEKAKGNYDNAK 261


>gi|114706461|ref|ZP_01439363.1| Signal peptidase II, family A8 [Fulvimarina pelagi HTCC2506]
 gi|114538322|gb|EAU41444.1| Signal peptidase II, family A8 [Fulvimarina pelagi HTCC2506]
          Length = 168

 Score = 92.0 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 36/104 (34%), Positives = 63/104 (60%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           M ++  P  L  +  +++  + ++W K P  + +      ++  GA+GN++D  L GYV+
Sbjct: 58  MFADTGPLGLALLAGVVLVAVLYLWVKTPPDRKLTHFALAIVVGGAIGNLIDRLLLGYVV 117

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
           DY+  HT  + FAVFNLAD FIS+G  +I+ D+I+L   ++ +I
Sbjct: 118 DYVFFHTPLFEFAVFNLADSFISVGAFLIVLDEIVLTPMRERRI 161


>gi|110347209|ref|YP_666027.1| signal peptidase II [Mesorhizobium sp. BNC1]
 gi|110283320|gb|ABG61380.1| signal peptidase II, Aspartic peptidase, MEROPS family A08
           [Chelativorans sp. BNC1]
          Length = 123

 Score = 92.0 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 29/92 (31%), Positives = 47/92 (51%), Gaps = 2/92 (2%)

Query: 7   PTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIH 66
           P +L  I+++I+A +     + PK   +  +G  LI  GA+GN+VD    G V D++  H
Sbjct: 33  PLMLAGIKMVIVAGLLLWAMRTPK--PLEMVGLGLIAGGAMGNIVDRISQGAVTDFLDFH 90

Query: 67  TQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
              W +  FN+AD  I+IG  ++I        
Sbjct: 91  VGRWHWPAFNMADTMITIGVVLLIAGSFWPVR 122


>gi|15677668|ref|NP_274829.1| lipoprotein signal peptidase [Neisseria meningitidis MC58]
 gi|254804339|ref|YP_003082560.1| Lipoprotein signal peptidase [Neisseria meningitidis alpha14]
 gi|7227086|gb|AAF42167.1| signal peptidase II [Neisseria meningitidis MC58]
 gi|254667881|emb|CBA03975.1| Lipoprotein signal peptidase [Neisseria meningitidis alpha14]
 gi|254673173|emb|CBA08038.1| Lipoprotein signal peptidase [Neisseria meningitidis alpha275]
 gi|319409845|emb|CBY90154.1| lipoprotein signal peptidase (prolipoprotein signal peptidase;
           signal peptidase II; SPase II) [Neisseria meningitidis
           WUE 2594]
 gi|325131480|gb|EGC54187.1| signal peptidase II [Neisseria meningitidis M6190]
 gi|325135618|gb|EGC58235.1| signal peptidase II [Neisseria meningitidis M0579]
 gi|325139652|gb|EGC62191.1| signal peptidase II [Neisseria meningitidis CU385]
 gi|325143834|gb|EGC66150.1| signal peptidase II [Neisseria meningitidis M01-240013]
 gi|325206748|gb|ADZ02201.1| signal peptidase II [Neisseria meningitidis M04-240196]
          Length = 175

 Score = 92.0 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 26/100 (26%), Positives = 55/100 (55%), Gaps = 1/100 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + + + + A++     ++    ++   G  +I  GALGNV+D  ++G+V+D++
Sbjct: 76  GWQKYFFLVLAVAVSAYLVRAILRDEFA-TLGKTGAAMIIGGALGNVIDRLIHGHVVDFL 134

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
           + + Q W +  FN+AD FI +G  + + D+I+ +  Q+ K
Sbjct: 135 LFYWQNWFYPAFNIADSFICVGAVLAVLDNIVHRKTQEEK 174


>gi|241760245|ref|ZP_04758341.1| signal peptidase II [Neisseria flavescens SK114]
 gi|241319356|gb|EER55821.1| signal peptidase II [Neisseria flavescens SK114]
          Length = 204

 Score = 92.0 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 23/95 (24%), Positives = 50/95 (52%), Gaps = 1/95 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + + ++I  ++     ++   +     G  +I  GA+GNVVD  ++G+V+D++
Sbjct: 102 GWQKFFFLGLAVVISLYLARAILRDEFGRW-GKPGAAMIIGGAIGNVVDRLIHGHVVDFL 160

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
           + + Q W +  FN+AD FI +G   ++ D ++ + 
Sbjct: 161 LFYWQNWFYPAFNIADSFICVGAVCLVIDGLLHKK 195


>gi|330811819|ref|YP_004356281.1| Signal peptidase II [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327379927|gb|AEA71277.1| Signal peptidase II [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 170

 Score = 92.0 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 48/97 (49%), Gaps = 1/97 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S     +   I +++ A +    K+  + ++   +   L+  GALGN+ D    G+VID+
Sbjct: 67  SGWQRWLFALIAVVVSAVLVVWLKRLGRNETWLAVALALVLGGALGNLYDRIALGHVIDF 126

Query: 63  IMIHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQH 98
           I++H Q  W F  FN AD  IS+G  ++  D    + 
Sbjct: 127 ILVHWQNRWYFPAFNFADSAISVGAVMLALDMFKSKK 163


>gi|223984555|ref|ZP_03634686.1| hypothetical protein HOLDEFILI_01981 [Holdemania filiformis DSM
           12042]
 gi|223963483|gb|EEF67864.1| hypothetical protein HOLDEFILI_01981 [Holdemania filiformis DSM
           12042]
          Length = 158

 Score = 92.0 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 22/93 (23%), Positives = 45/93 (48%)

Query: 9   ILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQ 68
               I  + +    +   K  K ++   +  +L+  GALGN++D   + YV D++     
Sbjct: 65  FFYIITAVAVVGFSWYLWKTDKKETWTRLATVLVIGGALGNLIDRVAFHYVRDFLDFIIF 124

Query: 69  TWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
            + F +FN+AD+ + +G  ++I   +I    +K
Sbjct: 125 GYDFPIFNVADMALCVGVGLLILITLIRPEGEK 157


>gi|118617188|ref|YP_905520.1| lipoprotein signal peptidase LspA [Mycobacterium ulcerans Agy99]
 gi|118569298|gb|ABL04049.1| lipoprotein signal peptidase LspA [Mycobacterium ulcerans Agy99]
          Length = 309

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 22/95 (23%), Positives = 44/95 (46%), Gaps = 12/95 (12%)

Query: 7   PTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCL------YGYVI 60
             +L  I   ++  IF++ ++       + +G  +I  GA+GN+VD          G+V+
Sbjct: 206 TWVLTLIATGVVVGIFWMGRRL--VSPWWAVGLGMILGGAMGNLVDRFFRAPGPLRGHVV 263

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDII 95
           D+  +      + VFN+AD  +  G  +++   I 
Sbjct: 264 DFFSVGW----WPVFNVADPSVVGGAILLVILSIF 294


>gi|330954240|gb|EGH54500.1| lipoprotein signal peptidase [Pseudomonas syringae Cit 7]
          Length = 168

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 49/97 (50%), Gaps = 1/97 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +     +   I +++ A +    K+  +  +   +   L+  GALGN+ D  + G+VID+
Sbjct: 65  AGWQRWLFALIAVVVSAVLVVWLKRLGRDDTWLAVALALVLGGALGNLYDRIVLGHVIDF 124

Query: 63  IMIHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQH 98
           I++H Q  W F  FN+AD  I++G  ++  D    + 
Sbjct: 125 ILVHWQNRWYFPAFNVADSAITVGAIMLALDMFKSKK 161


>gi|149182320|ref|ZP_01860798.1| signal peptidase II [Bacillus sp. SG-1]
 gi|148849939|gb|EDL64111.1| signal peptidase II [Bacillus sp. SG-1]
          Length = 164

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 25/98 (25%), Positives = 49/98 (50%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
                  I I +I  I +  +K  K   +F I   L+  GA+GN +D      V+D++  
Sbjct: 56  QMWFFYIITIAVIIGIVYYLEKQAKGDKLFSISLALLLGGAIGNFIDRLFRKEVVDFLNT 115

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
           +   + F +FN+AD  ++ G  ++I + ++ + R+K +
Sbjct: 116 YIFQYDFPIFNIADAALTFGVGLLIINMLLEERREKKE 153


>gi|85706994|ref|ZP_01038083.1| lipoprotein signal peptidase [Roseovarius sp. 217]
 gi|85668435|gb|EAQ23307.1| lipoprotein signal peptidase [Roseovarius sp. 217]
          Length = 164

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 20/98 (20%), Positives = 42/98 (42%), Gaps = 2/98 (2%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           +L       L  + + +  ++  +  +         I Y  I  GALGNV+D   +  V 
Sbjct: 64  LLGGAPWWSLTVLALAVCGWLTVMLLRT--DNRAEAIAYGAIIGGALGNVLDRIRFRGVT 121

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
           D++  +  +  +  FN+AD+F+  G  +++    +   
Sbjct: 122 DFLDFYVGSTHWPAFNMADVFVVSGVGLLLIAPWLSAK 159


>gi|302185240|ref|ZP_07261913.1| lipoprotein signal peptidase [Pseudomonas syringae pv. syringae
           642]
 gi|330901413|gb|EGH32832.1| lipoprotein signal peptidase [Pseudomonas syringae pv. japonica
           str. M301072PT]
          Length = 168

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 49/97 (50%), Gaps = 1/97 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +     +   I +++ A +    K+  +  +   +   L+  GALGN+ D  + G+VID+
Sbjct: 65  AGWQRWLFALIAVVVSAVLVVWLKRLGRDDTWLAVALALVLGGALGNLYDRIVLGHVIDF 124

Query: 63  IMIHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQH 98
           I++H Q  W F  FN+AD  I++G  ++  D    + 
Sbjct: 125 ILVHWQNRWYFPAFNVADSAITVGAIMLALDMFKSKK 161


>gi|239998203|ref|ZP_04718127.1| lipoprotein signal peptidase [Neisseria gonorrhoeae 35/02]
 gi|240013386|ref|ZP_04720299.1| lipoprotein signal peptidase [Neisseria gonorrhoeae DGI18]
 gi|240079965|ref|ZP_04724508.1| lipoprotein signal peptidase [Neisseria gonorrhoeae FA19]
 gi|268683530|ref|ZP_06150392.1| lipoprotein signal peptidase [Neisseria gonorrhoeae SK-92-679]
 gi|268623814|gb|EEZ56214.1| lipoprotein signal peptidase [Neisseria gonorrhoeae SK-92-679]
          Length = 167

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 25/99 (25%), Positives = 53/99 (53%), Gaps = 1/99 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + + + + A++     ++    ++  IG  +I  GA GNV+D  ++G+V+D++
Sbjct: 69  GWQKYFFLVLAVAVSAYLVRAILRDEFA-ALGKIGAAMIIGGASGNVIDRLIHGHVVDFL 127

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           + + Q W +  FN+AD FI +G  + + D+I+ +   K 
Sbjct: 128 LFYWQNWFYPAFNIADSFICVGAVLAVLDNIVHRKDSKK 166


>gi|262163905|ref|ZP_06031644.1| lipoprotein signal peptidase [Vibrio mimicus VM223]
 gi|262027433|gb|EEY46099.1| lipoprotein signal peptidase [Vibrio mimicus VM223]
          Length = 80

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 28/74 (37%), Positives = 43/74 (58%)

Query: 25 WKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQTWSFAVFNLADLFISI 84
           ++ P T    +I Y LI  GA+GNV D  ++G+V+DY+  +  T+ +  FNLAD  I I
Sbjct: 1  MRRLPATDKWNNIAYALIIGGAVGNVFDRIVHGFVVDYLDFYWGTYHWPAFNLADSAICI 60

Query: 85 GTCIIIYDDIILQH 98
          G  +II D  + + 
Sbjct: 61 GAAMIILDGFLAKK 74


>gi|240114920|ref|ZP_04728982.1| lipoprotein signal peptidase [Neisseria gonorrhoeae PID18]
 gi|240117204|ref|ZP_04731266.1| lipoprotein signal peptidase [Neisseria gonorrhoeae PID1]
 gi|260441265|ref|ZP_05795081.1| lipoprotein signal peptidase [Neisseria gonorrhoeae DGI2]
 gi|291044610|ref|ZP_06570319.1| signal peptidase II [Neisseria gonorrhoeae DGI2]
 gi|293397730|ref|ZP_06641936.1| signal peptidase II [Neisseria gonorrhoeae F62]
 gi|291011504|gb|EFE03500.1| signal peptidase II [Neisseria gonorrhoeae DGI2]
 gi|291611676|gb|EFF40745.1| signal peptidase II [Neisseria gonorrhoeae F62]
          Length = 196

 Score = 91.6 bits (227), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 25/99 (25%), Positives = 53/99 (53%), Gaps = 1/99 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + + + + A++     ++    ++  IG  +I  GA GNV+D  ++G+V+D++
Sbjct: 98  GWQKYFFLVLAVAVSAYLVRAILRDEFA-ALGKIGAAMIIGGASGNVIDRLIHGHVVDFL 156

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           + + Q W +  FN+AD FI +G  + + D+I+ +   K 
Sbjct: 157 LFYWQNWFYPAFNIADSFICVGAVLAVLDNIVHRKDSKK 195


>gi|225025126|ref|ZP_03714318.1| hypothetical protein EIKCOROL_02018 [Eikenella corrodens ATCC
           23834]
 gi|224942087|gb|EEG23296.1| hypothetical protein EIKCOROL_02018 [Eikenella corrodens ATCC
           23834]
          Length = 168

 Score = 91.6 bits (227), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 24/100 (24%), Positives = 49/100 (49%), Gaps = 1/100 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S     +   +  ++  ++  +  ++ K   + D+   +I  GA+GNV+D   YG+VID+
Sbjct: 69  SGWQKYLFAGLAAVVTLYLA-LGIRSGKFGRLGDVAAAMIIGGAIGNVIDRINYGHVIDF 127

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           ++ +     +  FN+AD FI +G  + + D      R + 
Sbjct: 128 LLFYWNNHYYPAFNVADSFICVGAALFVIDGFRQGKRNQA 167


>gi|268594058|ref|ZP_06128225.1| lipoprotein signal peptidase [Neisseria gonorrhoeae 35/02]
 gi|268596108|ref|ZP_06130275.1| lipoprotein signal peptidase [Neisseria gonorrhoeae FA19]
 gi|268547447|gb|EEZ42865.1| lipoprotein signal peptidase [Neisseria gonorrhoeae 35/02]
 gi|268549896|gb|EEZ44915.1| lipoprotein signal peptidase [Neisseria gonorrhoeae FA19]
          Length = 168

 Score = 91.6 bits (227), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 25/99 (25%), Positives = 53/99 (53%), Gaps = 1/99 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + + + + A++     ++    ++  IG  +I  GA GNV+D  ++G+V+D++
Sbjct: 70  GWQKYFFLVLAVAVSAYLVRAILRDEFA-ALGKIGAAMIIGGASGNVIDRLIHGHVVDFL 128

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           + + Q W +  FN+AD FI +G  + + D+I+ +   K 
Sbjct: 129 LFYWQNWFYPAFNIADSFICVGAVLAVLDNIVHRKDSKK 167


>gi|110347017|ref|YP_665835.1| signal peptidase II [Mesorhizobium sp. BNC1]
 gi|110283128|gb|ABG61188.1| signal peptidase II, Aspartic peptidase, MEROPS family A08
           [Chelativorans sp. BNC1]
          Length = 174

 Score = 91.6 bits (227), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 28/92 (30%), Positives = 46/92 (50%), Gaps = 2/92 (2%)

Query: 7   PTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIH 66
           P +L  I+++I+A +     + PK   +  +G  LI  GA+GN+VD    G V D++   
Sbjct: 71  PLMLAGIKMVIVAGLLLWAMRTPK--PLETLGLGLIAGGAMGNIVDRISQGAVTDFLDFR 128

Query: 67  TQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
              W +  FN+AD  I+IG  ++I        
Sbjct: 129 IGGWHWPAFNMADTTITIGVALLIAGSFWPGR 160


>gi|329114390|ref|ZP_08243152.1| Lipoprotein signal peptidase [Acetobacter pomorum DM001]
 gi|326696466|gb|EGE48145.1| Lipoprotein signal peptidase [Acetobacter pomorum DM001]
          Length = 171

 Score = 91.2 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 24/100 (24%), Positives = 46/100 (46%), Gaps = 2/100 (2%)

Query: 7   PTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIH 66
             +  +I + +   +     +      +       IT GA+GNV+D   YG V+D++  H
Sbjct: 73  RIVFSAIALAVACCLLVWIFRTHS--KLTAACVGAITGGAIGNVMDRVRYGAVVDFLHAH 130

Query: 67  TQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDF 106
              WS+ VFN+AD  I    C+++  + +   +Q+  +  
Sbjct: 131 AFGWSWYVFNVADSAIVCAVCMLLVQNFLAGGQQQDNVKT 170


>gi|322834472|ref|YP_004214499.1| lipoprotein signal peptidase [Rahnella sp. Y9602]
 gi|321169673|gb|ADW75372.1| lipoprotein signal peptidase [Rahnella sp. Y9602]
          Length = 168

 Score = 91.2 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 26/100 (26%), Positives = 51/100 (51%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I ++I+  +  +  +    + + +I + +I  GALGN+ D   +G+V+D+I
Sbjct: 66  GWQRWFFALIALVIVVALVVLMYRGTAKQKLNNIAFAMIIGGALGNLFDRLYHGFVVDFI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
             +   W FA FNLAD FI +G  +++ +  + +  +  K
Sbjct: 126 DFYVGNWHFATFNLADSFICVGAAMVVLEGFLAKPSEATK 165


>gi|161869383|ref|YP_001598550.1| lipoprotein signal peptidase [Neisseria meningitidis 053442]
 gi|189028660|sp|A9M1J8|LSPA_NEIM0 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|161594936|gb|ABX72596.1| lipoprotein signal peptidase [Neisseria meningitidis 053442]
          Length = 164

 Score = 91.2 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 25/99 (25%), Positives = 53/99 (53%), Gaps = 1/99 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + + + + A++     ++    ++   G  +I  GALGNV+D  ++G+V+D++
Sbjct: 66  GWQKYFFLVLAVAVSAYLVRAILRDEFA-TLGKTGAAMIIGGALGNVIDRLIHGHVVDFL 124

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           + + Q W +  FN+AD FI +G  + + D+I+ +   K 
Sbjct: 125 LFYWQNWFYPAFNIADSFICVGAVLAVLDNIVHRKDGKK 163


>gi|59800534|ref|YP_207246.1| lipoprotein signal peptidase [Neisseria gonorrhoeae FA 1090]
 gi|240120457|ref|ZP_04733419.1| lipoprotein signal peptidase [Neisseria gonorrhoeae PID24-1]
 gi|254492980|ref|ZP_05106151.1| lipoprotein signal peptidase [Neisseria gonorrhoeae 1291]
 gi|268598233|ref|ZP_06132400.1| lipoprotein signal peptidase [Neisseria gonorrhoeae MS11]
 gi|268600578|ref|ZP_06134745.1| lipoprotein signal peptidase [Neisseria gonorrhoeae PID18]
 gi|268602895|ref|ZP_06137062.1| lipoprotein signal peptidase [Neisseria gonorrhoeae PID1]
 gi|268681362|ref|ZP_06148224.1| lipoprotein signal peptidase [Neisseria gonorrhoeae PID332]
 gi|81311262|sp|Q5FAF3|LSPA_NEIG1 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|59717429|gb|AAW88834.1| putative lipoprotein signal peptidase [Neisseria gonorrhoeae FA
           1090]
 gi|226512020|gb|EEH61365.1| lipoprotein signal peptidase [Neisseria gonorrhoeae 1291]
 gi|268582364|gb|EEZ47040.1| lipoprotein signal peptidase [Neisseria gonorrhoeae MS11]
 gi|268584709|gb|EEZ49385.1| lipoprotein signal peptidase [Neisseria gonorrhoeae PID18]
 gi|268587026|gb|EEZ51702.1| lipoprotein signal peptidase [Neisseria gonorrhoeae PID1]
 gi|268621646|gb|EEZ54046.1| lipoprotein signal peptidase [Neisseria gonorrhoeae PID332]
          Length = 164

 Score = 91.2 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 25/99 (25%), Positives = 53/99 (53%), Gaps = 1/99 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + + + + A++     ++    ++  IG  +I  GA GNV+D  ++G+V+D++
Sbjct: 66  GWQKYFFLVLAVAVSAYLVRAILRDEFA-ALGKIGAAMIIGGASGNVIDRLIHGHVVDFL 124

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           + + Q W +  FN+AD FI +G  + + D+I+ +   K 
Sbjct: 125 LFYWQNWFYPAFNIADSFICVGAVLAVLDNIVHRKDSKK 163


>gi|222147335|ref|YP_002548292.1| lipoprotein signal peptidase [Agrobacterium vitis S4]
 gi|254810428|sp|B9JZH6|LSPA_AGRVS RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|221734325|gb|ACM35288.1| signal peptidase II [Agrobacterium vitis S4]
          Length = 163

 Score = 91.2 bits (226), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 42/89 (47%), Positives = 62/89 (69%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           MLS++   ++V +R+ I+AF+ ++W++  +      +GY LI  GA GN++D   YGYV+
Sbjct: 62  MLSHLDAWVIVVMRLAIVAFVAWLWRQTSRDHQFAHLGYCLIIAGAFGNIIDRFTYGYVV 121

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCII 89
           DYI+ HT+TWSFAVFNLAD  I+IG   I
Sbjct: 122 DYILFHTETWSFAVFNLADSLITIGAGFI 150


>gi|323144574|ref|ZP_08079163.1| signal peptidase II [Succinatimonas hippei YIT 12066]
 gi|322415650|gb|EFY06395.1| signal peptidase II [Succinatimonas hippei YIT 12066]
          Length = 172

 Score = 90.8 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 23/104 (22%), Positives = 51/104 (49%), Gaps = 4/104 (3%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   ++ ++I     ++ KK P++     + Y L   GA+GN++D    GYV+D++
Sbjct: 66  GWQRWFFAALAVVISLGFIYVLKKTPRSHKWTCLAYALFIGGAIGNLIDRLFLGYVVDFL 125

Query: 64  MIHTQTWS----FAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
           + + +T S    +  FN+AD+ + +G  +++      +   + K
Sbjct: 126 LFYLKTDSGILAYPAFNVADIAVCVGAFLLVIVSFGSKKTTENK 169


>gi|251772726|gb|EES53288.1| Signal peptidase II [Leptospirillum ferrodiazotrophum]
          Length = 160

 Score = 90.8 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 21/104 (20%), Positives = 43/104 (41%), Gaps = 3/104 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
            V   +L+   +L +  I     +  + +        +I  GA GN+ D    G V+D++
Sbjct: 56  GVHEALLIGFTLLAMGGILLYSARKGRERRPDIYPLAMILGGAAGNLSDRIREGRVVDFL 115

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDFP 107
             +     +  FN+AD  I +G   ++    +    ++G+   P
Sbjct: 116 DFYIGNAHWPAFNIADSAIVVGVGTLL---FLQWRDERGRTGTP 156


>gi|322435105|ref|YP_004217317.1| lipoprotein signal peptidase [Acidobacterium sp. MP5ACTX9]
 gi|321162832|gb|ADW68537.1| lipoprotein signal peptidase [Acidobacterium sp. MP5ACTX9]
          Length = 174

 Score = 90.8 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 25/102 (24%), Positives = 50/102 (49%), Gaps = 4/102 (3%)

Query: 1   MLSNVSPTI----LVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLY 56
           + + +SP I    L+   ++ +  +  +  +  +  S+  I   LI  GA+GN+ D    
Sbjct: 68  LFAELSPAIVRNTLIGFSVIAVLVVLGMIWRVGRVYSLTGIALALILGGAIGNLYDRIKL 127

Query: 57  GYVIDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
            YV+D++ +    + +  FN+AD  I IG C+++ +    Q 
Sbjct: 128 KYVVDFLEVKIVHYHWPDFNVADSCIVIGACLLLLEIFRNQP 169


>gi|309378425|emb|CBX22978.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 164

 Score = 90.8 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 26/99 (26%), Positives = 54/99 (54%), Gaps = 1/99 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + + + + A++     ++    ++  IG  +I  GALGNV+D  ++G+V+D++
Sbjct: 66  GWQKYFFLVLAVAVSAYLVRAIFRDEFA-ALGKIGAAMIIGGALGNVIDRLIHGHVVDFL 124

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           + + Q W +  FN+AD FI +G  + + D+I+ +   K 
Sbjct: 125 LFYWQNWFYPAFNIADSFICVGAVLAVLDNIVHRKDGKK 163


>gi|325129573|gb|EGC52397.1| signal peptidase II [Neisseria meningitidis OX99.30304]
 gi|325201522|gb|ADY96976.1| signal peptidase II [Neisseria meningitidis M01-240149]
          Length = 164

 Score = 90.8 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 25/99 (25%), Positives = 53/99 (53%), Gaps = 1/99 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + + + + A++     ++    ++   G  +I  GALGNV+D  ++G+V+D++
Sbjct: 66  GWQKYFFLVLAVAVSAYLVRAILRDEFA-ALGKTGAAMIIGGALGNVIDRLIHGHVVDFL 124

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           + + Q W +  FN+AD FI +G  + + D+I+ +   K 
Sbjct: 125 LFYWQNWFYPAFNIADSFICVGAVLAVLDNIVHRKDGKK 163


>gi|188532860|ref|YP_001906657.1| lipoprotein signal peptidase [Erwinia tasmaniensis Et1/99]
 gi|238058051|sp|B2VH02|LSPA_ERWT9 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|188027902|emb|CAO95759.1| Lipoprotein signal peptidase [Erwinia tasmaniensis Et1/99]
          Length = 168

 Score = 90.8 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 28/100 (28%), Positives = 49/100 (49%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I + I+  +  +  ++  +  + +I Y LI  GALGN+ D   +G+V+D+I
Sbjct: 66  GWQRWFFAGIAVAIVVVLLVMMYRSKASDRLNNIAYALIVGGALGNLFDRAYHGFVVDFI 125

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
                 W FA FN+AD  I IG  +I+ +  I    ++ +
Sbjct: 126 DFTIGDWHFATFNIADCGICIGAALIVLEGFINPTSKRSE 165


>gi|66043976|ref|YP_233817.1| lipoprotein signal peptidase [Pseudomonas syringae pv. syringae
           B728a]
 gi|63254683|gb|AAY35779.1| Peptidase A8, signal peptidase II [Pseudomonas syringae pv.
           syringae B728a]
          Length = 168

 Score = 90.8 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 49/97 (50%), Gaps = 1/97 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +     +   I +++ A +    K+  +  +   +   L+  GALGN+ D  + G+VID+
Sbjct: 65  AGWQRWLFALIAVVVSAVLVVWLKRLGRDDTWLAVALALVLGGALGNLYDRIVLGHVIDF 124

Query: 63  IMIHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQH 98
           I++H Q  W F  FN+AD  IS+G  ++  D    + 
Sbjct: 125 ILVHWQNRWYFPAFNVADSAISVGAVMLALDMFKSKK 161


>gi|289674850|ref|ZP_06495740.1| lipoprotein signal peptidase [Pseudomonas syringae pv. syringae
           FF5]
 gi|330971958|gb|EGH72024.1| lipoprotein signal peptidase [Pseudomonas syringae pv. aceris str.
           M302273PT]
          Length = 168

 Score = 90.8 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 49/97 (50%), Gaps = 1/97 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +     +   I +++ A +    K+  +  +   +   L+  GALGN+ D  + G+VID+
Sbjct: 65  AGWQRWLFALIAVVVSAVLVVWLKRLGRDDTWLAVALALVLGGALGNLYDRIVLGHVIDF 124

Query: 63  IMIHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQH 98
           I++H Q  W F  FN+AD  IS+G  ++  D    + 
Sbjct: 125 ILVHWQNRWYFPAFNVADSAISVGAIMLALDMFKSKK 161


>gi|240127459|ref|ZP_04740120.1| lipoprotein signal peptidase [Neisseria gonorrhoeae SK-93-1035]
          Length = 189

 Score = 90.8 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 24/99 (24%), Positives = 52/99 (52%), Gaps = 1/99 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + + + +  ++     ++    ++  IG  +I  GA GNV+D  ++G+V+D++
Sbjct: 91  GWQKYFFLVLAVAVSTYLVRAILRDEFA-ALGKIGAAMIIGGASGNVIDRLIHGHVVDFL 149

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           + + Q W +  FN+AD FI +G  + + D+I+ +   K 
Sbjct: 150 LFYWQNWFYPAFNIADSFICVGAVLAVLDNIVHRKDSKK 188


>gi|313669052|ref|YP_004049336.1| lipoprotein signal peptidase [Neisseria lactamica ST-640]
 gi|313006514|emb|CBN87978.1| putative lipoprotein signal peptidase [Neisseria lactamica 020-06]
          Length = 164

 Score = 90.8 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 26/99 (26%), Positives = 53/99 (53%), Gaps = 1/99 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + + + + A++     ++    +   IG  +I  GALGNV+D  ++G+V+D++
Sbjct: 66  GWQKYFFLVLAVAVSAYLVRAILRDEFA-TFGKIGAAMIIGGALGNVIDRLIHGHVVDFL 124

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           + + Q W +  FN+AD FI +G  + + D+I+ +   K 
Sbjct: 125 LFYWQNWFYPAFNIADSFICVGAVLAVLDNIVHRKDGKK 163


>gi|268685836|ref|ZP_06152698.1| lipoprotein signal peptidase [Neisseria gonorrhoeae SK-93-1035]
 gi|268626120|gb|EEZ58520.1| lipoprotein signal peptidase [Neisseria gonorrhoeae SK-93-1035]
          Length = 167

 Score = 90.8 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 24/99 (24%), Positives = 52/99 (52%), Gaps = 1/99 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + + + +  ++     ++    ++  IG  +I  GA GNV+D  ++G+V+D++
Sbjct: 69  GWQKYFFLVLAVAVSTYLVRAILRDEFA-ALGKIGAAMIIGGASGNVIDRLIHGHVVDFL 127

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           + + Q W +  FN+AD FI +G  + + D+I+ +   K 
Sbjct: 128 LFYWQNWFYPAFNIADSFICVGAVLAVLDNIVHRKDSKK 166


>gi|320107099|ref|YP_004182689.1| lipoprotein signal peptidase [Terriglobus saanensis SP1PR4]
 gi|319925620|gb|ADV82695.1| lipoprotein signal peptidase [Terriglobus saanensis SP1PR4]
          Length = 175

 Score = 90.8 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 23/94 (24%), Positives = 44/94 (46%)

Query: 5   VSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIM 64
           +    L+    +  A +  +  +  +  S   +G  LI  GALGN+ D     YVID++ 
Sbjct: 75  LVRWGLIVFSAIASAVVLVMIWRMGRDWSPASLGLALILGGALGNLYDRIWLHYVIDFLE 134

Query: 65  IHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
           +    + +  FN+AD  I IG  +++ + +  + 
Sbjct: 135 VTIVHYHWPDFNVADSCICIGATLLMIEILWPRP 168


>gi|149185342|ref|ZP_01863659.1| lipoprotein signal peptidase [Erythrobacter sp. SD-21]
 gi|148831453|gb|EDL49887.1| lipoprotein signal peptidase [Erythrobacter sp. SD-21]
          Length = 182

 Score = 90.4 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 34/104 (32%), Positives = 53/104 (50%), Gaps = 3/104 (2%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S  S  ILV +  LI   +     +      I  +G  +I  GALGN+ D    GYVIDY
Sbjct: 66  SFESRWILVGVTALIALVVTIWMFREKAFGDI--LGLSMILGGALGNIKDRYELGYVIDY 123

Query: 63  IMIHTQTWS-FAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
             +H   +  F +FN+AD  I+IG  II+     ++ +++ ++D
Sbjct: 124 ADLHFGDFRPFLIFNVADAAITIGVLIILARAFFMRDKEEDEVD 167


>gi|325207501|gb|ADZ02953.1| signal peptidase II [Neisseria meningitidis NZ-05/33]
          Length = 174

 Score = 90.4 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 25/99 (25%), Positives = 53/99 (53%), Gaps = 1/99 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + + + + A++     ++    ++   G  +I  GALGNV+D  ++G+V+D++
Sbjct: 76  GWQKYFFLVLAVAVSAYLVRAILRDEFA-ALGKTGAAMIIGGALGNVIDRLIHGHVVDFL 134

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           + + Q W +  FN+AD FI +G  + + D+I+ +   K 
Sbjct: 135 LFYWQNWFYPAFNIADSFICVGAVLAVLDNIVHRKDGKK 173


>gi|67459024|ref|YP_246648.1| lipoprotein signal peptidase [Rickettsia felis URRWXCal2]
 gi|67004557|gb|AAY61483.1| Lipoprotein signal peptidase [Rickettsia felis URRWXCal2]
          Length = 238

 Score = 90.4 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 37/108 (34%), Positives = 56/108 (51%), Gaps = 6/108 (5%)

Query: 5   VSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIM 64
            S  I +    LI+ +++++  ++    S    GY  +  GA+GN++D    G V D+I 
Sbjct: 113 YSNAIFLITNTLIVCYLYYLMIRSKTIGSFA--GYSFVIGGAVGNLIDRFFRGAVFDFIH 170

Query: 65  IHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH----RQKGKIDFPQ 108
            H Q +SF VFNLAD FI+IG  I+I D    +     + KG  D  Q
Sbjct: 171 FHYQNYSFPVFNLADCFITIGVIILIEDYYSTKKVIEEKAKGNYDNAQ 218


>gi|261417497|ref|YP_003251180.1| lipoprotein signal peptidase [Fibrobacter succinogenes subsp.
           succinogenes S85]
 gi|261373953|gb|ACX76698.1| lipoprotein signal peptidase [Fibrobacter succinogenes subsp.
           succinogenes S85]
 gi|302326196|gb|ADL25397.1| signal peptidase II [Fibrobacter succinogenes subsp. succinogenes
           S85]
          Length = 194

 Score = 90.4 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 26/102 (25%), Positives = 49/102 (48%), Gaps = 4/102 (3%)

Query: 4   NVSPT-ILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
            + P    + I I+    + + +K   K   +  +G ++I  GA+GN +D      V+D+
Sbjct: 74  FLPPWLFFLLISIVAAFALAWFYKSIDKRDYLSRLGVVMILGGAVGNFIDRMRMQMVVDF 133

Query: 63  IMIHTQTW---SFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
           I      +    F  FN+AD F+++G  ++I   +IL+   K
Sbjct: 134 IDCDFPDFIMTRFPTFNVADSFVTVGVALVILSPVILRKLHK 175


>gi|28199317|ref|NP_779631.1| lipoprotein signal peptidase [Xylella fastidiosa Temecula1]
 gi|71276192|ref|ZP_00652471.1| Peptidase A8, signal peptidase II [Xylella fastidiosa Dixon]
 gi|71901177|ref|ZP_00683281.1| Peptidase A8, signal peptidase II [Xylella fastidiosa Ann-1]
 gi|71902288|ref|ZP_00684282.1| Peptidase A8, signal peptidase II [Xylella fastidiosa Ann-1]
 gi|170730684|ref|YP_001776117.1| lipoprotein signal peptidase [Xylella fastidiosa M12]
 gi|182682042|ref|YP_001830202.1| lipoprotein signal peptidase [Xylella fastidiosa M23]
 gi|32129702|sp|Q87BL6|LSPA_XYLFT RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|238687930|sp|B0U3Q8|LSPA_XYLFM RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|238691066|sp|B2I6V1|LSPA_XYLF2 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|28057423|gb|AAO29280.1| lipoprotein signal peptidase [Xylella fastidiosa Temecula1]
 gi|71162953|gb|EAO12676.1| Peptidase A8, signal peptidase II [Xylella fastidiosa Dixon]
 gi|71727965|gb|EAO30186.1| Peptidase A8, signal peptidase II [Xylella fastidiosa Ann-1]
 gi|71729059|gb|EAO31186.1| Peptidase A8, signal peptidase II [Xylella fastidiosa Ann-1]
 gi|167965477|gb|ACA12487.1| Signal peptidase II [Xylella fastidiosa M12]
 gi|182632152|gb|ACB92928.1| lipoprotein signal peptidase [Xylella fastidiosa M23]
 gi|307578311|gb|ADN62280.1| lipoprotein signal peptidase [Xylella fastidiosa subsp. fastidiosa
           GB514]
          Length = 167

 Score = 90.4 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 24/99 (24%), Positives = 45/99 (45%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                + +++ + I   + F   + P+ +    + Y LI  G +GNV+D  L+G+V+D+I
Sbjct: 67  GWQMWLFIALALGISGLLTFWLSRTPRREWRSALPYALIIGGGIGNVIDRFLHGHVVDFI 126

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
             +  ++ +  FNLAD  I  G   I    +        
Sbjct: 127 QWYVGSYYWPSFNLADSAIVAGAIGIGLLSLFDSKHSPK 165


>gi|269213794|ref|ZP_06158182.1| signal peptidase II [Neisseria cinerea ATCC 14685]
 gi|269145388|gb|EEZ71806.1| signal peptidase II [Neisseria cinerea ATCC 14685]
          Length = 155

 Score = 90.4 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 23/101 (22%), Positives = 54/101 (53%), Gaps = 1/101 (0%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + + + +  ++     ++    ++   G  +I  GALGNV+D  ++G+V+D++
Sbjct: 53  GWQKYFFLLLAVAVSIYLVRAILRDEFA-ALGKTGAAMIIGGALGNVIDRLIHGHVVDFL 111

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
           + + Q W +  FN+AD FI +G  + + D+I+ +  ++  +
Sbjct: 112 LFYWQDWFYPAFNIADSFICVGAVLAVLDNIVNRKDREKNV 152


>gi|117925436|ref|YP_866053.1| signal peptidase II [Magnetococcus sp. MC-1]
 gi|117609192|gb|ABK44647.1| signal peptidase II, Aspartic peptidase, MEROPS family A08
           [Magnetococcus sp. MC-1]
          Length = 159

 Score = 90.4 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 51/96 (53%), Gaps = 2/96 (2%)

Query: 1   MLSNVSPTI--LVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGY 58
           M +N++P     + + + ++A I  +                +I  GA+GN++D    G+
Sbjct: 53  MFTNLAPFWRQFLLVGVAVVACIMILMMLRSAQTRYSAAALGMIMGGAMGNLLDRVRLGW 112

Query: 59  VIDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDI 94
           V+D+I +H QT S+ VFN+AD  I+IG  +I+ +  
Sbjct: 113 VVDFIHLHWQTLSWPVFNIADTAITIGVAMILLEGF 148


>gi|319898201|ref|YP_004158294.1| Lipoprotein signal peptidase (Prolipoprotein signal peptidase)
           (Signal peptidase II) (SPase II) [Bartonella
           clarridgeiae 73]
 gi|319402165|emb|CBI75691.1| Lipoprotein signal peptidase (Prolipoprotein signal peptidase)
           (Signal peptidase II) (SPase II) [Bartonella
           clarridgeiae 73]
          Length = 172

 Score = 90.4 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 36/106 (33%), Positives = 62/106 (58%), Gaps = 1/106 (0%)

Query: 2   LSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVID 61
           LS+     ++++ ++II F+ ++WK     K +   G   I  GA+GN++D   + YVID
Sbjct: 63  LSSYPHWGIIALTLIIIVFLLWLWKNTENDKFLSYFGISFIIGGAIGNLIDRIRFHYVID 122

Query: 62  YIMIHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDF 106
           YI+ H    +SFAVFNLAD FI++G   ++ D+  +  ++K   + 
Sbjct: 123 YILFHINGVFSFAVFNLADTFITLGAVAVLIDEFRILTKKKHYPEN 168


>gi|218885369|ref|YP_002434690.1| lipoprotein signal peptidase [Desulfovibrio vulgaris str. 'Miyazaki
           F']
 gi|218756323|gb|ACL07222.1| lipoprotein signal peptidase [Desulfovibrio vulgaris str. 'Miyazaki
           F']
          Length = 166

 Score = 90.4 bits (224), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 20/92 (21%), Positives = 39/92 (42%), Gaps = 1/92 (1%)

Query: 5   VSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIM 64
               + +   +L + +      +  +   +   G+  I  GALGN+VD   +  VID++ 
Sbjct: 65  WQFWLFLVATVLAV-WAIVSLTRAAQEDRVLFTGFGCILGGALGNLVDRVRFRAVIDFLD 123

Query: 65  IHTQTWSFAVFNLADLFISIGTCIIIYDDIIL 96
            +   W +  FN+AD+ I +G  +        
Sbjct: 124 FYVGDWHWPAFNVADIAICVGAFLAFIAMYRQ 155


>gi|307824801|ref|ZP_07655024.1| lipoprotein signal peptidase [Methylobacter tundripaludum SV96]
 gi|307734159|gb|EFO05013.1| lipoprotein signal peptidase [Methylobacter tundripaludum SV96]
          Length = 169

 Score = 90.4 bits (224), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 22/91 (24%), Positives = 48/91 (52%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    + ++I   I     +  K +++  +   L+  GA+GN++D   YGYVID++
Sbjct: 69  GWQRWFFAGLALMISVVIAVWLTRLKKHETLLAVALALVLGGAVGNLIDRLAYGYVIDFL 128

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDI 94
            ++ ++W +  FN+AD  I++G  +++ +  
Sbjct: 129 DVYYESWHWPAFNIADSAITLGVVLMLAESF 159


>gi|157828433|ref|YP_001494675.1| lipoprotein signal peptidase [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|157800914|gb|ABV76167.1| lipoprotein signal peptidase [Rickettsia rickettsii str. 'Sheila
           Smith']
          Length = 179

 Score = 90.4 bits (224), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 36/108 (33%), Positives = 56/108 (51%), Gaps = 6/108 (5%)

Query: 5   VSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIM 64
            S  I +    +I+ +++++  ++    S    GY  +  GA+GN++D    G V D+I 
Sbjct: 50  YSNAIFLITNTIIVCYLYYLMIRSKTIGSFA--GYSFVIGGAVGNLIDRFFRGAVFDFIH 107

Query: 65  IHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH----RQKGKIDFPQ 108
            H Q +SF VFNLAD FI+IG  I+I D    +     + KG  D  Q
Sbjct: 108 FHYQNYSFPVFNLADCFITIGVIILIEDYYSTKKVIEEKAKGNYDNAQ 155


>gi|94987494|ref|YP_595427.1| lipoprotein signal peptidase [Lawsonia intracellularis PHE/MN1-00]
 gi|94731743|emb|CAJ55106.1| Lipoprotein signal peptidase [Lawsonia intracellularis PHE/MN1-00]
          Length = 164

 Score = 90.4 bits (224), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 23/102 (22%), Positives = 41/102 (40%)

Query: 5   VSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIM 64
               + +      I  IFF+ +     +     G   I  GALGN+ D      VID++ 
Sbjct: 63  WQFWLFLGATFWAIVIIFFLARSAHSNERFLFWGLGCILGGALGNLFDRLRIRAVIDFLD 122

Query: 65  IHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDF 106
            +   W +  FN+AD+ I  G  +++      +  ++  I  
Sbjct: 123 FYIGDWHWPAFNVADIAICCGGFLVLISMWHNEKIKRNTIKE 164


>gi|91776559|ref|YP_546315.1| signal peptidase II [Methylobacillus flagellatus KT]
 gi|91710546|gb|ABE50474.1| signal peptidase II, Aspartic peptidase, MEROPS family A08
           [Methylobacillus flagellatus KT]
          Length = 151

 Score = 90.4 bits (224), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 26/94 (27%), Positives = 47/94 (50%), Gaps = 1/94 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   +I ++    I  + +K+P+   +F +G  L+  GALGN+ D    GYV+D++
Sbjct: 58  GWQRIFFSAIAVVASIIIIRLLRKHPQQH-LFCLGLALVLGGALGNLYDRVTLGYVVDFL 116

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQ 97
             H   + +  FN+AD  I +G  ++I D    +
Sbjct: 117 FFHYGEYYWPAFNVADSAICVGVALLILDSFRKK 150


>gi|110636003|ref|YP_676211.1| signal peptidase II [Mesorhizobium sp. BNC1]
 gi|110286987|gb|ABG65046.1| signal peptidase II. Aspartic peptidase. MEROPS family A08
           [Chelativorans sp. BNC1]
          Length = 160

 Score = 90.4 bits (224), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 37/100 (37%), Positives = 59/100 (59%)

Query: 2   LSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVID 61
           LS V    L  + + +I FI  +  +         +G+ LI  GA+GN++D    GYV+D
Sbjct: 58  LSGVGGFWLSLLVLGVIIFIAVLAFRTDSNHLFARLGFALILGGAVGNLIDRATRGYVVD 117

Query: 62  YIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
           YI  HT  WSFA+FNLAD FI++G  +++ ++++   RQ+
Sbjct: 118 YIYFHTPVWSFAIFNLADAFITVGALLVVLEEVLNLRRQR 157


>gi|34580524|ref|ZP_00142004.1| lipoprotein signal peptidase [Rickettsia sibirica 246]
 gi|28261909|gb|EAA25413.1| lipoprotein signal peptidase [Rickettsia sibirica 246]
          Length = 201

 Score = 90.1 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 36/108 (33%), Positives = 56/108 (51%), Gaps = 6/108 (5%)

Query: 5   VSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIM 64
            S  I +    +I+ +++++  ++    S    GY  +  GA+GN++D    G V D+I 
Sbjct: 72  YSNAIFLITNTIIVCYLYYLMIRSKTIGSFA--GYSFVIGGAVGNLIDRFFRGAVFDFIH 129

Query: 65  IHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH----RQKGKIDFPQ 108
            H Q +SF VFNLAD FI+IG  I+I D    +     + KG  D  Q
Sbjct: 130 FHYQNYSFPVFNLADCFITIGVIILIEDYYSTKKVIEEKAKGNYDNAQ 177


>gi|296840725|ref|ZP_06863294.2| signal peptidase II [Neisseria polysaccharea ATCC 43768]
 gi|296840170|gb|EFH24108.1| signal peptidase II [Neisseria polysaccharea ATCC 43768]
          Length = 151

 Score = 90.1 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 26/99 (26%), Positives = 54/99 (54%), Gaps = 1/99 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + + + + A++     ++    ++  IG  +I  GALGNV+D  ++G+V+D++
Sbjct: 53  GWQKYFFLVLAVAVSAYLVRAILRDEFA-ALGKIGAAMIIGGALGNVIDRLIHGHVVDFL 111

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           + + Q W +  FN+AD FI +G  + + D+I+ +   K 
Sbjct: 112 LFYWQNWFYPAFNIADSFICVGAVLAVLDNIVHRKDSKK 150


>gi|51892380|ref|YP_075071.1| signal peptidase II [Symbiobacterium thermophilum IAM 14863]
 gi|81826161|sp|Q67Q16|LSPA_SYMTH RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|51856069|dbj|BAD40227.1| signal peptidase II [Symbiobacterium thermophilum IAM 14863]
          Length = 152

 Score = 90.1 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 19/94 (20%), Positives = 50/94 (53%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
                V++  L +A I +  ++      +  +   L+  GA+GN++D    G V+D+++ 
Sbjct: 56  GRWFFVAVAALAVAGILYYLRQPESRHPLLRVALGLVMGGAVGNMIDRIATGRVVDFLLF 115

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
           + + + F  FN+AD+ +++G  ++    ++++ +
Sbjct: 116 YWRDYYFPNFNVADICVTVGVGLLFLHLVLVERK 149


>gi|163735638|ref|ZP_02143069.1| putative lipoprotein signal peptidase [Roseobacter litoralis Och
           149]
 gi|161391066|gb|EDQ15404.1| putative lipoprotein signal peptidase [Roseobacter litoralis Och
           149]
          Length = 167

 Score = 90.1 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 25/99 (25%), Positives = 48/99 (48%), Gaps = 2/99 (2%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           ML       L+++ ++I  ++  +  +     ++  + Y  +  GALGNV+D   Y  V 
Sbjct: 67  MLGGAPWWSLIALALVICVWLGIMLFR--ADNAVETLAYGAMIGGALGNVIDRVRYRAVT 124

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
           D++  +  T  +  FNLAD+F+  G  +++    I   R
Sbjct: 125 DFLDFYIGTTHWPAFNLADVFVVSGVGLLLAAPWISARR 163


>gi|332981609|ref|YP_004463050.1| lipoprotein signal peptidase [Mahella australiensis 50-1 BON]
 gi|332699287|gb|AEE96228.1| lipoprotein signal peptidase [Mahella australiensis 50-1 BON]
          Length = 154

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 47/97 (48%), Gaps = 2/97 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
              + +S+ +L+ A I +     P    +  I   LI  GA+GN++D    GYV+D+I  
Sbjct: 58  QRWLFISLTVLVCAVIVYAVLARPNMPLMLKISLGLILGGAVGNLIDRIRLGYVVDFIDF 117

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
               +   +FN+AD  + IGT +  Y  I +   +K 
Sbjct: 118 RIINY--PIFNVADSAVVIGTILFGYYVIFVSDAKKS 152


>gi|229586683|ref|YP_002845184.1| lipoprotein signal peptidase [Rickettsia africae ESF-5]
 gi|259495134|sp|C3PND1|LSPA_RICAE RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|228021733|gb|ACP53441.1| Lipoprotein signal peptidase [Rickettsia africae ESF-5]
          Length = 201

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 36/108 (33%), Positives = 56/108 (51%), Gaps = 6/108 (5%)

Query: 5   VSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIM 64
            S  I +    +I+ +++++  ++    S    GY  +  GA+GN++D    G V D+I 
Sbjct: 72  YSNAIFLITNTIIVCYLYYLMIRSKTIGSFA--GYSFVIGGAVGNLIDRFFRGAVFDFIH 129

Query: 65  IHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH----RQKGKIDFPQ 108
            H Q +SF VFNLAD FI+IG  I+I D    +     + KG  D  Q
Sbjct: 130 FHYQNYSFPVFNLADCFITIGVIILIEDYYSTKKVIEEKAKGNYDNAQ 177


>gi|313673044|ref|YP_004051155.1| signal peptidase ii [Calditerrivibrio nitroreducens DSM 19672]
 gi|312939800|gb|ADR18992.1| signal peptidase II [Calditerrivibrio nitroreducens DSM 19672]
          Length = 167

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 26/106 (24%), Positives = 51/106 (48%), Gaps = 1/106 (0%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           M         V + ++ IA + ++  K      +    Y LI  GA+GN++D    G V+
Sbjct: 57  MSEQYRVAFFVLVTVIAIAIVVYLLIKEKSV-LLRRYAYTLILAGAIGNLIDRITIGKVV 115

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDF 106
           D++  +   + +  FN+AD+ IS+G  ++I D ++ + R+      
Sbjct: 116 DFLDFYIGKYHWPAFNVADISISVGVGLLILDMLMEKQRKTINNSN 161


>gi|190570920|ref|YP_001975278.1| lipoprotein signal peptidase [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|213019436|ref|ZP_03335242.1| lipoprotein signal peptidase [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|190357192|emb|CAQ54608.1| lipoprotein signal peptidase [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|212994858|gb|EEB55500.1| lipoprotein signal peptidase [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 158

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 29/101 (28%), Positives = 45/101 (44%), Gaps = 2/101 (1%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
                 +  ILII  + ++  K         + + L+  GA+GNV+D   +G V D+I  
Sbjct: 60  GSFFFSACSILIIGILAYLIYK--SNDKSIYLSFSLMIGGAIGNVIDRIYWGAVYDFIYF 117

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDF 106
           H   W +  FNLADL I  G C ++Y   I       + + 
Sbjct: 118 HINDWYWPAFNLADLSIVCGMCTLLYKWYIYDRSISKQNEE 158


>gi|257091616|ref|YP_003165259.1| hypothetical protein CAP2UW1_4687 [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257048625|gb|ACV37812.1| hypothetical protein CAP2UW1_4687 [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 200

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 36/78 (46%), Gaps = 1/78 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +L+++ + +   +  +  K          GY L+  GA+GN+VD    G V+DY+
Sbjct: 101 GWQRYVLIALALAVSVGLTIMLLKGVA-NRWEGWGYSLLLGGAVGNLVDRLGRGAVVDYL 159

Query: 64  MIHTQTWSFAVFNLADLF 81
             H   W +  FNLAD  
Sbjct: 160 DFHAGGWHWPAFNLADTA 177


>gi|126492|sp|P17942|LSPA_PSEFL RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|151348|gb|AAA25884.1| signal peptidase II [Pseudomonas fluorescens]
          Length = 170

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 45/96 (46%), Gaps = 1/96 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +   I +++ A +    K+  +  +   I   L+  GALGN+ D    G+VID+I
Sbjct: 68  GWQRWLFAVIAVVVSAVLVVWLKRLGRDDTWLAIALALVLGGALGNLYDRIALGHVIDFI 127

Query: 64  MIHTQTWS-FAVFNLADLFISIGTCIIIYDDIILQH 98
           ++H Q    F  FN AD  I++G  ++  D    + 
Sbjct: 128 LVHWQNRHYFPAFNFADSAITVGAIMLALDMFKSKK 163


>gi|165933145|ref|YP_001649934.1| lipoprotein signal peptidase [Rickettsia rickettsii str. Iowa]
 gi|165908232|gb|ABY72528.1| lipoprotein signal peptidase [Rickettsia rickettsii str. Iowa]
          Length = 206

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 36/108 (33%), Positives = 56/108 (51%), Gaps = 6/108 (5%)

Query: 5   VSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIM 64
            S  I +    +I+ +++++  ++    S    GY  +  GA+GN++D    G V D+I 
Sbjct: 77  YSNAIFLITNTIIVCYLYYLMIRSKTIGSFA--GYSFVIGGAVGNLIDRFFRGAVFDFIH 134

Query: 65  IHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH----RQKGKIDFPQ 108
            H Q +SF VFNLAD FI+IG  I+I D    +     + KG  D  Q
Sbjct: 135 FHYQNYSFPVFNLADCFITIGVIILIEDYYSTKKVIEEKAKGNYDNAQ 182


>gi|269215246|ref|ZP_05987999.2| signal peptidase II [Neisseria lactamica ATCC 23970]
 gi|269207957|gb|EEZ74412.1| signal peptidase II [Neisseria lactamica ATCC 23970]
          Length = 151

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 26/99 (26%), Positives = 54/99 (54%), Gaps = 1/99 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + + + + A++     ++    ++  IG  +I  GALGNV+D  ++G+V+D++
Sbjct: 53  GWQKYFFLVLAVAVSAYLVRAILRDEFA-TLGKIGAAMIIGGALGNVIDRLIHGHVVDFL 111

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           + + Q W +  FN+AD FI +G  + + D+I+ +   K 
Sbjct: 112 LFYWQNWFYPAFNIADSFICVGAVLAVLDNIVHRKDGKK 150


>gi|93005231|ref|YP_579668.1| lipoprotein signal peptidase [Psychrobacter cryohalolentis K5]
 gi|92392909|gb|ABE74184.1| lipoprotein signal peptidase [Psychrobacter cryohalolentis K5]
          Length = 216

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 30/99 (30%), Positives = 56/99 (56%), Gaps = 1/99 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    + +L+  F+     K P+   +  +G  L+  GA+GN++D  L+G+VID+I
Sbjct: 117 GWQKWFFSGLALLMSLFLIGYLAKAPRQAKLLSLGLALVLGGAVGNLIDRLLHGHVIDFI 176

Query: 64  MIHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
            +H    W + +FN+AD+ ISIG  +I+ D + L+ +++
Sbjct: 177 HVHYADVWHYPIFNIADIGISIGVLLIVIDMLFLEKKRE 215


>gi|328954556|ref|YP_004371890.1| Lipoprotein signal peptidase [Desulfobacca acetoxidans DSM 11109]
 gi|328454880|gb|AEB10709.1| Lipoprotein signal peptidase [Desulfobacca acetoxidans DSM 11109]
          Length = 156

 Score = 89.3 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 23/90 (25%), Positives = 47/90 (52%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
            +     V   ++++A + +++ + P    +F  GY L+ +GA+GN++D    G VID++
Sbjct: 54  GLVSYFFVIATLVVLAVVGYLFWRTPLQHRLFLWGYSLLISGAVGNLMDRIRLGEVIDFL 113

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDD 93
             +   + +  FN+AD  I +G  +I    
Sbjct: 114 DFYVGRYHWPAFNVADSLICLGAGLIFLGI 143


>gi|238650903|ref|YP_002916759.1| lipoprotein signal peptidase [Rickettsia peacockii str. Rustic]
 gi|238625001|gb|ACR47707.1| lipoprotein signal peptidase [Rickettsia peacockii str. Rustic]
          Length = 206

 Score = 89.3 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 36/108 (33%), Positives = 57/108 (52%), Gaps = 6/108 (5%)

Query: 5   VSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIM 64
            S  I +    +I+ +++++  ++    S    GY ++  GA+GN++D    G V D+I 
Sbjct: 77  YSNAIFLITNTIIVCYLYYLMIRSKTIGSFA--GYSVVIGGAVGNLIDRFFRGAVFDFIH 134

Query: 65  IHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH----RQKGKIDFPQ 108
            H Q +SF VFNLAD FI+IG  I+I D    +     + KG  D  Q
Sbjct: 135 FHYQNYSFPVFNLADCFITIGVIILIEDYYSTKKVIEEKAKGNYDNAQ 182


>gi|326403385|ref|YP_004283466.1| lipoprotein signal peptidase [Acidiphilium multivorum AIU301]
 gi|325050246|dbj|BAJ80584.1| lipoprotein signal peptidase [Acidiphilium multivorum AIU301]
          Length = 177

 Score = 89.3 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 23/80 (28%), Positives = 37/80 (46%), Gaps = 2/80 (2%)

Query: 20  FIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQTWSFAVFNLAD 79
            +     + P    +  +G   I  GA GNV+    YG V+D++ +H     + VFNLAD
Sbjct: 85  GLSVWLWRTPS--LLAALGLGAIIGGAAGNVISRIAYGAVVDFVDVHIGNLHWYVFNLAD 142

Query: 80  LFISIGTCIIIYDDIILQHR 99
             I  G   +I + +  + R
Sbjct: 143 AAIDGGVAALIIESLFSRDR 162


>gi|308274790|emb|CBX31389.1| Lipoprotein signal peptidase [uncultured Desulfobacterium sp.]
          Length = 171

 Score = 89.3 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 26/88 (29%), Positives = 49/88 (55%)

Query: 10  LVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQT 69
            + +  L + FI + ++  P+   +      LI  GA GN+VD   +G V+D++ I+ + 
Sbjct: 84  FIVVSFLALCFILYFYRVTPRKYPMLATALALIFGGAAGNLVDRIRFGKVVDFLDIYIRN 143

Query: 70  WSFAVFNLADLFISIGTCIIIYDDIILQ 97
             +  FN+AD  ISIG CI+++  ++ +
Sbjct: 144 LHWPAFNIADSAISIGMCILLFHILLKK 171


>gi|319646074|ref|ZP_08000304.1| lipoprotein signal peptidase [Bacillus sp. BT1B_CT2]
 gi|52348026|gb|AAU40660.1| LspA [Bacillus licheniformis ATCC 14580]
 gi|317391824|gb|EFV72621.1| lipoprotein signal peptidase [Bacillus sp. BT1B_CT2]
          Length = 179

 Score = 89.3 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 22/97 (22%), Positives = 46/97 (47%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
                  I  ++I  I +  +K+ K + +  I   L+  GA+GN +D      V+D+I +
Sbjct: 82  QMWFFYIITTVVIIGIVYYIQKHAKGQILLGIALGLMLGGAVGNFIDRVFRQEVVDFIHV 141

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
               + + +FN+AD  + IG  ++    ++   ++K 
Sbjct: 142 TIVNYHYPIFNIADSSLCIGVLLLFIQMLLDGKKKKE 178


>gi|260460491|ref|ZP_05808742.1| lipoprotein signal peptidase [Mesorhizobium opportunistum WSM2075]
 gi|259033596|gb|EEW34856.1| lipoprotein signal peptidase [Mesorhizobium opportunistum WSM2075]
          Length = 180

 Score = 89.3 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 46/102 (45%), Positives = 68/102 (66%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           M S++  T LV I +L++AF+ ++    P    I   G+ LI  GALGN++D  +YG+VI
Sbjct: 55  MFSSLGDTGLVVIAVLVVAFVLYLATHTPSGHVIARTGFALIIGGALGNLIDRAVYGHVI 114

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           DYI+ HT  WSFAVFNLAD FIS+G  ++++D++I   R+  
Sbjct: 115 DYILFHTPVWSFAVFNLADAFISVGAALVVFDELIGWRREPK 156


>gi|291484097|dbj|BAI85172.1| lipoprotein signal peptidase [Bacillus subtilis subsp. natto
           BEST195]
          Length = 152

 Score = 89.3 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 19/99 (19%), Positives = 44/99 (44%), Gaps = 2/99 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
                  I   +I  I +  ++  K +    +   L+  GA+GN +D  +   V+D+I +
Sbjct: 56  QMWFFYLITTAVIIGIVYYIQRYTKGQRFLGVALGLMLGGAIGNFIDRAVRQEVVDFIHV 115

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
               +   +FN+AD  + +G  ++    ++   ++K + 
Sbjct: 116 IIVNY--PIFNIADSSLCVGVMLLFIQMLLDSGKKKKEQ 152


>gi|269303411|gb|ACZ33511.1| signal peptidase II [Chlamydophila pneumoniae LPCoLN]
          Length = 168

 Score = 89.3 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 29/103 (28%), Positives = 56/103 (54%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           + SN    + +    +I+  + +++ K    +S      +L+  GA+GNV D   YG+V+
Sbjct: 65  LFSNYKYFLFLLRIFVILGLLAYLFLKKKSIQSTTQTALVLLCAGAIGNVGDIIFYGHVV 124

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
           D+I  + + W+F  FN+AD+ IS+GT +++Y       + + K
Sbjct: 125 DFISFNYKQWAFPTFNVADVLISLGTLLLVYKFYFPTKQTEKK 167


>gi|15839008|ref|NP_299696.1| lipoprotein signal peptidase [Xylella fastidiosa 9a5c]
 gi|32129721|sp|Q9PAS8|LSPA_XYLFA RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|9107603|gb|AAF85216.1|AE004050_9 lipoprotein signal peptidase [Xylella fastidiosa 9a5c]
          Length = 167

 Score = 89.3 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 24/99 (24%), Positives = 44/99 (44%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                + +++ + I   + F   + P+ +    + Y LI  G +GNV+D  L+G+V+D+I
Sbjct: 67  GWQMWLFIALALGISGLLTFWLSRTPRREWRSALPYALIIGGGIGNVIDRFLHGHVVDFI 126

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
             +  +  +  FNLAD  I  G   I    +        
Sbjct: 127 QWYVGSHYWPSFNLADSAIVAGAIGIGLLSLFDSKHSPK 165


>gi|170748217|ref|YP_001754477.1| lipoprotein signal peptidase [Methylobacterium radiotolerans JCM
           2831]
 gi|238058054|sp|B1LSB3|LSPA_METRJ RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|170654739|gb|ACB23794.1| lipoprotein signal peptidase [Methylobacterium radiotolerans JCM
           2831]
          Length = 171

 Score = 89.3 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 47/97 (48%), Gaps = 2/97 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
            +   +LV++ +     +    ++   T  +  I   LI  GALGN +D   YG V D++
Sbjct: 63  GIGRWLLVALSLAAAIGLGLWMRR--ATSRLLGIALGLIVGGALGNAIDRAAYGAVFDFV 120

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
            +H   WS+ VFN+AD  I  G   +I D +    R+
Sbjct: 121 HLHAGGWSWYVFNVADAAIVAGVIGLILDSLSPDGRK 157


>gi|197120010|ref|YP_002140437.1| lipoprotein signal peptidase [Geobacter bemidjiensis Bem]
 gi|197089370|gb|ACH40641.1| lipoprotein signal peptidase [Geobacter bemidjiensis Bem]
          Length = 164

 Score = 89.3 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 23/101 (22%), Positives = 50/101 (49%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S+      + +  + +  I  +  +    + +  +   LI +GALGN++D    G VID+
Sbjct: 61  SSWRLPFFLLVSAVAVVVILVVVSRLRDDQKVSALSLSLIFSGALGNLIDRVRLGEVIDF 120

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
           + +H     +  FN+AD  I +G  ++  + ++ + R+K +
Sbjct: 121 LYVHWYEHYWPAFNVADSAICVGVFLLAIEMVLEERREKAQ 161


>gi|240015828|ref|ZP_04722368.1| lipoprotein signal peptidase [Neisseria gonorrhoeae FA6140]
 gi|240112175|ref|ZP_04726665.1| lipoprotein signal peptidase [Neisseria gonorrhoeae MS11]
          Length = 151

 Score = 89.3 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 25/99 (25%), Positives = 53/99 (53%), Gaps = 1/99 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + + + + A++     ++    ++  IG  +I  GA GNV+D  ++G+V+D++
Sbjct: 53  GWQKYFFLVLAVAVSAYLVRAILRDEFA-ALGKIGAAMIIGGASGNVIDRLIHGHVVDFL 111

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           + + Q W +  FN+AD FI +G  + + D+I+ +   K 
Sbjct: 112 LFYWQNWFYPAFNIADSFICVGAVLAVLDNIVHRKDSKK 150


>gi|293376241|ref|ZP_06622484.1| signal peptidase II [Turicibacter sanguinis PC909]
 gi|325845148|ref|ZP_08168457.1| signal peptidase II [Turicibacter sp. HGF1]
 gi|292645133|gb|EFF63200.1| signal peptidase II [Turicibacter sanguinis PC909]
 gi|325488813|gb|EGC91213.1| signal peptidase II [Turicibacter sp. HGF1]
          Length = 152

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 27/99 (27%), Positives = 46/99 (46%)

Query: 2   LSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVID 61
                    +    +I   I ++ + + K      I   LI  GA+GN +D  LY +V+D
Sbjct: 54  FQGKMMFFYLITLAVIAVVIVWMTRLDIKKDKWLMIALALILGGAVGNFIDRVLYQHVVD 113

Query: 62  YIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
           +I  +   + F +FN+AD  + IG  ++  D I+   RQ
Sbjct: 114 FIDTYILGYDFPIFNIADSALCIGVVLMAIDAILDMKRQ 152


>gi|297583962|ref|YP_003699742.1| lipoprotein signal peptidase [Bacillus selenitireducens MLS10]
 gi|297142419|gb|ADH99176.1| lipoprotein signal peptidase [Bacillus selenitireducens MLS10]
          Length = 155

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 49/95 (51%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
              +     ++++  I ++     K    F I   L+  GA+GN +D  L G V+D+I +
Sbjct: 57  QMWLFYIATVIVVGVIVYMIITQAKESRFFGISLGLVLGGAIGNFIDRLLEGEVVDFIDV 116

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
              T++F +FN+AD  + IG  +++   I+ + RQ
Sbjct: 117 FIFTYNFPIFNVADSALVIGVGLMMIYFILEEKRQ 151


>gi|148259646|ref|YP_001233773.1| lipoprotein signal peptidase [Acidiphilium cryptum JF-5]
 gi|146401327|gb|ABQ29854.1| signal peptidase II, Aspartic peptidase, MEROPS family A08
           [Acidiphilium cryptum JF-5]
          Length = 177

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 23/80 (28%), Positives = 37/80 (46%), Gaps = 2/80 (2%)

Query: 20  FIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQTWSFAVFNLAD 79
            +     + P    +  +G   I  GA GNV+    YG V+D++ +H     + VFNLAD
Sbjct: 85  GLSVWLWRTPS--LLAALGLGAIIGGAAGNVISRIAYGAVVDFVDVHVGNLHWYVFNLAD 142

Query: 80  LFISIGTCIIIYDDIILQHR 99
             I  G   +I + +  + R
Sbjct: 143 AAIDGGVAALIIESLFSRDR 162


>gi|120597246|ref|YP_961820.1| lipoprotein signal peptidase [Shewanella sp. W3-18-1]
 gi|120597271|ref|YP_961845.1| lipoprotein signal peptidase [Shewanella sp. W3-18-1]
 gi|120597350|ref|YP_961924.1| lipoprotein signal peptidase [Shewanella sp. W3-18-1]
 gi|146291307|ref|YP_001181731.1| lipoprotein signal peptidase [Shewanella putrefaciens CN-32]
 gi|146291333|ref|YP_001181757.1| lipoprotein signal peptidase [Shewanella putrefaciens CN-32]
 gi|120557339|gb|ABM23266.1| signal peptidase II. Aspartic peptidase. MEROPS family A08
           [Shewanella sp. W3-18-1]
 gi|120557364|gb|ABM23291.1| signal peptidase II. Aspartic peptidase. MEROPS family A08
           [Shewanella sp. W3-18-1]
 gi|120557443|gb|ABM23370.1| signal peptidase II. Aspartic peptidase. MEROPS family A08
           [Shewanella sp. W3-18-1]
 gi|145562997|gb|ABP73932.1| lipoprotein signal peptidase [Shewanella putrefaciens CN-32]
 gi|145563023|gb|ABP73958.1| lipoprotein signal peptidase [Shewanella putrefaciens CN-32]
          Length = 170

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 23/83 (27%), Positives = 39/83 (46%), Gaps = 2/83 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + I +++  F+  +  +N        I   LI  GA+GN++D    GYV+D  
Sbjct: 67  GWQRYFFIGIAVVVSIFLIKLILENR--HKGEAIACSLILGGAMGNLIDRVFRGYVVDSF 124

Query: 64  MIHTQTWSFAVFNLADLFISIGT 86
             + + W +  FNLAD+ I +G 
Sbjct: 125 DFYWRDWHWPAFNLADIAIVLGA 147


>gi|331006483|ref|ZP_08329784.1| Lipoprotein signal peptidase [gamma proteobacterium IMCC1989]
 gi|330419708|gb|EGG94073.1| Lipoprotein signal peptidase [gamma proteobacterium IMCC1989]
          Length = 191

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 27/116 (23%), Positives = 43/116 (37%), Gaps = 17/116 (14%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                 L  +   +  F+ F        K I  +G  L+  GA+GN+ D    GYV+D+I
Sbjct: 75  GWQRIFLGVVAFAVSVFLVFWILCINSEKKIEILGLSLVLGGAIGNLWDRIYLGYVVDFI 134

Query: 64  MIHTQT-----------------WSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
                T                   +  FN+AD  I +G   +I D +  + R+  
Sbjct: 135 DWFYITANSDCLSFFYFIFSSQSCHWPAFNIADAAIMLGAACLIIDMLFFEPRKNE 190


>gi|81428559|ref|YP_395559.1| Signal peptidase II (lipoprotein signal peptidase) (prolipoprotein
           signal peptidase) [Lactobacillus sakei subsp. sakei 23K]
 gi|123564272|sp|Q38X31|LSPA_LACSS RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|78610201|emb|CAI55250.1| Signal peptidase II (Lipoprotein signal peptidase) (Prolipoprotein
           signal peptidase) [Lactobacillus sakei subsp. sakei 23K]
          Length = 151

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 22/98 (22%), Positives = 47/98 (47%), Gaps = 3/98 (3%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           ML+         + I+ +  I +++  + +++ ++ IG  L+  GALGN +D     YV+
Sbjct: 53  MLAG-QQWFFYIVTIIAVGVIGYLFYTSERSEKLYRIGLTLMLAGALGNFIDRLHLKYVV 111

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
           D   +      F +FN+AD  ++ G   +    ++ + 
Sbjct: 112 DMFQLEFIN--FPIFNVADTALTCGVICVFIAILLKEK 147


>gi|317127211|ref|YP_004093493.1| lipoprotein signal peptidase [Bacillus cellulosilyticus DSM 2522]
 gi|315472159|gb|ADU28762.1| lipoprotein signal peptidase [Bacillus cellulosilyticus DSM 2522]
          Length = 156

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 21/98 (21%), Positives = 50/98 (51%), Gaps = 1/98 (1%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGY-VIDYIM 64
              + + I I +   + ++ +   K  + + +   L+  GA+GN  D    G  V+D+I 
Sbjct: 56  QLWLFIIITIGVSCVLIYLIQTIKKGMNWYGVSLALLLGGAIGNFTDRLFRGGEVVDFIN 115

Query: 65  IHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           ++  +++F +FN+AD+ +++G  +++      + R K 
Sbjct: 116 VYIFSYNFPIFNVADMALNVGVVMMLIHLFKEEKRNKK 153


>gi|162452654|ref|YP_001615021.1| Signal peptidase II [Sorangium cellulosum 'So ce 56']
 gi|161163236|emb|CAN94541.1| Signal peptidase II [Sorangium cellulosum 'So ce 56']
          Length = 163

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 26/103 (25%), Positives = 49/103 (47%), Gaps = 4/103 (3%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S     +L+   ++++  +   W  + +       GY LI  GA+GN +D  + GYVID+
Sbjct: 65  SPAKVAVLLVCSMIVLGVVLLGWWSSRRASVTEQAGYALIVAGAIGNAIDRGVRGYVIDF 124

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
           I +H     + VFN+AD+ I  G  ++         ++  ++ 
Sbjct: 125 IHLH----RWPVFNVADIAIVAGGILLGIAMFRRARQEPREVS 163


>gi|85859342|ref|YP_461544.1| lipoprotein signal peptidase [Syntrophus aciditrophicus SB]
 gi|123516549|sp|Q2LTG5|LSPA_SYNAS RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|85722433|gb|ABC77376.1| lipoprotein signal peptidase [Syntrophus aciditrophicus SB]
          Length = 161

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 28/92 (30%), Positives = 47/92 (51%)

Query: 9   ILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQ 68
              S+ ++    I F   KN  +  +  I   L+  GA+GN+VD   +G VID++ ++  
Sbjct: 69  FFTSVTLIAAGLILFYLIKNRVSDLMMVIPLALVLAGAMGNLVDRIRFGEVIDFLDVYIG 128

Query: 69  TWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
            + +  FN+AD  ISIG   ++ D I  Q  +
Sbjct: 129 RYHWPAFNIADTAISIGVLFLVVDMIQKQKEK 160


>gi|121595767|ref|YP_987663.1| lipoprotein signal peptidase [Acidovorax sp. JS42]
 gi|260557393|ref|ZP_05829608.1| signal peptidase II [Acinetobacter baumannii ATCC 19606]
 gi|120607847|gb|ABM43587.1| signal peptidase II [Acidovorax sp. JS42]
 gi|260409019|gb|EEX02322.1| signal peptidase II [Acinetobacter baumannii ATCC 19606]
          Length = 170

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 24/83 (28%), Positives = 40/83 (48%), Gaps = 2/83 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + I +++  F+  +  +N        I Y LI  GA+GN++D    GYV+D  
Sbjct: 67  GWQRYFFIGIAVVVSIFLIKLILENR--HKGEAIAYSLILGGAMGNLIDRVFRGYVVDSF 124

Query: 64  MIHTQTWSFAVFNLADLFISIGT 86
             + + W +  FNLAD+ I +G 
Sbjct: 125 DFYWRDWHWPAFNLADIAIVLGA 147


>gi|260771782|ref|ZP_05880700.1| lipoprotein signal peptidase [Vibrio metschnikovii CIP 69.14]
 gi|260613074|gb|EEX38275.1| lipoprotein signal peptidase [Vibrio metschnikovii CIP 69.14]
          Length = 74

 Score = 88.5 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 27/74 (36%), Positives = 44/74 (59%)

Query: 25 WKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQTWSFAVFNLADLFISI 84
           ++ P T+   +I Y LI  GA+GNV D  ++G+V+DY+  + +T+ +  FNLAD  I I
Sbjct: 1  MRRLPATEKWNNIAYALIIGGAVGNVFDRVVHGFVVDYLDFYWKTYHWPAFNLADSAICI 60

Query: 85 GTCIIIYDDIILQH 98
          G  ++I D    + 
Sbjct: 61 GAAMVILDGFRNKK 74


>gi|317121730|ref|YP_004101733.1| lipoprotein signal peptidase [Thermaerobacter marianensis DSM
           12885]
 gi|315591710|gb|ADU51006.1| lipoprotein signal peptidase [Thermaerobacter marianensis DSM
           12885]
          Length = 204

 Score = 88.5 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 35/78 (44%), Gaps = 1/78 (1%)

Query: 22  FFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQTWS-FAVFNLADL 80
            +   + P           L   GA+GN++D   +GYV+D+I +       + VFN+AD 
Sbjct: 72  LYWLPRLPGRAGTARFALGLQLGGAVGNLIDRLRWGYVVDFIDLEFWPLHRWPVFNVADA 131

Query: 81  FISIGTCIIIYDDIILQH 98
            I  GT +++   +    
Sbjct: 132 AIVTGTVLLVLWLLRGAE 149


>gi|297185511|gb|ADI24143.1| lipoprotein signal peptidase [Acinetobacter baumannii]
          Length = 163

 Score = 88.5 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 24/83 (28%), Positives = 40/83 (48%), Gaps = 2/83 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + I +++  F+  +  +N        I Y LI  GA+GN++D    GYV+D  
Sbjct: 60  GWQRYFFIGIAVVVSIFLIKLIFENR--HKGEAIAYSLILGGAMGNLIDRVFRGYVVDSF 117

Query: 64  MIHTQTWSFAVFNLADLFISIGT 86
             + + W +  FNLAD+ I +G 
Sbjct: 118 DFYWRDWHWPAFNLADIAIVLGA 140


>gi|262374456|ref|ZP_06067731.1| signal peptidase II [Acinetobacter junii SH205]
 gi|262310713|gb|EEY91802.1| signal peptidase II [Acinetobacter junii SH205]
          Length = 170

 Score = 88.5 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 24/83 (28%), Positives = 40/83 (48%), Gaps = 2/83 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + I +++  F+  +  +N        I Y LI  GA+GN++D    GYV+D  
Sbjct: 67  GWQRYFFIGIAVVVSIFLIKLILENR--HKGEAIAYSLILGGAMGNLIDRVFRGYVVDSF 124

Query: 64  MIHTQTWSFAVFNLADLFISIGT 86
             + + W +  FNLAD+ I +G 
Sbjct: 125 DFYWRDWHWPAFNLADIAIVLGA 147


>gi|71891906|ref|YP_277636.1| prolipoprotein signal peptidase [Candidatus Blochmannia
           pennsylvanicus str. BPEN]
 gi|123641146|sp|Q493S2|LSPA_BLOPB RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|71796012|gb|AAZ40763.1| prolipoprotein signal peptidase [Candidatus Blochmannia
           pennsylvanicus str. BPEN]
          Length = 165

 Score = 88.5 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 30/99 (30%), Positives = 47/99 (47%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S     + V I  L+I        K  +    + I Y ++  GALGN++D  LYG V+D+
Sbjct: 65  SLYYRWLFVWIITLVIVAFIIALYKLIERPKCYSISYSMVIGGALGNLLDRILYGAVVDF 124

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
           I +H + W +  FN+AD+ I IG  I+         +  
Sbjct: 125 IDVHIKNWHWPTFNVADIAICIGITIVTIRFYYDFIKNN 163


>gi|169797585|ref|YP_001715378.1| prolipoprotein signal peptidase (SPase II) [Acinetobacter baumannii
           AYE]
 gi|90265341|emb|CAJ77023.1| lipoprotein signal peptidase [Acinetobacter baumannii]
 gi|169150512|emb|CAM88419.1| prolipoprotein signal peptidase (SPase II) [Acinetobacter baumannii
           AYE]
 gi|239840492|gb|ACS32043.1| lipoprotein signal peptidase [Acinetobacter baumannii]
          Length = 170

 Score = 88.5 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 24/83 (28%), Positives = 40/83 (48%), Gaps = 2/83 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + I +++  F+  +  +N        I Y LI  GA+GN++D    GYV+D  
Sbjct: 67  GWQRYFFIGIAVVVSIFLIKLIFENR--HKGEAIAYSLILGGAMGNLIDRVFRGYVVDSF 124

Query: 64  MIHTQTWSFAVFNLADLFISIGT 86
             + + W +  FNLAD+ I +G 
Sbjct: 125 DFYWRDWHWPAFNLADIAIVLGA 147


>gi|149204455|ref|ZP_01881421.1| putative lipoprotein signal peptidase [Roseovarius sp. TM1035]
 gi|149141954|gb|EDM30003.1| putative lipoprotein signal peptidase [Roseovarius sp. TM1035]
          Length = 164

 Score = 88.5 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 20/98 (20%), Positives = 44/98 (44%), Gaps = 2/98 (2%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           +L       L ++ + +  ++  +  +      +  I Y  I  GALGNV+D   +  V 
Sbjct: 64  LLGGAPWWSLTALALAVCGWLTVMLVRTA--NPVEAIAYGAIIGGALGNVLDRIRFRSVT 121

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
           D++  +  +  +  FN+AD+F+  G  +++    +   
Sbjct: 122 DFLDFYVGSTHWPAFNMADVFVVSGVGLLLIAPWLSAK 159


>gi|83955800|ref|ZP_00964342.1| Peptidase A8, signal peptidase II [Sulfitobacter sp. NAS-14.1]
 gi|83839805|gb|EAP78982.1| Peptidase A8, signal peptidase II [Sulfitobacter sp. NAS-14.1]
          Length = 164

 Score = 88.5 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 21/98 (21%), Positives = 44/98 (44%), Gaps = 2/98 (2%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           +L       L ++ + +  ++  +  +      +  I Y  I  GALGNV+D   +  V 
Sbjct: 64  LLGGAPWWSLTALALAVCGWLTVMLVRTA--NPVEAIAYGAIIGGALGNVLDRIRFRGVT 121

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
           D++  H  +  +  FN+AD+F+  G  +++    +   
Sbjct: 122 DFLDFHAGSTHWPAFNMADVFVVGGVGLLLIAPWLSAK 159


>gi|320354486|ref|YP_004195825.1| lipoprotein signal peptidase [Desulfobulbus propionicus DSM 2032]
 gi|320122988|gb|ADW18534.1| lipoprotein signal peptidase [Desulfobulbus propionicus DSM 2032]
          Length = 160

 Score = 88.5 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 23/100 (23%), Positives = 52/100 (52%)

Query: 5   VSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIM 64
                 ++     + FI+   +   +    + +G  LI  GA+GN++D   +G+VID++ 
Sbjct: 61  WRQVFFIAAAGAALVFIWIAQRSFGRRSMAYTLGLALIAGGAIGNLIDRIRFGFVIDFLD 120

Query: 65  IHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
           ++  T+ +  FN+AD  I++G  + I ++++   +Q  + 
Sbjct: 121 VYVGTYHWPAFNIADSAITVGVILFIVNNLLFDRQQSERA 160


>gi|284048843|ref|YP_003399182.1| lipoprotein signal peptidase [Acidaminococcus fermentans DSM 20731]
 gi|283953064|gb|ADB47867.1| lipoprotein signal peptidase [Acidaminococcus fermentans DSM 20731]
          Length = 159

 Score = 88.1 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 28/103 (27%), Positives = 46/103 (44%), Gaps = 4/103 (3%)

Query: 5   VSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIM 64
                 V I +     IF +     +      +G  L   GALGN++D    GYVID++ 
Sbjct: 53  YQRVFFVVITLAAAVAIFLLRDHIRREGPRARLGTGLFLGGALGNLIDRIATGYVIDFVD 112

Query: 65  IHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDFP 107
            H     + VFN+AD+FI  G  +I++  +  +  +    + P
Sbjct: 113 FHF----WPVFNVADIFICAGVGLIVWSMLENETGKGQHPEQP 151


>gi|226329204|ref|ZP_03804722.1| hypothetical protein PROPEN_03107 [Proteus penneri ATCC 35198]
 gi|225202390|gb|EEG84744.1| hypothetical protein PROPEN_03107 [Proteus penneri ATCC 35198]
          Length = 91

 Score = 88.1 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 25/75 (33%), Positives = 43/75 (57%)

Query: 24 IWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQTWSFAVFNLADLFIS 83
          +  KN  +  + ++ Y LI  GALGN+ D  ++G+VID++ ++   W +  FN+AD+ I 
Sbjct: 1  MMYKNKASAKLSNVAYALIIGGALGNLSDRLIHGFVIDFLDVYVGDWHWPTFNIADMGIC 60

Query: 84 IGTCIIIYDDIILQH 98
          IG  +II +      
Sbjct: 61 IGAGLIIIESFFPDK 75


>gi|288957546|ref|YP_003447887.1| signal peptidase II [Azospirillum sp. B510]
 gi|288909854|dbj|BAI71343.1| signal peptidase II [Azospirillum sp. B510]
          Length = 171

 Score = 88.1 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 25/96 (26%), Positives = 48/96 (50%), Gaps = 2/96 (2%)

Query: 5   VSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIM 64
           + P IL ++  +I   +    ++    + +  +    I  GA+GNV D  ++G V+D++ 
Sbjct: 77  MMPYILSAVAAVIAVCLISWLRQ--AERRLVALALGFIIGGAVGNVADRLMHGAVVDFLD 134

Query: 65  IHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
            H   W F  FN+AD  IS+G  +++ D +     +
Sbjct: 135 FHLAGWHFWAFNVADSGISVGVVLLLIDGLFAGREK 170


>gi|332968410|gb|EGK07477.1| signal peptidase II [Kingella kingae ATCC 23330]
          Length = 173

 Score = 88.1 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 54/97 (55%), Gaps = 1/97 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                + + +  +I AF+    +K+ +     +    +I  GA GNV+D  ++G V+D++
Sbjct: 74  GWQKYLFMLLAFVISAFLAHEIRKS-EMSRWGNFAAAMIIGGAFGNVIDRFVHGKVVDFL 132

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
           + + Q WS+ VFN+AD F+ +G  ++++D+     R+
Sbjct: 133 LFYWQNWSYPVFNIADCFVCVGAALLVWDNWRQGKRK 169


>gi|171057919|ref|YP_001790268.1| lipoprotein signal peptidase [Leptothrix cholodnii SP-6]
 gi|170775364|gb|ACB33503.1| lipoprotein signal peptidase [Leptothrix cholodnii SP-6]
          Length = 170

 Score = 88.1 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 23/99 (23%), Positives = 46/99 (46%), Gaps = 8/99 (8%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +       +++ I       ++  ++  ++ +F     ++  GA+GNV+D   +GYV+D+
Sbjct: 67  AGWQRWFFITLGIAASGMFIWLL-RSHASQKLFAFSVSMLLGGAIGNVIDRAWHGYVVDF 125

Query: 63  IMIHTQ-------TWSFAVFNLADLFISIGTCIIIYDDI 94
           +  H            F  FN+AD  I+ G   +I D+I
Sbjct: 126 LQFHWDFLAPIFPGGYFPSFNVADCAITAGAIGLILDEI 164


>gi|332976323|gb|EGK13179.1| signal peptidase II [Desmospora sp. 8437]
          Length = 148

 Score = 88.1 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 20/97 (20%), Positives = 44/97 (45%), Gaps = 2/97 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
              + + + +L++  I     +  +++ +      LI  GA+GN++D    G V+D++  
Sbjct: 44  QQWLFIVVTVLVVVGILVYLARLKESQPLMSWSLALILGGAVGNLLDRIRLGEVVDFLDF 103

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
                 + +FN+AD  I IG  I++   +     +  
Sbjct: 104 RW--IHYPIFNVADSAIVIGVGIMLLYTLRQPREKDD 138


>gi|126215738|sp|Q4ULU0|LSPA_RICFE RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
          Length = 197

 Score = 88.1 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 37/108 (34%), Positives = 56/108 (51%), Gaps = 6/108 (5%)

Query: 5   VSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIM 64
            S  I +    LI+ +++++  ++    S    GY  +  GA+GN++D    G V D+I 
Sbjct: 72  YSNAIFLITNTLIVCYLYYLMIRSKTIGSFA--GYSFVIGGAVGNLIDRFFRGAVFDFIH 129

Query: 65  IHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH----RQKGKIDFPQ 108
            H Q +SF VFNLAD FI+IG  I+I D    +     + KG  D  Q
Sbjct: 130 FHYQNYSFPVFNLADCFITIGVIILIEDYYSTKKVIEEKAKGNYDNAQ 177


>gi|160872207|ref|ZP_02062339.1| signal peptidase II [Rickettsiella grylli]
 gi|159121006|gb|EDP46344.1| signal peptidase II [Rickettsiella grylli]
          Length = 173

 Score = 88.1 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 42/97 (43%), Gaps = 1/97 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S     +  +I  ++  ++  +  +      +      LI  GA+GN+ D    GYVID+
Sbjct: 78  SGWQRWVFSAISGIVSIYLIRLLYRGGLNNGV-ACAVSLILGGAIGNLYDRLSLGYVIDF 136

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
           I      W FA FNLAD  ISIG  + I        +
Sbjct: 137 IDFCLGYWHFATFNLADTAISIGAVLWIVSSYKHDKK 173


>gi|258546200|ref|ZP_05706434.1| signal peptidase II [Cardiobacterium hominis ATCC 15826]
 gi|258518625|gb|EEV87484.1| signal peptidase II [Cardiobacterium hominis ATCC 15826]
          Length = 158

 Score = 88.1 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 23/96 (23%), Positives = 46/96 (47%), Gaps = 1/96 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S       + I  +I  ++ +       T ++  + Y  I  GA+GN+ D  L+G V+D+
Sbjct: 59  SGWQRWFFMGIATVIGLWLCYAIVFER-TNALTRLAYASILGGAIGNLYDRILHGKVVDF 117

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
           I  H  +  +  FN+AD+ I +G  +++   ++   
Sbjct: 118 ISWHIGSAYWPTFNVADVGICVGVGLLVIAWLVEWR 153


>gi|54023756|ref|YP_117998.1| lipoprotein signal peptidase [Nocardia farcinica IFM 10152]
 gi|54015264|dbj|BAD56634.1| putative signal peptidase [Nocardia farcinica IFM 10152]
          Length = 240

 Score = 87.7 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 21/98 (21%), Positives = 40/98 (40%), Gaps = 12/98 (12%)

Query: 7   PTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYG------YVI 60
             +L  I   ++  +  I +        + IG  ++  GALGN+ D           +V+
Sbjct: 90  TWLLTLIATAVVIGVIRIGRTLRS--LWWAIGLGMVLGGALGNLTDRLFRSPGPLQGHVV 147

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
           D++ +      F VFN+AD  I  G  +++   +    
Sbjct: 148 DFVAVG----DFPVFNVADSAIVCGATLLVVATVFGFE 181


>gi|163784366|ref|ZP_02179263.1| lipoprotein signal peptidase [Hydrogenivirga sp. 128-5-R1-1]
 gi|159880365|gb|EDP73972.1| lipoprotein signal peptidase [Hydrogenivirga sp. 128-5-R1-1]
          Length = 167

 Score = 87.7 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 30/97 (30%), Positives = 52/97 (53%)

Query: 9   ILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQ 68
           +L +  I ++A   + + K  +  ++  I   LI  GA+GN+ D  + G V D+I  H  
Sbjct: 68  LLGASSIAVLATAVYAFSKRKELSNLETIFLGLIAGGAVGNLYDRFILGKVRDFIDFHIL 127

Query: 69  TWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
            + +  FN+AD  I+IG    I++++ L+ R K K D
Sbjct: 128 NYHWPAFNIADASITIGIAGFIFNELYLKKRLKNKQD 164


>gi|300867010|ref|ZP_07111680.1| lipoprotein signal peptidase [Oscillatoria sp. PCC 6506]
 gi|300334993|emb|CBN56846.1| lipoprotein signal peptidase [Oscillatoria sp. PCC 6506]
          Length = 167

 Score = 87.7 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 27/103 (26%), Positives = 45/103 (43%), Gaps = 2/103 (1%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           + SN     L  + + +   +  +    P+      +GY LI  GALGN +D  + G V+
Sbjct: 61  LFSNGGVNWLRWLSLAVSIGLMVLAWFGPRLNRWEQVGYGLILGGALGNGIDRFISGAVV 120

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
           D++        F VFNLAD+FI+ G   ++          +  
Sbjct: 121 DFLDFRL--IRFPVFNLADVFINAGIICLLIAIFRNSPPPRNN 161


>gi|225166290|ref|ZP_03727983.1| lipoprotein signal peptidase [Opitutaceae bacterium TAV2]
 gi|224799464|gb|EEG18000.1| lipoprotein signal peptidase [Opitutaceae bacterium TAV2]
          Length = 125

 Score = 87.7 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 25/104 (24%), Positives = 49/104 (47%), Gaps = 1/104 (0%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           + +  S   L  +    +  I+    +      +  +G+ L+  G +GN+VD  L+G+VI
Sbjct: 18  LFAGKS-FFLAILAAATLGGIYLWRHQLGLRSRVAQVGFGLLCGGIVGNLVDRLLHGHVI 76

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
           D++  H   + +  FN+AD+ I IG  I +   ++     K + 
Sbjct: 77  DFLDFHFGGYVYPTFNVADMGICIGVGIYLIHSLLQPGPGKNEN 120


>gi|13472802|ref|NP_104369.1| lipoprotein signal peptidase [Mesorhizobium loti MAFF303099]
 gi|81855541|sp|Q98GR1|LSPA_RHILO RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|14023549|dbj|BAB50155.1| lipoprotein signal peptidase [Mesorhizobium loti MAFF303099]
          Length = 168

 Score = 87.7 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 45/104 (43%), Positives = 68/104 (65%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           M S+   T LV I +L++AF+ ++  + P    I   G+ LI  GALGN++D  +YG+VI
Sbjct: 55  MFSSFGDTGLVVIAVLVVAFVLYLATRTPSGHVIARTGFALIIGGALGNLIDRAVYGHVI 114

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
           DYI+ HT  WSFA+FNLAD FIS+G  ++++D++I   R+    
Sbjct: 115 DYILFHTPVWSFAIFNLADAFISVGAALVVFDELIGWRREPSNA 158


>gi|330994145|ref|ZP_08318073.1| Lipoprotein signal peptidase [Gluconacetobacter sp. SXCC-1]
 gi|329758612|gb|EGG75128.1| Lipoprotein signal peptidase [Gluconacetobacter sp. SXCC-1]
          Length = 157

 Score = 87.7 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 28/92 (30%), Positives = 44/92 (47%), Gaps = 2/92 (2%)

Query: 7   PTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIH 66
             I     +LI+  +     + P  +    +   LI  GA+GNV D   +G V+D+I  H
Sbjct: 66  RIIFSIAALLIVTGLGVWLARTP--RRWVAMALGLIMGGAIGNVTDRLRFGAVVDFIHAH 123

Query: 67  TQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
               S+ VFN+AD  I  G  I+I D++  + 
Sbjct: 124 AYGHSWPVFNIADALIDCGVAILIIDNMRNRD 155


>gi|157825686|ref|YP_001493406.1| lipoprotein signal peptidase [Rickettsia akari str. Hartford]
 gi|166232872|sp|A8GNC3|LSPA_RICAH RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|157799644|gb|ABV74898.1| lipoprotein signal peptidase [Rickettsia akari str. Hartford]
          Length = 196

 Score = 87.7 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 37/108 (34%), Positives = 58/108 (53%), Gaps = 6/108 (5%)

Query: 5   VSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIM 64
            S  I +    LI+ +++++  ++    S    GY  +  GA+GN++D C  G V D+I 
Sbjct: 72  YSNAIFLITNTLIVCYLYYLMIRSNTIGSFA--GYSFVIGGAVGNLIDRCFRGAVFDFIH 129

Query: 65  IHTQTWSFAVFNLADLFISIGTCIIIYDD----IILQHRQKGKIDFPQ 108
            H   +SF VFNLAD FI+IG  I+I D      +++ + KG  D  Q
Sbjct: 130 FHYHNYSFPVFNLADCFITIGVIILIEDYDNTKKVIEEKIKGNYDNAQ 177


>gi|325267046|ref|ZP_08133716.1| signal peptidase II [Kingella denitrificans ATCC 33394]
 gi|324981546|gb|EGC17188.1| signal peptidase II [Kingella denitrificans ATCC 33394]
          Length = 194

 Score = 87.7 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 24/96 (25%), Positives = 49/96 (51%), Gaps = 1/96 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                + + +   I  ++    +K  +     +    +I  GA GNV+D   YG V+D++
Sbjct: 98  GWQKYLFMLLAFAISGWLGNEIRKG-ELGKTGNFAAAMIIGGAFGNVIDRFAYGKVVDFL 156

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
           +++ Q W + VFN+AD F+ +G  +++ D I  + +
Sbjct: 157 LVYWQNWHYPVFNIADCFVCVGAVLLVIDSIRHKKK 192


>gi|148556684|ref|YP_001264266.1| lipoprotein signal peptidase [Sphingomonas wittichii RW1]
 gi|166232879|sp|A5VCW2|LSPA_SPHWW RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|148501874|gb|ABQ70128.1| lipoprotein signal peptidase [Sphingomonas wittichii RW1]
          Length = 172

 Score = 87.7 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 29/99 (29%), Positives = 49/99 (49%), Gaps = 3/99 (3%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S+    +LV+   LI A I     +      +  +   L+  GA+GN+ D    GYV D+
Sbjct: 67  SDRERWLLVAGTALIAAGIVAWIWREKAKGDV--VALGLVLGGAIGNIADRTRLGYVADF 124

Query: 63  IMIHTQTWS-FAVFNLADLFISIGTCIIIYDDIILQHRQ 100
           +  H   W  F VFN+AD  I+IG  I++   ++++  +
Sbjct: 125 LDPHIGDWHPFLVFNVADAAITIGVLILVLRALLVREPK 163


>gi|329890607|ref|ZP_08268950.1| signal peptidase II [Brevundimonas diminuta ATCC 11568]
 gi|328845908|gb|EGF95472.1| signal peptidase II [Brevundimonas diminuta ATCC 11568]
          Length = 175

 Score = 87.4 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 21/96 (21%), Positives = 44/96 (45%), Gaps = 2/96 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                IL    +++   + +   +    + +      L+  GA+GNV+D   +G V+D++
Sbjct: 72  GAGRWILSVFSVVVAGLLAWWATR--ADRRLLIAAIGLVMGGAVGNVIDRIRFGGVVDFL 129

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
                     +FN+AD  I++G  ++I D  + + R
Sbjct: 130 DFSGTGLFPWIFNIADSGITVGVALLILDSFLSERR 165


>gi|225872169|ref|YP_002753624.1| signal peptidase II [Acidobacterium capsulatum ATCC 51196]
 gi|225793730|gb|ACO33820.1| signal peptidase II [Acidobacterium capsulatum ATCC 51196]
          Length = 175

 Score = 87.4 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 25/95 (26%), Positives = 48/95 (50%)

Query: 9   ILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQ 68
           +L    +  I  +  +  K  +  ++  +   LI  GA+GNV D  +Y  V D++ +   
Sbjct: 78  LLTGFSLFAIIIVLGVLLKIGRRFTMTGLALALILGGAIGNVWDRIVYKEVTDFLAVTII 137

Query: 69  TWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
            + +  FNLAD  I IG C+++ D ++ +  Q+ +
Sbjct: 138 HYHWPDFNLADSAIVIGGCLLLLDALLGKKHQESE 172


>gi|83648574|ref|YP_437009.1| lipoprotein signal peptidase [Hahella chejuensis KCTC 2396]
 gi|83636617|gb|ABC32584.1| lipoprotein signal peptidase [Hahella chejuensis KCTC 2396]
          Length = 179

 Score = 87.4 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 40/94 (42%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S       + +  ++   +     +  + +        L+  GALGN+ D  + GYV+D+
Sbjct: 78  SGWQRWFFIILAAVVSVVLVLWLVRLTREERWMACALSLVLGGALGNLYDRAVLGYVVDF 137

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIIL 96
           +      ++F  FN AD  I+IG  +I  D    
Sbjct: 138 LHFFYGGYNFPAFNFADTTITIGAFMIAIDVFRN 171


>gi|299136786|ref|ZP_07029969.1| lipoprotein signal peptidase [Acidobacterium sp. MP5ACTX8]
 gi|298601301|gb|EFI57456.1| lipoprotein signal peptidase [Acidobacterium sp. MP5ACTX8]
          Length = 167

 Score = 87.4 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 24/92 (26%), Positives = 49/92 (53%)

Query: 7   PTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIH 66
             +LV   +  I  +  +  K  ++ ++  +   LI  GA+GN+ D  LY +V+D++ +H
Sbjct: 74  RNLLVGFSVAAIVLVLVLLWKLGRSFTLTSVALALILGGAIGNLYDRILYKHVVDFLEVH 133

Query: 67  TQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
              + +  FN+AD  I +G C+++ + +  Q 
Sbjct: 134 IVHYHWPDFNVADSAIVVGACLLLIEILRPQR 165


>gi|148822762|ref|YP_001287517.1| lipoprotein signal peptidase [Mycobacterium tuberculosis F11]
 gi|253799406|ref|YP_003032407.1| lipoprotein signal peptidase lspA [Mycobacterium tuberculosis KZN
           1435]
 gi|254231767|ref|ZP_04925094.1| lipoprotein signal peptidase lspA [Mycobacterium tuberculosis C]
 gi|289554670|ref|ZP_06443880.1| lipoprotein signal peptidase lspA [Mycobacterium tuberculosis KZN
           605]
 gi|289745294|ref|ZP_06504672.1| lipoprotein signal peptidase lspA [Mycobacterium tuberculosis
           02_1987]
 gi|298525050|ref|ZP_07012459.1| lipoprotein signal peptidase lspA [Mycobacterium tuberculosis
           94_M4241A]
 gi|308231866|ref|ZP_07414065.2| lipoprotein signal peptidase lspA [Mycobacterium tuberculosis
           SUMu001]
 gi|308370755|ref|ZP_07667012.1| lipoprotein signal peptidase lspA [Mycobacterium tuberculosis
           SUMu003]
 gi|308371992|ref|ZP_07667281.1| lipoprotein signal peptidase lspA [Mycobacterium tuberculosis
           SUMu004]
 gi|308374338|ref|ZP_07667764.1| lipoprotein signal peptidase lspA [Mycobacterium tuberculosis
           SUMu006]
 gi|308377760|ref|ZP_07668588.1| lipoprotein signal peptidase lspA [Mycobacterium tuberculosis
           SUMu009]
 gi|308380107|ref|ZP_07669120.1| lipoprotein signal peptidase lspA [Mycobacterium tuberculosis
           SUMu011]
 gi|308400684|ref|ZP_07669398.1| lipoprotein signal peptidase lspA [Mycobacterium tuberculosis
           SUMu012]
 gi|124600826|gb|EAY59836.1| lipoprotein signal peptidase lspA [Mycobacterium tuberculosis C]
 gi|148721289|gb|ABR05914.1| lipoprotein signal peptidase lspA [Mycobacterium tuberculosis F11]
 gi|253320910|gb|ACT25513.1| lipoprotein signal peptidase lspA [Mycobacterium tuberculosis KZN
           1435]
 gi|289439302|gb|EFD21795.1| lipoprotein signal peptidase lspA [Mycobacterium tuberculosis KZN
           605]
 gi|289685822|gb|EFD53310.1| lipoprotein signal peptidase lspA [Mycobacterium tuberculosis
           02_1987]
 gi|298494844|gb|EFI30138.1| lipoprotein signal peptidase lspA [Mycobacterium tuberculosis
           94_M4241A]
 gi|308215822|gb|EFO75221.1| lipoprotein signal peptidase lspA [Mycobacterium tuberculosis
           SUMu001]
 gi|308330949|gb|EFP19800.1| lipoprotein signal peptidase lspA [Mycobacterium tuberculosis
           SUMu003]
 gi|308334770|gb|EFP23621.1| lipoprotein signal peptidase lspA [Mycobacterium tuberculosis
           SUMu004]
 gi|308342260|gb|EFP31111.1| lipoprotein signal peptidase lspA [Mycobacterium tuberculosis
           SUMu006]
 gi|308354709|gb|EFP43560.1| lipoprotein signal peptidase lspA [Mycobacterium tuberculosis
           SUMu009]
 gi|308362575|gb|EFP51426.1| lipoprotein signal peptidase lspA [Mycobacterium tuberculosis
           SUMu011]
 gi|308366239|gb|EFP55090.1| lipoprotein signal peptidase lspA [Mycobacterium tuberculosis
           SUMu012]
 gi|323719987|gb|EGB29099.1| lipoprotein signal peptidase lspA [Mycobacterium tuberculosis
           CDC1551A]
 gi|328459157|gb|AEB04580.1| lipoprotein signal peptidase lspA [Mycobacterium tuberculosis KZN
           4207]
          Length = 224

 Score = 87.4 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 22/95 (23%), Positives = 45/95 (47%), Gaps = 12/95 (12%)

Query: 7   PTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCL------YGYVI 60
             +L  I   ++  IF++ ++       + +G  +I  GA+GN+VD          G+V+
Sbjct: 112 TWVLTLIATGVVVGIFWMGRRL--VSPWWALGLGMILGGAMGNLVDRFFRAPGPLRGHVV 169

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDII 95
           D++ +      + VFN+AD  +  G  +++   I 
Sbjct: 170 DFLSVGW----WPVFNVADPSVVGGAILLVILSIF 200


>gi|172057959|ref|YP_001814419.1| lipoprotein signal peptidase [Exiguobacterium sibiricum 255-15]
 gi|171990480|gb|ACB61402.1| lipoprotein signal peptidase [Exiguobacterium sibiricum 255-15]
          Length = 157

 Score = 87.4 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 19/94 (20%), Positives = 44/94 (46%)

Query: 9   ILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQ 68
               I ++++  + +   K      +F     L+  GA+GN +D    G V+D+   +  
Sbjct: 60  FFFVITLVVVIGLIYFLYKEGTKNKVFAWSVALLLGGAVGNFIDRMARGEVVDFFHFYPF 119

Query: 69  TWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
            ++F +FN+AD+ ++ G  +++   +  +   K 
Sbjct: 120 GYNFPIFNVADVSLTFGVILMLISVMFEERLTKK 153


>gi|15895384|ref|NP_348733.1| lipoprotein signal peptidase [Clostridium acetobutylicum ATCC 824]
 gi|81854810|sp|Q97H98|LSPA_CLOAB RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|15025104|gb|AAK80073.1|AE007712_9 Lipoprotein signal peptidase [Clostridium acetobutylicum ATCC 824]
 gi|325509530|gb|ADZ21166.1| Lipoprotein signal peptidase [Clostridium acetobutylicum EA 2018]
          Length = 154

 Score = 87.4 bits (216), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 28/104 (26%), Positives = 54/104 (51%), Gaps = 2/104 (1%)

Query: 2   LSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVID 61
            S     +L ++ +L+++ I     K      +  I   L+ +GALGN+ D   Y YV+D
Sbjct: 52  FSG-KTLVLSAVTLLVLSAIIVYMIKYRPKSKLARISLSLVISGALGNLYDRVFYKYVVD 110

Query: 62  YIMIHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
              +H +  + + VFN+AD+ + +GT +I    ++   ++ GK+
Sbjct: 111 LFSLHYKDIYYYPVFNVADICVVVGTIMIAIFIVLKDDKKDGKV 154


>gi|313903977|ref|ZP_07837357.1| lipoprotein signal peptidase [Eubacterium cellulosolvens 6]
 gi|313471126|gb|EFR66448.1| lipoprotein signal peptidase [Eubacterium cellulosolvens 6]
          Length = 199

 Score = 87.4 bits (216), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 26/106 (24%), Positives = 50/106 (47%), Gaps = 5/106 (4%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSI--FDIGYILITTGALGNVVDHCLYGY 58
           ML N        +  +       +  + P+        I  +++ +GA GN +D  +  Y
Sbjct: 89  MLQN-QQWFFYILTTVFFILAVVVLYRLPQNAKYRPMTISVVVLLSGAAGNFIDRVVNRY 147

Query: 59  VIDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
           VID+I  + +  +F VFN+AD+++++G  I+I   I     +  K+
Sbjct: 148 VIDFI--YVELINFPVFNVADIYVTVGVTILIVLMIFKYKDEDMKV 191


>gi|332527594|ref|ZP_08403641.1| lipoprotein signal peptidase [Rubrivivax benzoatilyticus JA2]
 gi|332111997|gb|EGJ11974.1| lipoprotein signal peptidase [Rubrivivax benzoatilyticus JA2]
          Length = 172

 Score = 87.4 bits (216), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 27/104 (25%), Positives = 49/104 (47%), Gaps = 8/104 (7%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +       V + +   A I ++   N  ++ +F     +I  GA+GNV+D  L+G+VID+
Sbjct: 67  AGWQRWFFVGVGVAASAVIVWMLA-NHASQRLFSFAVTMILGGAVGNVIDRLLHGHVIDF 125

Query: 63  IMIHTQ-------TWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
           +               F  FN+AD  I++G   ++ D+I+   R
Sbjct: 126 LQFRFGFLEPMFRGGYFPSFNVADAAITLGAVCLVLDEILRVRR 169


>gi|328957531|ref|YP_004374917.1| lipoprotein signal peptidase [Carnobacterium sp. 17-4]
 gi|328673855|gb|AEB29901.1| lipoprotein signal peptidase [Carnobacterium sp. 17-4]
          Length = 142

 Score = 87.0 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 30/98 (30%), Positives = 50/98 (51%), Gaps = 2/98 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
                  I I++I F+ +  +K  K   +F I   LI  G++GN +D   + YVID + +
Sbjct: 46  QMWFFYIITIIVIGFVIYYLQKYGKQSRLFSIALALILAGSIGNFIDRIRFEYVIDMVRL 105

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
                 F +FN+AD+ +SIG  ++I    I +  +K K
Sbjct: 106 EFIN--FPIFNVADMSLSIGVFLMIIFVFIDERNEKKK 141


>gi|110347232|ref|YP_666050.1| signal peptidase II [Mesorhizobium sp. BNC1]
 gi|110283343|gb|ABG61403.1| signal peptidase II, Aspartic peptidase, MEROPS family A08
           [Chelativorans sp. BNC1]
          Length = 165

 Score = 87.0 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 26/85 (30%), Positives = 39/85 (45%), Gaps = 2/85 (2%)

Query: 16  LIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQTWSFAVF 75
           +++ F+F              +   LIT GA GN+ D    G V D+I +H   W +  F
Sbjct: 80  VVVGFLFVWMLYAKTNG--HTMALGLITGGASGNIYDRMRQGAVTDFIDLHLGAWHWPTF 137

Query: 76  NLADLFISIGTCIIIYDDIILQHRQ 100
           N AD+ I +G  I+I D    +  Q
Sbjct: 138 NTADIAIVVGAAILIADSFRSKPGQ 162


>gi|163747595|ref|ZP_02154943.1| putative lipoprotein signal peptidase [Oceanibulbus indolifex
           HEL-45]
 gi|161379120|gb|EDQ03541.1| putative lipoprotein signal peptidase [Oceanibulbus indolifex
           HEL-45]
          Length = 158

 Score = 87.0 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 24/92 (26%), Positives = 45/92 (48%), Gaps = 2/92 (2%)

Query: 2   LSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVID 61
             NV   +L  +   ++ F+     +   T++   + Y ++  GALGN+VD   +  V D
Sbjct: 57  FQNVPWWVLALVATAVVLFLVVSLIR--ATQAAEAVAYGMVIGGALGNIVDRLRFEGVTD 114

Query: 62  YIMIHTQTWSFAVFNLADLFISIGTCIIIYDD 93
           ++  +  T  +  FNLAD+F+  G  I++   
Sbjct: 115 FLDFYLGTVHWPAFNLADVFVVCGVGILLIFS 146


>gi|300854257|ref|YP_003779241.1| putative signal peptidase [Clostridium ljungdahlii DSM 13528]
 gi|300434372|gb|ADK14139.1| predicted signal peptidase [Clostridium ljungdahlii DSM 13528]
          Length = 151

 Score = 87.0 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 28/92 (30%), Positives = 54/92 (58%), Gaps = 1/92 (1%)

Query: 8   TILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHT 67
             L  I I+++  + F   K   ++ +  I + LI +GALGN++D  +Y YV+D+I +H 
Sbjct: 57  YFLTIITIIVVGGMIFYIIKYKPSEKLIRISFSLIISGALGNLMDRMVYKYVVDFISVHY 116

Query: 68  QT-WSFAVFNLADLFISIGTCIIIYDDIILQH 98
           +  + F VFN+AD+ + +GT ++ +  +  + 
Sbjct: 117 KDIYYFPVFNIADVMVVVGTALLAFYLLKEEK 148


>gi|56964105|ref|YP_175836.1| lipoprotein signal peptidase [Bacillus clausii KSM-K16]
 gi|81822092|sp|Q5WFI5|LSPA_BACSK RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|56910348|dbj|BAD64875.1| signal peptidase II [Bacillus clausii KSM-K16]
          Length = 151

 Score = 87.0 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 23/96 (23%), Positives = 44/96 (45%), Gaps = 3/96 (3%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
                  +  +I+  I ++ +   K   +  I   L+  GA+GN +D  L   V+D+I  
Sbjct: 55  QMWFFYVVTTIIVGVIIYLIQTEAKGNRLLKIALGLVLGGAIGNFIDRLLRQEVVDFIDT 114

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
                 F +FN+AD  ++IG  + + + +I    +K
Sbjct: 115 ---FGDFPIFNIADSALTIGVGLFLLNILIQGRNEK 147


>gi|319404922|emb|CBI78522.1| Lipoprotein signal peptidase [Bartonella sp. AR 15-3]
          Length = 167

 Score = 87.0 bits (215), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 37/101 (36%), Positives = 62/101 (61%), Gaps = 1/101 (0%)

Query: 2   LSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVID 61
           LS+     +V++ +LII F+ ++WK     K +   G   I  GA+GN++D   + YVID
Sbjct: 58  LSSYPHWGIVALTLLIIVFLLWLWKNTENDKFLSHFGITFIIGGAVGNLIDRIRFHYVID 117

Query: 62  YIMIHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
           Y++ H    +SFAVFNLAD FI++G   ++ D+  ++ ++K
Sbjct: 118 YLLFHISDIFSFAVFNLADAFITLGVVAVLIDEFCIRTKKK 158


>gi|302528437|ref|ZP_07280779.1| signal peptidase (SPase) II [Streptomyces sp. AA4]
 gi|302437332|gb|EFL09148.1| signal peptidase (SPase) II [Streptomyces sp. AA4]
          Length = 202

 Score = 87.0 bits (215), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 25/99 (25%), Positives = 45/99 (45%), Gaps = 9/99 (9%)

Query: 7   PTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYG------YVI 60
             +L  + I ++  I +I ++         IG  L+  GALGN+ D           +V+
Sbjct: 92  TWVLALVAIGVVIAIVWISRRLRSVGW--AIGLGLVLAGALGNLTDRFFREPGPLRGHVV 149

Query: 61  DYIM-IHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
           D+I         FA+FN+AD  I +G  +I+   ++ + 
Sbjct: 150 DFISAFVPNGQGFAIFNIADSAICVGGALIVLLSLLGKD 188


>gi|15618446|ref|NP_224731.1| lipoprotein signal peptidase [Chlamydophila pneumoniae CWL029]
 gi|15836066|ref|NP_300590.1| lipoprotein signal peptidase [Chlamydophila pneumoniae J138]
 gi|16752506|ref|NP_444768.1| lipoprotein signal peptidase [Chlamydophila pneumoniae AR39]
 gi|8134562|sp|Q9Z817|LSPA_CHLPN RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|4376825|gb|AAD18675.1| Lipoprotein Signal Peptidase [Chlamydophila pneumoniae CWL029]
 gi|7189147|gb|AAF38086.1| lipoprotein signal peptidase [Chlamydophila pneumoniae AR39]
 gi|8978906|dbj|BAA98741.1| lipoprotein signal peptidase [Chlamydophila pneumoniae J138]
          Length = 168

 Score = 87.0 bits (215), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 28/103 (27%), Positives = 56/103 (54%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           + SN    + +    +I+  + +++ K    +S      +L+  GA+GNV D   YG+++
Sbjct: 65  LFSNYKYFLFLLRIFVILGLLAYLFFKKKSIQSTTQTALVLLCAGAIGNVGDIIFYGHIV 124

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
           D+I  + + W+F  FN+AD+ IS+GT +++Y       + + K
Sbjct: 125 DFISFNYKQWAFPTFNVADVLISLGTLLLVYKFYFPTKQTEKK 167


>gi|253576152|ref|ZP_04853484.1| signal peptidase (SPase) II [Paenibacillus sp. oral taxon 786 str.
           D14]
 gi|251844495|gb|EES72511.1| signal peptidase (SPase) II [Paenibacillus sp. oral taxon 786 str.
           D14]
          Length = 172

 Score = 87.0 bits (215), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 24/97 (24%), Positives = 50/97 (51%), Gaps = 1/97 (1%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKT-KSIFDIGYILITTGALGNVVDHCLYGYVIDYIM 64
                + +  +++  I +   K       +  +   L+  GA+GN +D  + G V+D++M
Sbjct: 64  QRWFFIVVTTVVVIGIVWYLLKVKNQPNKMLPVALSLVLGGAIGNFLDRAVSGEVVDFLM 123

Query: 65  IHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
            +  +++F +FN+AD  I +G  +II D ++   R+K
Sbjct: 124 FNFGSYTFPIFNVADSCIVVGVALIILDSLLELRREK 160


>gi|108762828|ref|YP_628643.1| lipoprotein signal peptidase [Myxococcus xanthus DK 1622]
 gi|108466708|gb|ABF91893.1| signal peptidase II [Myxococcus xanthus DK 1622]
          Length = 202

 Score = 87.0 bits (215), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 44/96 (45%), Gaps = 4/96 (4%)

Query: 8   TILVSIRILIIAFIFFIWKKNP---KTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIM 64
            +     I  +  I F ++K       +     G  L+  GALGN +D     +VID++ 
Sbjct: 99  PLFHVAIIGALILITFSFRKLTGTDPEEKWALWGLPLVLGGALGNYIDRVARAFVIDFLE 158

Query: 65  IHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQHR 99
           +H     +F  FN+AD  I IG  ++I D  + + +
Sbjct: 159 VHWFDKATFPSFNVADAAICIGVGMLIIDSFVRKEK 194


>gi|308069861|ref|YP_003871466.1| Lipoprotein signal peptidase (Prolipoprotein signal peptidase)
           [Paenibacillus polymyxa E681]
 gi|305859140|gb|ADM70928.1| Lipoprotein signal peptidase (Prolipoprotein signal peptidase)
           [Paenibacillus polymyxa E681]
          Length = 163

 Score = 87.0 bits (215), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 27/99 (27%), Positives = 52/99 (52%), Gaps = 1/99 (1%)

Query: 6   SPTILVSIRILIIAFIFFIWKKN-PKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIM 64
              + + I I+++  I +  +K     + +  +   L+  GA+GN +D  + G V+D+  
Sbjct: 56  QRWLFIVITIVVVIGIVWYLRKTVKAGQKLLPVALSLVLGGAVGNFLDRAISGEVVDFAQ 115

Query: 65  IHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
            +   ++F +FN+AD  I IG  +II D ++   R+KG 
Sbjct: 116 FNFGNYTFPIFNVADSAIVIGVALIILDTLLESRREKGN 154


>gi|99079933|ref|YP_612087.1| signal peptidase II [Ruegeria sp. TM1040]
 gi|99036213|gb|ABF62825.1| signal peptidase II. Aspartic peptidase. MEROPS family A08
           [Ruegeria sp. TM1040]
          Length = 160

 Score = 86.6 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 31/96 (32%), Positives = 52/96 (54%), Gaps = 1/96 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
           + S  IL+ I ++I A +F   +++     +  I   L+  GALGNV+D  LYGYV+D++
Sbjct: 63  DSSRWILIGISLIICAAVFLWVRRSHANSRLMLISAGLVIGGALGNVLDRVLYGYVLDFL 122

Query: 64  MIHTQTWSFA-VFNLADLFISIGTCIIIYDDIILQH 98
            +     +   VFN+AD+FI  G   +I  +   + 
Sbjct: 123 NMSCCGINNPYVFNVADVFIFAGAAGLILFEGRAKK 158


>gi|226313368|ref|YP_002773262.1| lipoprotein signal peptidase [Brevibacillus brevis NBRC 100599]
 gi|254810438|sp|C0ZG49|LSPA_BREBN RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|226096316|dbj|BAH44758.1| lipoprotein signal peptidase [Brevibacillus brevis NBRC 100599]
          Length = 149

 Score = 86.6 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 21/95 (22%), Positives = 45/95 (47%), Gaps = 2/95 (2%)

Query: 7   PTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIH 66
               ++I  +++  I     +  K +    +    +  GA+GN +D  + G V+D++   
Sbjct: 57  RWFFIAITAVVVIGIVISLIRLGKKQPRASLALSFVLGGAVGNFIDRAMSGQVVDFLDFT 116

Query: 67  TQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
                F +FN+AD+ I+IG  I++ D  +   + +
Sbjct: 117 L--IHFPIFNVADMAITIGVGILLLDVFLDGKKNR 149


>gi|301168534|emb|CBW28124.1| lipoprotein signal peptidase [Bacteriovorax marinus SJ]
          Length = 165

 Score = 86.6 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 28/101 (27%), Positives = 48/101 (47%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
            V     + +  +   ++ ++  K   T +     Y LI  GA+GN++D     YV+D  
Sbjct: 63  FVRILFFLILPTIACFWLLWLIWKTRHTSAWLCTTYSLIFAGAVGNLIDRYSLKYVVDMF 122

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
             +  T  FA FN+AD  ISI   ++I D   L+ +++ K 
Sbjct: 123 DFYIGTSHFAAFNIADSAISIAAVMLIIDFAYLEKKREEKA 163


>gi|15616768|ref|NP_239980.1| lipoprotein signal peptidase [Buchnera aphidicola str. APS
           (Acyrthosiphon pisum)]
 gi|11386909|sp|P57248|LSPA_BUCAI RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|25290079|pir||B84947 signal peptidase II (EC 3.4.23.36) [imported] - Buchnera sp.
           (strain APS)
 gi|10038831|dbj|BAB12866.1| lipoprotein signal peptidase [Buchnera aphidicola str. APS
           (Acyrthosiphon pisum)]
 gi|311085891|gb|ADP65973.1| lipoprotein signal peptidase [Buchnera aphidicola str. LL01
           (Acyrthosiphon pisum)]
 gi|311086463|gb|ADP66544.1| lipoprotein signal peptidase [Buchnera aphidicola str. TLW03
           (Acyrthosiphon pisum)]
 gi|311087044|gb|ADP67124.1| lipoprotein signal peptidase [Buchnera aphidicola str. JF99
           (Acyrthosiphon pisum)]
          Length = 160

 Score = 86.6 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 33/88 (37%), Positives = 47/88 (53%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +      L ++ IL I  +  I  K  K ++     Y LI  GA GN++D   YG+V+D+
Sbjct: 67  NGWQKWFLSTVSILTILVMTRIITKLKKQETKKITAYSLIIAGATGNLIDRIFYGFVVDF 126

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIII 90
           I IH   W FA FN+AD  I IG  I++
Sbjct: 127 IDIHINDWHFATFNIADCSIFIGIIILM 154


>gi|219682079|ref|YP_002468463.1| lipoprotein signal peptidase [Buchnera aphidicola str. Tuc7
           (Acyrthosiphon pisum)]
 gi|254810441|sp|B8D753|LSPA_BUCAT RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|219621812|gb|ACL29968.1| lipoprotein signal peptidase [Buchnera aphidicola str. Tuc7
           (Acyrthosiphon pisum)]
 gi|311087605|gb|ADP67684.1| lipoprotein signal peptidase [Buchnera aphidicola str. JF98
           (Acyrthosiphon pisum)]
          Length = 160

 Score = 86.6 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 33/88 (37%), Positives = 47/88 (53%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +      L ++ IL I  +  I  K  K ++     Y LI  GA GN++D   YG+V+D+
Sbjct: 67  NGWQKWFLSTVSILTILVMTRIITKLKKQETKKITAYSLIIAGATGNLIDRIFYGFVVDF 126

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIII 90
           I IH   W FA FN+AD  I IG  I++
Sbjct: 127 IDIHINDWHFATFNIADCSIFIGIIILM 154


>gi|226226807|ref|YP_002760913.1| lipoprotein signal peptidase [Gemmatimonas aurantiaca T-27]
 gi|226089998|dbj|BAH38443.1| lipoprotein signal peptidase [Gemmatimonas aurantiaca T-27]
          Length = 187

 Score = 86.6 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 20/108 (18%), Positives = 47/108 (43%), Gaps = 1/108 (0%)

Query: 2   LSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYG-YVI 60
           L   S  + + +  + +  ++ + +++ +      +   L+  GA+GNV+D       V+
Sbjct: 67  LGEYSRWLFMVLTGVALVVLWRLLRQSAEGDVRRLLAIALVAAGAVGNVIDRIRSELGVV 126

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDFPQ 108
           D+I I      +  FN+AD+ +S G  ++       +  +  +    Q
Sbjct: 127 DFIDIGIGLHRWPTFNVADIAVSSGAFLLAIVLWREERDEVARAAADQ 174


>gi|257465596|ref|ZP_05629967.1| lipoprotein signal peptidase [Actinobacillus minor 202]
 gi|257451256|gb|EEV25299.1| lipoprotein signal peptidase [Actinobacillus minor 202]
          Length = 191

 Score = 86.6 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 27/124 (21%), Positives = 50/124 (40%), Gaps = 25/124 (20%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKT---KSIFDIGYILITTGALGNVVDH------- 53
                  + + I+I   +  +  +N      K   +  Y LI  GA+GN +D        
Sbjct: 67  GWQTYFFLGLAIVISCALVVMLYRNKGDQAVKKWENAAYALIIGGAMGNAIDRAVDKCSL 126

Query: 54  -------------CLYGYVIDYIMIHTQ--TWSFAVFNLADLFISIGTCIIIYDDIILQH 98
                           GYV+D++  +     + FA FN+AD+ IS+G  +++   +I   
Sbjct: 127 FNIIPNEPYNKLNVCQGYVVDFLDFYWNWDGYHFATFNVADIAISVGAGLLMIASLIEAK 186

Query: 99  RQKG 102
           ++K 
Sbjct: 187 KKKS 190


>gi|219681523|ref|YP_002467908.1| lipoprotein signal peptidase [Buchnera aphidicola str. 5A
           (Acyrthosiphon pisum)]
 gi|257471204|ref|ZP_05635203.1| lipoprotein signal peptidase [Buchnera aphidicola str. LSR1
           (Acyrthosiphon pisum)]
 gi|254810440|sp|B8D8U9|LSPA_BUCA5 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|219624366|gb|ACL30521.1| lipoprotein signal peptidase [Buchnera aphidicola str. 5A
           (Acyrthosiphon pisum)]
          Length = 160

 Score = 86.6 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 32/88 (36%), Positives = 47/88 (53%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +      L ++ +L I  +  I  K  K ++     Y LI  GA GN++D   YG+V+D+
Sbjct: 67  NGWQKWFLSTVSMLTILVMTRIITKLKKQETKKITAYSLIIAGATGNLIDRIFYGFVVDF 126

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIII 90
           I IH   W FA FN+AD  I IG  I++
Sbjct: 127 IDIHINDWHFATFNIADCSIFIGIIILM 154


>gi|90420556|ref|ZP_01228463.1| putative lipoprotein signal peptidase [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90335284|gb|EAS49037.1| putative lipoprotein signal peptidase [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 168

 Score = 86.6 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 37/101 (36%), Positives = 63/101 (62%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           M S +    L ++  +++  +  +W K P  + +   G  +I  GA+GN++D  L GYV+
Sbjct: 57  MFSGMGEVGLAALAGVVLVVVMILWIKTPADRRLTHFGLAIIVGGAIGNLIDRVLLGYVV 116

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
           DY+  HT  W+FA+FNLAD  I++G  +I++D+ ILQ R++
Sbjct: 117 DYVYFHTPVWAFAIFNLADACITVGAGVILFDEFILQPRRE 157


>gi|169629785|ref|YP_001703434.1| lipoprotein signal peptidase [Mycobacterium abscessus ATCC 19977]
 gi|169241752|emb|CAM62780.1| Lipoprotein signal peptidase [Mycobacterium abscessus]
          Length = 195

 Score = 86.6 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 26/103 (25%), Positives = 47/103 (45%), Gaps = 12/103 (11%)

Query: 2   LSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCL------ 55
            +     +L  I I ++  I FI ++   T   + IG  +I  GALGN+VD         
Sbjct: 67  FATGYTWVLTLIAISVVVGILFIGRRLVST--WWAIGLGMILGGALGNLVDRFFRGPGPL 124

Query: 56  YGYVIDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
            G+V+D++ +      + VFN+AD  +  G  +++   +    
Sbjct: 125 RGHVVDFLSVGW----WPVFNVADPSVVGGAILLVALSLFGYD 163


>gi|83952901|ref|ZP_00961630.1| lipoprotein signal peptidase [Roseovarius nubinhibens ISM]
 gi|83835692|gb|EAP74992.1| lipoprotein signal peptidase [Roseovarius nubinhibens ISM]
          Length = 152

 Score = 86.6 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 25/99 (25%), Positives = 47/99 (47%), Gaps = 2/99 (2%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           ML       L+++ + I  ++  +  +     ++  + Y  I  GALGNV+D   Y  V 
Sbjct: 52  MLGGAPLWSLIALALAICVWLGVMLIR--AENAVETLAYGAIIGGALGNVIDRVRYRAVT 109

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
           D++  +  T  +  FN+AD+F+  G  +++    I   R
Sbjct: 110 DFLDFYIGTTHWPAFNMADVFVVSGVGLLLAAPWISARR 148


>gi|254473552|ref|ZP_05086948.1| signal peptidase II [Pseudovibrio sp. JE062]
 gi|211957264|gb|EEA92468.1| signal peptidase II [Pseudovibrio sp. JE062]
          Length = 168

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 27/99 (27%), Positives = 45/99 (45%), Gaps = 2/99 (2%)

Query: 5   VSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIM 64
           +    L +  +    FI   +        +  I   L+ +GAL N  D   YG V+DY+ 
Sbjct: 71  IGRWGLAAFTVAASVFI--WFWSARAINRLEAICLGLVLSGALSNGFDRLYYGQVVDYLY 128

Query: 65  IHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
            H   +S+ VFNLAD +I IG   ++ D + +   +  +
Sbjct: 129 FHVGEFSWYVFNLADAWIVIGAAGLLLDTLFIGKNKDSR 167


>gi|254456280|ref|ZP_05069709.1| signal peptidase II [Candidatus Pelagibacter sp. HTCC7211]
 gi|207083282|gb|EDZ60708.1| signal peptidase II [Candidatus Pelagibacter sp. HTCC7211]
          Length = 164

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 32/102 (31%), Positives = 55/102 (53%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           + S     +   +  +I+  I  I K    +K +   G ++I  GALGN+ D   Y  V 
Sbjct: 63  LFSFSQNNLYNLLTAIILIIILVILKMIIDSKGVKKYGLLMIFGGALGNLFDRLFYKAVP 122

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           D+I  H + + + VFN+AD+FI+IG  I+I  ++IL +++  
Sbjct: 123 DFIDFHVEEFHWFVFNVADIFITIGVIIMILFELILNNQKND 164


>gi|87123000|ref|ZP_01078859.1| signal peptidase II [Marinomonas sp. MED121]
 gi|86161717|gb|EAQ63023.1| signal peptidase II [Marinomonas sp. MED121]
          Length = 168

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 27/100 (27%), Positives = 47/100 (47%), Gaps = 1/100 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    I I+++  I +   K   +     +   LI  GA+GN+ D   YG+V+DY+
Sbjct: 67  GWQRWFFSIIAIVVVIGISWRLVKIASSNYWEALSLTLILGGAIGNLYDRLAYGHVVDYL 126

Query: 64  MIHT-QTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
             H  QTW F  FN+AD  I++G  +++ +  + +     
Sbjct: 127 QFHWQQTWYFPAFNIADSAITLGVIVMLLEGYLNKKFTNK 166


>gi|240950119|ref|ZP_04754412.1| lipoprotein signal peptidase [Actinobacillus minor NM305]
 gi|240295388|gb|EER46161.1| lipoprotein signal peptidase [Actinobacillus minor NM305]
          Length = 191

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 27/124 (21%), Positives = 50/124 (40%), Gaps = 25/124 (20%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKT---KSIFDIGYILITTGALGNVVDH------- 53
                  + + I+I   +  +  +N      K   +  Y LI  GA+GN +D        
Sbjct: 67  GWQTHFFLGLAIVISCALVVMLYRNKGDQAVKKWENAAYALIIGGAIGNAIDRAVDKCSL 126

Query: 54  -------------CLYGYVIDYIMIHTQ--TWSFAVFNLADLFISIGTCIIIYDDIILQH 98
                           GYV+D++  +     + FA FN+AD+ IS+G  +++   +I   
Sbjct: 127 FNIIPNEPYNKLNVCQGYVVDFLDFYWNWDGYHFATFNVADIAISVGAGLLVIASLIEAK 186

Query: 99  RQKG 102
           ++K 
Sbjct: 187 KKKS 190


>gi|310642967|ref|YP_003947725.1| signal peptidase (spase) ii [Paenibacillus polymyxa SC2]
 gi|309247917|gb|ADO57484.1| Signal peptidase (SPase) II [Paenibacillus polymyxa SC2]
          Length = 163

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 27/99 (27%), Positives = 53/99 (53%), Gaps = 1/99 (1%)

Query: 6   SPTILVSIRILIIAFIFFIWKKN-PKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIM 64
              + + I I+++  I +  +K     + +  +   L+  GA+GN +D  + G V+D+  
Sbjct: 56  QRWLFIVITIVVVIGIVWYLRKTVRAGQKLLPVALSLVLGGAVGNFLDRAISGEVVDFAQ 115

Query: 65  IHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
            +  +++F +FN+AD  I IG  +II D ++   R+KG 
Sbjct: 116 FNFGSYTFPIFNVADSAIVIGVALIILDTLLESRREKGN 154


>gi|257880995|ref|ZP_05660648.1| lipoprotein signal peptidase [Enterococcus faecium 1,231,502]
 gi|257816653|gb|EEV43981.1| lipoprotein signal peptidase [Enterococcus faecium 1,231,502]
          Length = 140

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 45/97 (46%), Gaps = 3/97 (3%)

Query: 8   TILVSIRILIIAFIFFIWKKNP-KTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIH 66
                + ++ +  I  +  KN  K    F IG  LI  GA+GN +D    GYV+D     
Sbjct: 46  WFFTIVTLIAVVVILTLMIKNREKGNRWFMIGLSLILAGAIGNFIDRIRLGYVVDMFQTD 105

Query: 67  TQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
               SF +FN+AD+ +  G   ++   I+ +  Q+ K
Sbjct: 106 FM--SFPIFNVADVTLVCGVICMLIYIILDEKDQRKK 140


>gi|84503200|ref|ZP_01001285.1| putative lipoprotein signal peptidase [Oceanicola batsensis
           HTCC2597]
 gi|84686766|ref|ZP_01014653.1| putative lipoprotein signal peptidase [Maritimibacter alkaliphilus
           HTCC2654]
 gi|114762615|ref|ZP_01442059.1| putative lipoprotein signal peptidase [Pelagibaca bermudensis
           HTCC2601]
 gi|159046156|ref|YP_001541828.1| lipoprotein signal peptidase [Dinoroseobacter shibae DFL 12]
 gi|159046491|ref|YP_001542161.1| lipoprotein signal peptidase [Dinoroseobacter shibae DFL 12]
 gi|84388441|gb|EAQ01390.1| putative lipoprotein signal peptidase [Oceanicola batsensis
           HTCC2597]
 gi|84665197|gb|EAQ11676.1| putative lipoprotein signal peptidase [Rhodobacterales bacterium
           HTCC2654]
 gi|114544870|gb|EAU47875.1| putative lipoprotein signal peptidase [Roseovarius sp. HTCC2601]
 gi|157913915|gb|ABV95347.1| lipoprotein signal peptidase [Dinoroseobacter shibae DFL 12]
 gi|157914250|gb|ABV95680.1| lipoprotein signal peptidase [Dinoroseobacter shibae DFL 12]
          Length = 157

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 24/92 (26%), Positives = 45/92 (48%), Gaps = 2/92 (2%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           +L       LV + + I  ++ F+  +   +  +  I Y  I  GALGN++D   Y  V 
Sbjct: 57  LLGGAPWWSLVLLALGICVWLAFMLVRT--SSRVEAIAYGAIIGGALGNILDRLRYRAVT 114

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYD 92
           D++  +  T  +  FN+AD+F+  G  +++  
Sbjct: 115 DFLDFYIGTAHWPAFNMADVFVVGGVMLLLIA 146


>gi|218960742|ref|YP_001740517.1| Signal peptidase II [Candidatus Cloacamonas acidaminovorans]
 gi|167729399|emb|CAO80310.1| Signal peptidase II [Candidatus Cloacamonas acidaminovorans]
          Length = 188

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 29/98 (29%), Positives = 51/98 (52%), Gaps = 5/98 (5%)

Query: 5   VSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIM 64
           V+  I + + +L++  I ++         I  I + LI  GALGN++D  L+G V D+  
Sbjct: 73  VNRIIFICVTVLVVGIIIYLLHY--AQHKIQVIAFGLILGGALGNLIDRVLFGPVTDFFS 130

Query: 65  IHTQTW---SFAVFNLADLFISIGTCIIIYDDIILQHR 99
           +    +    F VFN+AD  I IG  ++I D + ++ +
Sbjct: 131 MDFPDFIMERFPVFNIADSSIFIGVVLMIIDMLFIKDK 168


>gi|33241887|ref|NP_876828.1| lipoprotein signal peptidase [Chlamydophila pneumoniae TW-183]
 gi|33236397|gb|AAP98485.1| lipoprotein signal peptidase [Chlamydophila pneumoniae TW-183]
          Length = 158

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 28/103 (27%), Positives = 56/103 (54%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           + SN    + +    +I+  + +++ K    +S      +L+  GA+GNV D   YG+++
Sbjct: 55  LFSNYKYFLFLLRIFVILGLLAYLFFKKKSIQSTTQTALVLLCAGAIGNVGDIIFYGHIV 114

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
           D+I  + + W+F  FN+AD+ IS+GT +++Y       + + K
Sbjct: 115 DFISFNYKQWAFPTFNVADVLISLGTLLLVYKFYFPTKQTEKK 157


>gi|293401500|ref|ZP_06645643.1| signal peptidase II [Erysipelotrichaceae bacterium 5_2_54FAA]
 gi|291305138|gb|EFE46384.1| signal peptidase II [Erysipelotrichaceae bacterium 5_2_54FAA]
          Length = 162

 Score = 86.2 bits (213), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 19/98 (19%), Positives = 45/98 (45%), Gaps = 1/98 (1%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           M         + + ++ +  + + +    K  ++   G +L+  G LGN +D   + +V 
Sbjct: 57  MFEGKMG-FFMIVTVIALIVMGYFYYCAEKKDALTKYGLVLMMAGTLGNFIDRLCFQHVR 115

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
           D++      + F VFN+AD+ + +G  +I+    + + 
Sbjct: 116 DFLDFVILGYDFPVFNVADIALCVGVFLILVSVFLEER 153


>gi|91202040|emb|CAJ75100.1| similar to type II lipoprotein signal peptidase [Candidatus
           Kuenenia stuttgartiensis]
          Length = 159

 Score = 86.2 bits (213), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 48/96 (50%), Gaps = 1/96 (1%)

Query: 8   TILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHT 67
            I + + +L IA I FI+ K+ K     ++   LI  GA+GN+ D   +  V D+I +H 
Sbjct: 62  NIFILLSLLAIAAILFIYIKSDKNIFSSNVALGLILAGAIGNLWDRIWFKCVRDFIDLHL 121

Query: 68  QT-WSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
              + +  FN+AD  I +G  ++++        +K 
Sbjct: 122 GEKYHWPTFNVADGLICVGISLMVFASFSPSKHKKS 157


>gi|147678154|ref|YP_001212369.1| lipoprotein signal peptidase [Pelotomaculum thermopropionicum SI]
 gi|189028662|sp|A5D178|LSPA_PELTS RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|146274251|dbj|BAF60000.1| lipoprotein signal peptidase [Pelotomaculum thermopropionicum SI]
          Length = 152

 Score = 86.2 bits (213), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 28/95 (29%), Positives = 47/95 (49%), Gaps = 4/95 (4%)

Query: 9   ILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQ 68
           + V++ ++IIA +   + K    K + D G  L+  GALGN+ D   YG V+D++     
Sbjct: 59  LFVTVTVIIIAGVLVGYFKIRPRKPVLDYGLGLVAGGALGNLADRLRYGLVVDFLDFRI- 117

Query: 69  TWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
              + VFNLAD  I  G  ++ +  +    +   K
Sbjct: 118 ---WPVFNLADTAIVTGAFLLAWALLNDSDKSSKK 149


>gi|262202528|ref|YP_003273736.1| lipoprotein signal peptidase [Gordonia bronchialis DSM 43247]
 gi|262085875|gb|ACY21843.1| lipoprotein signal peptidase [Gordonia bronchialis DSM 43247]
          Length = 166

 Score = 86.2 bits (213), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 31/107 (28%), Positives = 50/107 (46%), Gaps = 5/107 (4%)

Query: 1   MLSNVSPTILVSIRILIIAFI-FFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYV 59
           M + + P +L+++  LI A I  + W+  P +     +G   I  GA  NV+D  L G V
Sbjct: 63  MGNQLPPPVLLTVTGLITAGIAVYAWRAAPTSSWSSIVGLGAIFAGAAANVIDRTLDGKV 122

Query: 60  IDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDF 106
            DY+        F  FNLAD F+S G  +++    +     + K+  
Sbjct: 123 TDYLHTGW----FPTFNLADTFLSCGVALLLAAQFVESCSAESKVST 165


>gi|296164415|ref|ZP_06846989.1| signal peptidase II [Mycobacterium parascrofulaceum ATCC BAA-614]
 gi|295900197|gb|EFG79629.1| signal peptidase II [Mycobacterium parascrofulaceum ATCC BAA-614]
          Length = 209

 Score = 85.8 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 22/98 (22%), Positives = 45/98 (45%), Gaps = 12/98 (12%)

Query: 7   PTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCL------YGYVI 60
             +L  I   ++  IF++ ++       + +G  +I  GA+GN+VD          G+V+
Sbjct: 105 TWVLTLIATGVVVGIFWMGRRL--VSPWWAVGLGMILGGAMGNLVDRFFRAPGPLRGHVV 162

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
           D++ +      + VFN+AD  +  G  +++   I    
Sbjct: 163 DFLSVGW----WPVFNVADPSVVGGAILLVVLSIFGYD 196


>gi|52080147|ref|YP_078938.1| lipoprotein signal peptidase [Bacillus licheniformis ATCC 14580]
 gi|161760693|ref|YP_091353.2| lipoprotein signal peptidase [Bacillus licheniformis ATCC 14580]
 gi|52003358|gb|AAU23300.1| signal peptidase II LspA [Bacillus licheniformis ATCC 14580]
          Length = 153

 Score = 85.8 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 22/97 (22%), Positives = 46/97 (47%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
                  I  ++I  I +  +K+ K + +  I   L+  GA+GN +D      V+D+I +
Sbjct: 56  QMWFFYIITTVVIIGIVYYIQKHAKGQILLGIALGLMLGGAVGNFIDRVFRQEVVDFIHV 115

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
               + + +FN+AD  + IG  ++    ++   ++K 
Sbjct: 116 TIVNYHYPIFNIADSSLCIGVLLLFIQMLLDGKKKKE 152


>gi|294084577|ref|YP_003551335.1| lipoprotein signal peptidase [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292664150|gb|ADE39251.1| lipoprotein signal peptidase [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 160

 Score = 85.8 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 25/99 (25%), Positives = 47/99 (47%), Gaps = 2/99 (2%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           ML       L+++ + I  ++  +  +     ++  + Y  I  GALGNV+D   Y  V 
Sbjct: 60  MLGGAPWWSLIALALAICVWLGVMLFR--ADNAVETLAYGAIIGGALGNVIDRVRYRAVT 117

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
           D++  +  T  +  FN+AD+F+  G  +++    I   R
Sbjct: 118 DFLDFYIVTTHWPAFNMADIFVVSGVGLLLAAPWISVRR 156


>gi|229815198|ref|ZP_04445534.1| hypothetical protein COLINT_02244 [Collinsella intestinalis DSM
           13280]
 gi|229809208|gb|EEP44974.1| hypothetical protein COLINT_02244 [Collinsella intestinalis DSM
           13280]
          Length = 247

 Score = 85.8 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 29/100 (29%), Positives = 44/100 (44%), Gaps = 2/100 (2%)

Query: 2   LSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVID 61
           L      I V+   L+I  I     +  +   +  +G  L+  GALGN +D  + GYV+D
Sbjct: 95  LGEGMGLIFVAFAALVIVAILQYLTRTRQVSKLETLGLGLVAGGALGNAIDRLMLGYVVD 154

Query: 62  YIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
           +I        F VFN+AD+ I +G        + L    K
Sbjct: 155 FIATDF--IDFPVFNVADIGICVGVFFAFVGFMFLSPAAK 192


>gi|291543961|emb|CBL17070.1| lipoprotein signal peptidase [Ruminococcus sp. 18P13]
          Length = 163

 Score = 85.8 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 24/104 (23%), Positives = 47/104 (45%), Gaps = 3/104 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGY-VIDYIM 64
              IL+ + ++++    +   K  +          L+  G +GN++D    G  V+DY+ 
Sbjct: 61  QRAILIGLPVILLGICVWAMWKYGRNSPFLKWNLTLVMAGGIGNLIDRIFRGGDVVDYLD 120

Query: 65  IHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDFPQ 108
              + + FAVFN AD  I IG  +I+   +  +  ++   + P 
Sbjct: 121 --IRLFHFAVFNFADCCICIGVFLILLYMLFDKSGKESPKEQPH 162


>gi|15608677|ref|NP_216055.1| lipoprotein signal peptidase [Mycobacterium tuberculosis H37Rv]
 gi|15841006|ref|NP_336043.1| lipoprotein signal peptidase [Mycobacterium tuberculosis CDC1551]
 gi|31792725|ref|NP_855218.1| lipoprotein signal peptidase [Mycobacterium bovis AF2122/97]
 gi|121637460|ref|YP_977683.1| lipoprotein signal peptidase [Mycobacterium bovis BCG str. Pasteur
           1173P2]
 gi|148661335|ref|YP_001282858.1| lipoprotein signal peptidase [Mycobacterium tuberculosis H37Ra]
 gi|167968094|ref|ZP_02550371.1| lipoprotein signal peptidase [Mycobacterium tuberculosis H37Ra]
 gi|215426883|ref|ZP_03424802.1| lipoprotein signal peptidase [Mycobacterium tuberculosis T92]
 gi|215445737|ref|ZP_03432489.1| lipoprotein signal peptidase [Mycobacterium tuberculosis T85]
 gi|224989935|ref|YP_002644622.1| lipoprotein signal peptidase [Mycobacterium bovis BCG str. Tokyo
           172]
 gi|254364411|ref|ZP_04980457.1| lipoprotein signal peptidase lspA [Mycobacterium tuberculosis str.
           Haarlem]
 gi|254550559|ref|ZP_05141006.1| lipoprotein signal peptidase [Mycobacterium tuberculosis '98-R604
           INH-RIF-EM']
 gi|260186490|ref|ZP_05763964.1| lipoprotein signal peptidase [Mycobacterium tuberculosis CPHL_A]
 gi|260200600|ref|ZP_05768091.1| lipoprotein signal peptidase [Mycobacterium tuberculosis T46]
 gi|260204825|ref|ZP_05772316.1| lipoprotein signal peptidase [Mycobacterium tuberculosis K85]
 gi|289442993|ref|ZP_06432737.1| lipoprotein signal peptidase lspA [Mycobacterium tuberculosis T46]
 gi|289447150|ref|ZP_06436894.1| lipoprotein signal peptidase lspA [Mycobacterium tuberculosis
           CPHL_A]
 gi|289569574|ref|ZP_06449801.1| lipoprotein signal peptidase lspA [Mycobacterium tuberculosis T17]
 gi|289574223|ref|ZP_06454450.1| lipoprotein signal peptidase lspA [Mycobacterium tuberculosis K85]
 gi|289750106|ref|ZP_06509484.1| lipoprotein signal peptidase lspA [Mycobacterium tuberculosis T92]
 gi|289753626|ref|ZP_06513004.1| lipoprotein signal peptidase lspA [Mycobacterium tuberculosis
           EAS054]
 gi|289757655|ref|ZP_06517033.1| lipoprotein signal peptidase lspA [Mycobacterium tuberculosis T85]
 gi|289761702|ref|ZP_06521080.1| lipoprotein signal peptidase lspA [Mycobacterium tuberculosis GM
           1503]
 gi|294996506|ref|ZP_06802197.1| lipoprotein signal peptidase [Mycobacterium tuberculosis 210]
 gi|297634108|ref|ZP_06951888.1| lipoprotein signal peptidase [Mycobacterium tuberculosis KZN 4207]
 gi|297731095|ref|ZP_06960213.1| lipoprotein signal peptidase [Mycobacterium tuberculosis KZN R506]
 gi|306803251|ref|ZP_07439919.1| lipoprotein signal peptidase lspA [Mycobacterium tuberculosis
           SUMu008]
 gi|313658427|ref|ZP_07815307.1| lipoprotein signal peptidase [Mycobacterium tuberculosis KZN V2475]
 gi|54037758|sp|P65263|LSPA_MYCBO RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|54041422|sp|P65262|LSPA_MYCTU RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|152032420|sp|A1KIW9|LSPA_MYCBP RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|1403503|emb|CAA98323.1| PROBABLE LIPOPROTEIN SIGNAL PEPTIDASE LSPA [Mycobacterium
           tuberculosis H37Rv]
 gi|13881215|gb|AAK45857.1| signal peptidase II [Mycobacterium tuberculosis CDC1551]
 gi|31618315|emb|CAD96233.1| Probable lipoprotein signal peptidase lspA [Mycobacterium bovis
           AF2122/97]
 gi|121493107|emb|CAL71578.1| Probable lipoprotein signal peptidase lspA [Mycobacterium bovis BCG
           str. Pasteur 1173P2]
 gi|134149925|gb|EBA41970.1| lipoprotein signal peptidase lspA [Mycobacterium tuberculosis str.
           Haarlem]
 gi|148505487|gb|ABQ73296.1| signal peptidase II [Mycobacterium tuberculosis H37Ra]
 gi|224773048|dbj|BAH25854.1| lipoprotein signal peptidase [Mycobacterium bovis BCG str. Tokyo
           172]
 gi|289415912|gb|EFD13152.1| lipoprotein signal peptidase lspA [Mycobacterium tuberculosis T46]
 gi|289420108|gb|EFD17309.1| lipoprotein signal peptidase lspA [Mycobacterium tuberculosis
           CPHL_A]
 gi|289538654|gb|EFD43232.1| lipoprotein signal peptidase lspA [Mycobacterium tuberculosis K85]
 gi|289543328|gb|EFD46976.1| lipoprotein signal peptidase lspA [Mycobacterium tuberculosis T17]
 gi|289690693|gb|EFD58122.1| lipoprotein signal peptidase lspA [Mycobacterium tuberculosis T92]
 gi|289694213|gb|EFD61642.1| lipoprotein signal peptidase lspA [Mycobacterium tuberculosis
           EAS054]
 gi|289709208|gb|EFD73224.1| lipoprotein signal peptidase lspA [Mycobacterium tuberculosis GM
           1503]
 gi|289713219|gb|EFD77231.1| lipoprotein signal peptidase lspA [Mycobacterium tuberculosis T85]
 gi|308350055|gb|EFP38906.1| lipoprotein signal peptidase lspA [Mycobacterium tuberculosis
           SUMu008]
 gi|326903169|gb|EGE50102.1| lipoprotein signal peptidase lspA [Mycobacterium tuberculosis
           W-148]
          Length = 202

 Score = 85.8 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 22/95 (23%), Positives = 45/95 (47%), Gaps = 12/95 (12%)

Query: 7   PTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCL------YGYVI 60
             +L  I   ++  IF++ ++       + +G  +I  GA+GN+VD          G+V+
Sbjct: 90  TWVLTLIATGVVVGIFWMGRRL--VSPWWALGLGMILGGAMGNLVDRFFRAPGPLRGHVV 147

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDII 95
           D++ +      + VFN+AD  +  G  +++   I 
Sbjct: 148 DFLSVGW----WPVFNVADPSVVGGAILLVILSIF 178


>gi|88813004|ref|ZP_01128247.1| Signal peptidase II [Nitrococcus mobilis Nb-231]
 gi|88789782|gb|EAR20906.1| Signal peptidase II [Nitrococcus mobilis Nb-231]
          Length = 157

 Score = 85.8 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 23/80 (28%), Positives = 41/80 (51%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                + +++ I +  F+     +  + +    +   LI  GALGNV+D   YG+V+D+I
Sbjct: 61  GWQRWLFITVAIGVCLFLLRWLAQLQRRERWLAVALGLILGGALGNVIDRLRYGHVVDFI 120

Query: 64  MIHTQTWSFAVFNLADLFIS 83
            +H   W +  FN+AD  I+
Sbjct: 121 DVHYGRWHWPAFNVADSAIT 140


>gi|197106623|ref|YP_002132000.1| lipoprotein signal peptidase [Phenylobacterium zucineum HLK1]
 gi|196480043|gb|ACG79571.1| lipoprotein signal peptidase [Phenylobacterium zucineum HLK1]
          Length = 163

 Score = 85.8 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 24/96 (25%), Positives = 47/96 (48%), Gaps = 2/96 (2%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S++     V   IL+   +    +K    + +   G  L+  GA+GN +D   +G V+D+
Sbjct: 63  SDLVRWGFVVFSILVGVLLALWARKT--DRLLPAAGLGLVIGGAIGNAIDRARFGAVVDF 120

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
           I +    +   +FN+AD  I+IG  +++ D +  + 
Sbjct: 121 IDVQRLGFFPWIFNIADSGITIGVILLLLDSMRPER 156


>gi|85373721|ref|YP_457783.1| putative lipoprotein signal peptidase [Erythrobacter litoralis
           HTCC2594]
 gi|84786804|gb|ABC62986.1| putative lipoprotein signal peptidase [Erythrobacter litoralis
           HTCC2594]
          Length = 163

 Score = 85.8 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 22/87 (25%), Positives = 40/87 (45%), Gaps = 2/87 (2%)

Query: 5   VSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIM 64
           ++P +L    +L++  +     +   T  +       I  GALGNV D    G V D++ 
Sbjct: 62  IAPYLLSGFALLVVGVLARWLWR--STVRLESAAIGSIIGGALGNVADRLADGAVTDFLD 119

Query: 65  IHTQTWSFAVFNLADLFISIGTCIIIY 91
            +   + +  FNLAD+ I +G  + + 
Sbjct: 120 FYVGGYHWPAFNLADVGIVLGVALFLV 146


>gi|52425805|ref|YP_088942.1| lipoprotein signal peptidase [Mannheimia succiniciproducens
           MBEL55E]
 gi|52307857|gb|AAU38357.1| LspA protein [Mannheimia succiniciproducens MBEL55E]
          Length = 165

 Score = 85.4 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 25/101 (24%), Positives = 48/101 (47%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + + + + A +  + +KN   + + +  Y LI  GAL N+ D    G+V+D+ 
Sbjct: 65  GWQKYFFIVLALAVSAVLVHLLRKNSARQKLQNSAYALIIGGALANMADRAYNGFVVDFF 124

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
               + W + VFN+AD+ I +G  ++I D      ++  K 
Sbjct: 125 DFFWREWHYPVFNVADIAICVGVGLLILDSFKNGEKKADKQ 165


>gi|86139676|ref|ZP_01058243.1| lipoprotein signal peptidase [Roseobacter sp. MED193]
 gi|85823567|gb|EAQ43775.1| lipoprotein signal peptidase [Roseobacter sp. MED193]
          Length = 167

 Score = 85.4 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 23/99 (23%), Positives = 47/99 (47%), Gaps = 2/99 (2%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           +L       L+++ + I  ++  +  +     ++  + Y  I  GALGNV+D   Y  V 
Sbjct: 67  LLGGAPWWGLIALALAICGWLGVMLFR--AENAVETLAYGAIIGGALGNVIDRVRYRSVT 124

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
           D++  +  +  +  FN+AD+F+  G  +++    I   R
Sbjct: 125 DFLDFYINSTHWPAFNMADVFVVSGVGLLLAAPWISARR 163


>gi|118595220|ref|ZP_01552567.1| peptidase A8, signal peptidase II [Methylophilales bacterium
           HTCC2181]
 gi|118440998|gb|EAV47625.1| peptidase A8, signal peptidase II [Methylophilales bacterium
           HTCC2181]
          Length = 153

 Score = 85.4 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 31/96 (32%), Positives = 50/96 (52%), Gaps = 2/96 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                 L  + +++   + F  +KN     +   G  LI  GA+GN++D  L+GYVID+I
Sbjct: 58  GWQRYFLALVSLIVSIALPFYIRKNH-HNKLLAFGLTLILGGAIGNLIDRLLHGYVIDFI 116

Query: 64  MIHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQH 98
            +H    + +  FN+AD  I+IG   II+D  I + 
Sbjct: 117 SLHMDNIFYWPAFNVADSSITIGAAFIIFDSFIKKK 152


>gi|319403498|emb|CBI77077.1| Lipoprotein signal peptidase [Bartonella rochalimae ATCC BAA-1498]
          Length = 151

 Score = 85.4 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 36/106 (33%), Positives = 64/106 (60%), Gaps = 1/106 (0%)

Query: 2   LSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVID 61
           LS+     ++++ ++II F+ ++ K   K K +   G  LI  GA+GN++D   + YVID
Sbjct: 42  LSSYPHWGIIALTLIIIVFLLWLLKNTAKDKFLSHFGTTLIIGGAIGNLIDRVRFHYVID 101

Query: 62  YIMIHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDF 106
           Y++ H +  +SFAVFNLAD FI++G   ++ D+  +  ++K   + 
Sbjct: 102 YLLFHIRDVFSFAVFNLADTFITLGAVAVLIDEFCICAKKKRYSNN 147


>gi|258616266|ref|ZP_05714036.1| lipoprotein signal peptidase [Enterococcus faecium DO]
          Length = 137

 Score = 85.4 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 45/97 (46%), Gaps = 3/97 (3%)

Query: 8   TILVSIRILIIAFIFFIWKKNP-KTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIH 66
                + ++ +  I  +  KN  K    F IG  LI  GA+GN +D    GYV+D     
Sbjct: 43  WFFTIVTLIAVVVILTLMIKNREKGNRWFMIGLSLILAGAIGNFIDRIRLGYVVDMFQTD 102

Query: 67  TQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
               SF +FN+AD+ +  G   ++   I+ +  Q+ K
Sbjct: 103 FM--SFPIFNVADVTLVCGVICMLIYIILDEKDQRKK 137


>gi|78357186|ref|YP_388635.1| signal peptidase II [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|123552201|sp|Q30ZF6|LSPA_DESDG RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|78219591|gb|ABB38940.1| signal peptidase II, Aspartic peptidase, MEROPS family A08
           [Desulfovibrio desulfuricans subsp. desulfuricans str.
           G20]
          Length = 156

 Score = 85.4 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 20/93 (21%), Positives = 41/93 (44%), Gaps = 1/93 (1%)

Query: 5   VSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIM 64
               +  +  +  +  I     ++ K+      G+ LI  GA+GN++D   +  VID++ 
Sbjct: 65  WQFWLFFAAAVTAVLAII-AMTRSAKSNPYLFTGFGLIMGGAIGNLIDRIRFRAVIDFLD 123

Query: 65  IHTQTWSFAVFNLADLFISIGTCIIIYDDIILQ 97
            H   + +  FN+AD+ I +G   +       +
Sbjct: 124 FHIGGYHWPAFNVADMGICVGAFFVCLAVYKHK 156


>gi|329851135|ref|ZP_08265892.1| signal peptidase II [Asticcacaulis biprosthecum C19]
 gi|328839981|gb|EGF89553.1| signal peptidase II [Asticcacaulis biprosthecum C19]
          Length = 178

 Score = 85.4 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 23/99 (23%), Positives = 49/99 (49%), Gaps = 3/99 (3%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
            +   +L   ++++   + +I  +    + +  I + LI  GA+GN +D   +GYV+D++
Sbjct: 78  GLMRWVLTVFQLVVAGLLTWIVFRVR--RPLLGIAFALIAGGAIGNAIDRIRFGYVVDFL 135

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
                 + + VFN+AD  I IG  ++ +     + + K 
Sbjct: 136 DFSGLFFPW-VFNVADSAICIGIALLAWYFYQSERQAKA 173


>gi|85375536|ref|YP_459598.1| lipoprotein signal peptidase [Erythrobacter litoralis HTCC2594]
 gi|84788619|gb|ABC64801.1| lipoprotein signal peptidase [Erythrobacter litoralis HTCC2594]
          Length = 184

 Score = 85.4 bits (211), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 32/95 (33%), Positives = 46/95 (48%), Gaps = 3/95 (3%)

Query: 7   PTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIH 66
              LV    LI   +     +      I  IG  LI  GALGN+ D   +GYVIDY  +H
Sbjct: 76  RWALVLGTALIAVVVGIWMLREKTLGDI--IGLGLIFGGALGNIYDRYTWGYVIDYADLH 133

Query: 67  TQTWS-FAVFNLADLFISIGTCIIIYDDIILQHRQ 100
              +  F +FN+AD  I+IG  II+    ++  ++
Sbjct: 134 FGEFRPFLIFNIADAAITIGVLIILARSFLVPEKK 168


>gi|23098940|ref|NP_692406.1| lipoprotein signal peptidase [Oceanobacillus iheyensis HTE831]
 gi|81846083|sp|Q8ER40|LSPA_OCEIH RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|22777168|dbj|BAC13441.1| lipoprotein signal peptidase [Oceanobacillus iheyensis HTE831]
          Length = 157

 Score = 85.4 bits (211), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 25/101 (24%), Positives = 49/101 (48%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
              +   I  ++I  I +    + K   +  +  ++I  GA+GN +D      V+D+   
Sbjct: 57  QMLLFYIITTIVIIGIIYFLHTHAKGDKLLSVALVVILGGAIGNFIDRIFRQEVVDFANF 116

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDF 106
           +   ++F +FN+AD  ++IG  + +   I+ + RQKGK   
Sbjct: 117 YIFDYNFPIFNVADSSLTIGVILFLIATILEEKRQKGKSKS 157


>gi|313901183|ref|ZP_07834671.1| signal peptidase II [Clostridium sp. HGF2]
 gi|312954141|gb|EFR35821.1| signal peptidase II [Clostridium sp. HGF2]
          Length = 158

 Score = 85.4 bits (211), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 21/88 (23%), Positives = 44/88 (50%)

Query: 9   ILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQ 68
               I I+ +  + + ++       +  IG +L+  G LGN +D  ++ YV D++     
Sbjct: 61  FFYLISIVFLIGMLYFYRTTDHRDRLTRIGVVLMMAGTLGNFIDRLIFQYVRDFLDFIIF 120

Query: 69  TWSFAVFNLADLFISIGTCIIIYDDIIL 96
            + F VFN+AD+ + +G  +I+   ++ 
Sbjct: 121 GYDFPVFNVADISLCVGVGLIVLSMVLE 148


>gi|220928061|ref|YP_002504970.1| lipoprotein signal peptidase [Clostridium cellulolyticum H10]
 gi|219998389|gb|ACL74990.1| lipoprotein signal peptidase [Clostridium cellulolyticum H10]
          Length = 163

 Score = 85.4 bits (211), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 23/98 (23%), Positives = 45/98 (45%), Gaps = 3/98 (3%)

Query: 7   PTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCL-YGYVIDYIMI 65
              L+ +  ++   + +   K         +   LI  GALGN+ D     G V+D++  
Sbjct: 56  TVFLILMVSVVSLAMLYYLIKEK--NKFLRLSLSLILGGALGNLYDRIFSNGKVVDFLEF 113

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
           H  ++ F  FN+AD+ + +GT ++    + L   +K +
Sbjct: 114 HFGSYVFPTFNVADILVVVGTILLAIYILFLYKEEKPE 151


>gi|317051697|ref|YP_004112813.1| lipoprotein signal peptidase [Desulfurispirillum indicum S5]
 gi|316946781|gb|ADU66257.1| lipoprotein signal peptidase [Desulfurispirillum indicum S5]
          Length = 166

 Score = 85.4 bits (211), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 21/104 (20%), Positives = 49/104 (47%), Gaps = 2/104 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +++     V +  + +A   ++++    +      G +LI  GA+GN++D    GYVID+
Sbjct: 59  ASLRIGFFVVVGCVALAVCVYLYR--HGSTWFHRQGALLIAAGAIGNMIDRVRLGYVIDF 116

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDF 106
             +   ++ +  FN+AD+ I++G         +    ++ +   
Sbjct: 117 FDVFLGSYHWPAFNVADICITVGAACYAVALTMEFRAEQQRKSS 160


>gi|306520956|ref|ZP_07407303.1| putative pseudouridylate synthase [Clostridium difficile QCD-32g58]
          Length = 453

 Score = 85.1 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 29/99 (29%), Positives = 48/99 (48%), Gaps = 4/99 (4%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           +L N    I + + +L   F  +      K      +G ILI +GALGN++D    G+V+
Sbjct: 52  LLQNNQ-WIFIIVALLATVFGLYYL-NTRKVHIFGRLGIILIISGALGNLIDRVRLGFVV 109

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
           DY           VFN+AD+F+ +GT  +    + L+ +
Sbjct: 110 DYFDFRVIWE--YVFNVADVFVVVGTVFLCIYVLFLKVK 146


>gi|209543576|ref|YP_002275805.1| lipoprotein signal peptidase [Gluconacetobacter diazotrophicus PAl
           5]
 gi|209531253|gb|ACI51190.1| lipoprotein signal peptidase [Gluconacetobacter diazotrophicus PAl
           5]
          Length = 174

 Score = 85.1 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 25/73 (34%), Positives = 38/73 (52%)

Query: 28  NPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQTWSFAVFNLADLFISIGTC 87
              T+         I  GA+GNV+D   YG V+D+I  H   WS+ VFNLAD  I  G  
Sbjct: 98  TRTTRPWVAGALGAIMGGAVGNVIDRMHYGAVVDFIHAHAYGWSWPVFNLADAAIDCGVA 157

Query: 88  IIIYDDIILQHRQ 100
           ++++D +  +  +
Sbjct: 158 VLLFDSLTDRRSR 170


>gi|310816799|ref|YP_003964763.1| lipoprotein signal peptidase [Ketogulonicigenium vulgare Y25]
 gi|308755534|gb|ADO43463.1| lipoprotein signal peptidase [Ketogulonicigenium vulgare Y25]
          Length = 185

 Score = 85.1 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 22/87 (25%), Positives = 44/87 (50%), Gaps = 2/87 (2%)

Query: 8   TILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHT 67
            +L+++ I+I   + +  ++    K +  +   ++  GA+GNVVD  +YG V D++ +  
Sbjct: 63  WLLIAVAIVISGVVLWWMRRG-DEKPLARVSAGILVGGAIGNVVDRLIYGAVADFLNMSF 121

Query: 68  QTWSFA-VFNLADLFISIGTCIIIYDD 93
             +     FN+AD+ I  G   +I   
Sbjct: 122 PGFDNPYAFNVADIAIFAGAAGLILFS 148


>gi|291279576|ref|YP_003496411.1| lipoprotein signal peptidase II [Deferribacter desulfuricans SSM1]
 gi|290754278|dbj|BAI80655.1| lipoprotein signal peptidase II [Deferribacter desulfuricans SSM1]
          Length = 164

 Score = 85.1 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 45/95 (47%)

Query: 9   ILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQ 68
           I   +  +I  FI            +  I Y LI  GA GN +D  + G V+D++  +  
Sbjct: 66  IFFVLITIIAIFIVIYLFVKENRSLLRKISYSLILGGAFGNFIDRLIIGKVVDFLDFYVG 125

Query: 69  TWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
           ++ +  FN+AD  IS+G   ++ D I  + R++  
Sbjct: 126 SYHWPAFNIADSAISVGIFFLLLDIIFDKRREESN 160


>gi|257068272|ref|YP_003154527.1| lipoprotein signal peptidase [Brachybacterium faecium DSM 4810]
 gi|256559090|gb|ACU84937.1| lipoprotein signal peptidase [Brachybacterium faecium DSM 4810]
          Length = 204

 Score = 85.1 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 23/101 (22%), Positives = 47/101 (46%), Gaps = 12/101 (11%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHC------ 54
           M S ++P +   +++ I+  +     K  ++     +   LI  GALGN+ D        
Sbjct: 54  MGSEITPAV-TGLQLAIVVGVIVFAVKAVRSPWY-AMALGLIMGGALGNIHDRLLRAPSA 111

Query: 55  LYGYVIDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDII 95
            +G V+D++ +      + VFN+AD+ +  G  +I+   + 
Sbjct: 112 FHGAVVDFLELP----HWPVFNVADMGVVGGAILIVALGLF 148


>gi|88608487|ref|YP_506779.1| signal peptidase II [Neorickettsia sennetsu str. Miyayama]
 gi|88600656|gb|ABD46124.1| signal peptidase II [Neorickettsia sennetsu str. Miyayama]
          Length = 184

 Score = 85.1 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 21/93 (22%), Positives = 43/93 (46%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           + +    + L  + I + A +  ++    + + +  + +  I  GA+ NV D   +G V 
Sbjct: 83  LFAGYQFSNLFFLLINVPAVLVVLFLSFREKRLVACVAWSFILGGAVANVTDRVRFGAVR 142

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDD 93
           D+I  H     + VFN+AD  I +G   +++  
Sbjct: 143 DFIDFHFLDLHWPVFNVADAAIFLGVVFVLFHS 175


>gi|295695961|ref|YP_003589199.1| lipoprotein signal peptidase [Bacillus tusciae DSM 2912]
 gi|295411563|gb|ADG06055.1| lipoprotein signal peptidase [Bacillus tusciae DSM 2912]
          Length = 181

 Score = 85.1 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 27/106 (25%), Positives = 51/106 (48%), Gaps = 5/106 (4%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           ML N    + V++ +++IA I  +  K    +    I   L+  GA+GN+ D  + G VI
Sbjct: 81  MLQN-QRWLFVAVTLVVIAGI--LSAKRRTRRRSTRIALALLLGGAVGNLWDRLVIGRVI 137

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDF 106
           D++ +      F +FN+AD  I+I    ++ D ++       + + 
Sbjct: 138 DFLDVRI--IHFPIFNVADSCITIAVAWMVVDALLAGRTVHKEKES 181


>gi|238018930|ref|ZP_04599356.1| hypothetical protein VEIDISOL_00790 [Veillonella dispar ATCC 17748]
 gi|237864414|gb|EEP65704.1| hypothetical protein VEIDISOL_00790 [Veillonella dispar ATCC 17748]
          Length = 126

 Score = 85.1 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 25/101 (24%), Positives = 50/101 (49%), Gaps = 5/101 (4%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           ML+N      + + ++++    + WK+  K      IG  L+ +GA+GN +D  +   V+
Sbjct: 31  MLAN-QRWFFLLVAVILLGACAYYWKRLSKGPWTLQIGSALLVSGAIGNGIDRYMIHGVV 89

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
           D+         + +FN+AD+ I +G  +++Y    L+   K
Sbjct: 90  DFFDFRI----WPIFNVADIGICVGVALVVYYLFTLKDDDK 126


>gi|254503484|ref|ZP_05115635.1| signal peptidase II [Labrenzia alexandrii DFL-11]
 gi|222439555|gb|EEE46234.1| signal peptidase II [Labrenzia alexandrii DFL-11]
          Length = 178

 Score = 85.1 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 28/92 (30%), Positives = 45/92 (48%), Gaps = 2/92 (2%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S++   +L    I     +            +  +   LI  GA+GN VD  +YG V+D+
Sbjct: 80  SDLGRWLLAGFTIAATIAL--WIWSTRVDLKLPALALALIIGGAVGNGVDRVVYGAVVDF 137

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDI 94
           +  H  T+S+ VFNLAD++I  G   ++YD  
Sbjct: 138 VHFHAGTFSWYVFNLADVWIVAGVVGLLYDSF 169


>gi|71064939|ref|YP_263666.1| lipoprotein signal peptidase [Psychrobacter arcticus 273-4]
 gi|71037924|gb|AAZ18232.1| signal peptidase II. Aspartic peptidase. MEROPS family A08
           [Psychrobacter arcticus 273-4]
          Length = 171

 Score = 85.1 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 29/100 (29%), Positives = 55/100 (55%), Gaps = 1/100 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                    + +L+  F+     K P+   +  +G  L+  GA+GN++D  L+G+VID+I
Sbjct: 72  GWQKWFFAGLALLMSLFLIGYLVKAPRQAKLLSLGLALVLGGAVGNLIDRLLHGHVIDFI 131

Query: 64  MIHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
            +H    W + +FN+AD+ I IG  +I+ D + L+ +++ 
Sbjct: 132 HVHYADVWHYPIFNIADIGICIGVALIVIDMLFLEKKREA 171


>gi|40062785|gb|AAR37679.1| lipoprotein signal peptidase [uncultured marine bacterium 439]
          Length = 154

 Score = 85.1 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 28/84 (33%), Positives = 48/84 (57%)

Query: 9   ILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQ 68
            L+++ + +   +     K P        G  ++ +GALGN++D   YGYVID+I +H Q
Sbjct: 65  FLLAVSLFVSLMVMVWIHKTPAIYRQRLFGQFILLSGALGNLLDRAQYGYVIDFIDVHYQ 124

Query: 69  TWSFAVFNLADLFISIGTCIIIYD 92
            + + VFN+AD  I IG  ++I++
Sbjct: 125 NYYWPVFNVADSLIFIGVILLIFE 148


>gi|239947260|ref|ZP_04699013.1| signal peptidase II [Rickettsia endosymbiont of Ixodes scapularis]
 gi|239921536|gb|EER21560.1| signal peptidase II [Rickettsia endosymbiont of Ixodes scapularis]
          Length = 173

 Score = 85.1 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 35/108 (32%), Positives = 58/108 (53%), Gaps = 6/108 (5%)

Query: 5   VSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIM 64
            S  I +    +I+ +++++  ++    S    GY  +  G++GN++D    G V D+I 
Sbjct: 50  YSNAIFLITNTIIVCYLYYLMIRSKTIGSFA--GYSFVIGGSVGNLIDRFFRGAVFDFIH 107

Query: 65  IHTQTWSFAVFNLADLFISIGTCIIIYDDI----ILQHRQKGKIDFPQ 108
            H Q +SF VFNLAD FI+IG  I+I D      +++ + KG  D  Q
Sbjct: 108 FHYQNYSFPVFNLADCFITIGVIILIEDYYNTKKVIEEKAKGNYDNAQ 155


>gi|114798762|ref|YP_759577.1| signal peptidase II [Hyphomonas neptunium ATCC 15444]
 gi|114738936|gb|ABI77061.1| signal peptidase II [Hyphomonas neptunium ATCC 15444]
          Length = 178

 Score = 85.1 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 23/102 (22%), Positives = 46/102 (45%), Gaps = 4/102 (3%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
            +   +L  +   I    F    +         +   L+  GA+GN++D   +G V+D++
Sbjct: 74  GLMRWVLAGVMAAIAIGFFLWLLR--AEGRFLRLSLALVVGGAIGNLIDRVRFGAVVDFV 131

Query: 64  MIH--TQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
            ++  T  +   VFN+AD  I+IG  ++  D  +L   ++  
Sbjct: 132 DVNELTFGYFPWVFNVADAAITIGALLLFVDQFLLSRPKQAN 173


>gi|168186170|ref|ZP_02620805.1| signal peptidase II [Clostridium botulinum C str. Eklund]
 gi|169295809|gb|EDS77942.1| signal peptidase II [Clostridium botulinum C str. Eklund]
          Length = 149

 Score = 85.1 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 27/94 (28%), Positives = 52/94 (55%), Gaps = 1/94 (1%)

Query: 7   PTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIH 66
             +LVS+ ++++  + + + K   T     +G  LI +GALGN+ D   Y YV+D+I+IH
Sbjct: 56  TALLVSVTLVVMIGVIYYFIKYKPTSKFIRLGIALIVSGALGNLYDRIFYKYVVDFILIH 115

Query: 67  TQT-WSFAVFNLADLFISIGTCIIIYDDIILQHR 99
            +  + +  FN+AD+ + +GT ++    +     
Sbjct: 116 YKNVYYYPTFNIADILVVVGTIMLAIFLLREGKE 149


>gi|88607803|ref|YP_505700.1| signal peptidase II [Anaplasma phagocytophilum HZ]
 gi|123494396|sp|Q2GIV1|LSPA_ANAPZ RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|88598866|gb|ABD44336.1| signal peptidase II [Anaplasma phagocytophilum HZ]
          Length = 156

 Score = 84.7 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 27/99 (27%), Positives = 48/99 (48%), Gaps = 4/99 (4%)

Query: 1   MLSNV--SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGY 58
           + S +    T+ + +  +IIA + +   K             +I  GALGN++D   +G 
Sbjct: 55  LFSTLENGNTVFMVLSAVIIAILSYTKIKTKSMSR--SCCLSVIVGGALGNLMDRLRFGA 112

Query: 59  VIDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQ 97
           V D+I +H   W +  FNLADL I+ G  + +  ++  +
Sbjct: 113 VYDFIDLHIGDWHWPAFNLADLTITCGVIVFLAMELRKR 151


>gi|162146415|ref|YP_001600874.1| lipoprotein signal peptidase [Gluconacetobacter diazotrophicus PAl
           5]
 gi|161784990|emb|CAP54533.1| putative lipoprotein signal peptidase [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 174

 Score = 84.7 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 25/73 (34%), Positives = 38/73 (52%)

Query: 28  NPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQTWSFAVFNLADLFISIGTC 87
              T+         I  GA+GNV+D   YG V+D+I  H   WS+ VFNLAD  I  G  
Sbjct: 98  TRTTRPWVAGALGAIMGGAVGNVIDRMHYGAVVDFIHAHAYGWSWPVFNLADAAIDCGVA 157

Query: 88  IIIYDDIILQHRQ 100
           ++++D +  +  +
Sbjct: 158 VLLFDSLTDRRSR 170


>gi|320528440|ref|ZP_08029602.1| signal peptidase II [Solobacterium moorei F0204]
 gi|320131354|gb|EFW23922.1| signal peptidase II [Solobacterium moorei F0204]
          Length = 155

 Score = 84.7 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 23/105 (21%), Positives = 46/105 (43%), Gaps = 2/105 (1%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           +LS     +  ++   +   +   +    K   +  I   L+  GA GN++D     YV 
Sbjct: 51  LLSGQQGVL--ALVAAVAIGLMGWYLFVKKPDILTGISLALMIGGAAGNLIDRLFLNYVR 108

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
           D++  +   + F VFN+AD+ + IG  +++      +   K  +D
Sbjct: 109 DFLNFYIFGYDFPVFNVADMALCIGVFLLLIATWKEEKNGKTNLD 153


>gi|329944573|ref|ZP_08292713.1| signal peptidase II [Actinomyces sp. oral taxon 170 str. F0386]
 gi|328530126|gb|EGF57009.1| signal peptidase II [Actinomyces sp. oral taxon 170 str. F0386]
          Length = 248

 Score = 84.7 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 22/99 (22%), Positives = 39/99 (39%), Gaps = 12/99 (12%)

Query: 2   LSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYG---- 57
            +     I   I  L++  I  + +          +   L+  GA+GN++D  L      
Sbjct: 97  FATGQTWIFALIAFLVVIIIIRVSRNLVSRSW--AVALGLVLGGAVGNLIDRLLREPGFL 154

Query: 58  --YVIDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDI 94
             +VID+I      +   V N+AD+ I +    II   +
Sbjct: 155 RGHVIDFID--YGGY--FVGNVADIAIVLAAAGIIILSL 189


>gi|296876326|ref|ZP_06900378.1| signal peptidase II [Streptococcus parasanguinis ATCC 15912]
 gi|312866741|ref|ZP_07726955.1| signal peptidase II [Streptococcus parasanguinis F0405]
 gi|322389732|ref|ZP_08063279.1| signal peptidase II [Streptococcus parasanguinis ATCC 903]
 gi|296432616|gb|EFH18411.1| signal peptidase II [Streptococcus parasanguinis ATCC 15912]
 gi|311097822|gb|EFQ56052.1| signal peptidase II [Streptococcus parasanguinis F0405]
 gi|321143571|gb|EFX39002.1| signal peptidase II [Streptococcus parasanguinis ATCC 903]
          Length = 153

 Score = 84.7 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 21/92 (22%), Positives = 43/92 (46%), Gaps = 2/92 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
                  I ++++   F+   K+ K       G  L+  G LGN +D    G+V+D   +
Sbjct: 60  QQWFFTLITLVVMVGAFYYLYKHLKGSLWMVTGLTLVIAGGLGNFIDRLRQGFVVDMFHL 119

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQ 97
                 FA+FN+AD ++++G  +++   +  +
Sbjct: 120 DFMN--FAIFNVADSYLTVGVFLLLILMLKEE 149


>gi|227824344|ref|ZP_03989176.1| signal peptidase II [Acidaminococcus sp. D21]
 gi|226904843|gb|EEH90761.1| signal peptidase II [Acidaminococcus sp. D21]
          Length = 151

 Score = 84.7 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 22/95 (23%), Positives = 52/95 (54%), Gaps = 4/95 (4%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
                + + + +IA + + W++  +   +  +G      GA+GN++D    G+VID+   
Sbjct: 56  QRLFFILMTVAVIAVLIYFWRRIKEEAIVVQLGAAFFLGGAVGNLIDRIETGFVIDFFDF 115

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
           +     + +FN+AD+FI +G  +I+++ ++ + R+
Sbjct: 116 YF----WPIFNVADIFICVGVGLIVWNIVMDECRK 146


>gi|15604273|ref|NP_220789.1| lipoprotein signal peptidase [Rickettsia prowazekii str. Madrid E]
 gi|6647604|sp|Q9ZDC4|LSPA_RICPR RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|3860965|emb|CAA14865.1| LIPOPROTEIN SIGNAL PEPTIDASE (lspA) [Rickettsia prowazekii]
 gi|292572020|gb|ADE29935.1| Lipoprotein signal peptidase [Rickettsia prowazekii Rp22]
          Length = 194

 Score = 84.7 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 30/94 (31%), Positives = 52/94 (55%), Gaps = 2/94 (2%)

Query: 5   VSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIM 64
            S TI +   ++I+ +++++   +    S    GY  +  GA+GN++D    G V D+I 
Sbjct: 72  YSNTIFLITNMIIVCYLYYLMICSKTIGSFA--GYSFVIGGAIGNLIDRFCRGAVFDFIH 129

Query: 65  IHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
            H + +SF VFNLAD FI++G  I++ D    + 
Sbjct: 130 FHYRNYSFPVFNLADCFITLGVIILMEDYFSTKK 163


>gi|182414506|ref|YP_001819572.1| lipoprotein signal peptidase [Opitutus terrae PB90-1]
 gi|177841720|gb|ACB75972.1| lipoprotein signal peptidase [Opitutus terrae PB90-1]
          Length = 187

 Score = 84.7 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 23/80 (28%), Positives = 40/80 (50%)

Query: 22  FFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQTWSFAVFNLADLF 81
           F   +       +  I + L+T G  GN+VD  ++G+V+D+I +H  T+ +  FN+AD  
Sbjct: 108 FLWRRALGLRDRMAQISFGLLTGGIAGNLVDRLVHGHVVDFIDLHFGTYVYPTFNVADSG 167

Query: 82  ISIGTCIIIYDDIILQHRQK 101
           I  G  + ++       R K
Sbjct: 168 ICAGVILYLWHSFREPGRAK 187


>gi|85711403|ref|ZP_01042462.1| Lipoprotein signal peptidase [Idiomarina baltica OS145]
 gi|85694904|gb|EAQ32843.1| Lipoprotein signal peptidase [Idiomarina baltica OS145]
          Length = 167

 Score = 84.7 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 25/91 (27%), Positives = 46/91 (50%), Gaps = 2/91 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + + +L+   +  +     K      I Y LI  GA+GN++D    GYV+D +
Sbjct: 67  GWQRYFFIGVALLMSVALTRLIFN--KVSKRDGISYGLILGGAVGNLIDRLFRGYVVDSL 124

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDI 94
            +  QTW   VFN+AD+ I++G  +++  ++
Sbjct: 125 HLGWQTWQLPVFNIADIAITLGVILLLLSNL 155


>gi|138894672|ref|YP_001125125.1| lipoprotein signal peptidase [Geobacillus thermodenitrificans
           NG80-2]
 gi|196247712|ref|ZP_03146414.1| lipoprotein signal peptidase [Geobacillus sp. G11MC16]
 gi|166232866|sp|A4IM26|LSPA_GEOTN RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|134266185|gb|ABO66380.1| Lipoprotein signal peptidase [Geobacillus thermodenitrificans
           NG80-2]
 gi|196212496|gb|EDY07253.1| lipoprotein signal peptidase [Geobacillus sp. G11MC16]
          Length = 160

 Score = 84.7 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 26/103 (25%), Positives = 51/103 (49%), Gaps = 1/103 (0%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           ML      +   + ++++A I    ++   ++ +  IG  L+  GA+GN +D      V+
Sbjct: 58  MLQG-QFWLFYLVTVIVVAGIIIYIRRLRPSERLAGIGLGLMLGGAIGNFIDRVFRKEVV 116

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
           D+I  +  T+SF VFN+AD  +++G  ++          +KG 
Sbjct: 117 DFIHTYIGTYSFPVFNIADSALTVGVILLFIHMFFFATPEKGN 159


>gi|34499023|ref|NP_903238.1| lipoprotein signal peptidase [Chromobacterium violaceum ATCC 12472]
 gi|34104873|gb|AAQ61230.1| lipoprotein signal peptidase [Chromobacterium violaceum ATCC 12472]
          Length = 166

 Score = 84.7 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 48/97 (49%), Gaps = 2/97 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +   +   +  ++ +   K   +  + ++    I  GALGNV+D   YG+VID+I
Sbjct: 71  GWQKYLFTILAFAVSGWLGWNIVKRRFSG-LMNLAAAFIMGGALGNVIDRLAYGHVIDFI 129

Query: 64  MIHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQHR 99
           M+H    W +  FNLAD FI +G  +++ D +    R
Sbjct: 130 MVHYYNEWYYPAFNLADSFICVGAALMVADSMKKPSR 166


>gi|146318439|ref|YP_001198151.1| prolipoprotein signal peptidase; Lsp [Streptococcus suis 05ZYH33]
 gi|145689245|gb|ABP89751.1| prolipoprotein signal peptidase; Lsp [Streptococcus suis 05ZYH33]
 gi|292558225|gb|ADE31226.1| prolipoprotein signal peptidase [Streptococcus suis GZ1]
          Length = 168

 Score = 84.7 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 24/94 (25%), Positives = 41/94 (43%), Gaps = 2/94 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
                  + I+ +  + + + K  K          L+  GALGN +D    GYV+D    
Sbjct: 73  QQWFFTIMTIVAVTGLVWYYIKQIKGNIWTLFSLSLMIAGALGNFIDRLRLGYVVDM--F 130

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
           H    SF VFN+AD+ +++G  I+    +  +  
Sbjct: 131 HLDFISFPVFNVADVCLTVGVGILFICIMKEESN 164


>gi|317472794|ref|ZP_07932105.1| signal peptidase II [Anaerostipes sp. 3_2_56FAA]
 gi|316899713|gb|EFV21716.1| signal peptidase II [Anaerostipes sp. 3_2_56FAA]
          Length = 191

 Score = 84.7 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 23/96 (23%), Positives = 51/96 (53%), Gaps = 4/96 (4%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSI--FDIGYILITTGALGNVVDHCLYGYVIDYI 63
              +   I +L +A + F++ K P  K        Y+ +  GA+GN++D    GYV+D+ 
Sbjct: 59  QQWLFFVITVLAVALLTFVYSKLPDEKKYRPLRFCYVFLCAGAVGNLIDRIFRGYVVDF- 117

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
             + +  +F VFN+AD+++++   ++ +  + +  +
Sbjct: 118 -FYFKPINFPVFNVADIYVTVSMAVLFFSFLFIIKK 152


>gi|157803839|ref|YP_001492388.1| lipoprotein signal peptidase [Rickettsia canadensis str. McKiel]
 gi|166232874|sp|A8EZ20|LSPA_RICCK RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|157785102|gb|ABV73603.1| signal peptidase II [Rickettsia canadensis str. McKiel]
          Length = 196

 Score = 84.7 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 32/108 (29%), Positives = 56/108 (51%), Gaps = 6/108 (5%)

Query: 5   VSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIM 64
            S  + +    +I+ +++++   +   +     GY  +  GA+GN++D    G V D+I 
Sbjct: 72  YSNAVFILTNSIIVCYLYYLMVCSKTIRGFA--GYSFVIGGAVGNLIDRLFRGAVFDFIH 129

Query: 65  IHTQTWSFAVFNLADLFISIGTCIIIYDDI----ILQHRQKGKIDFPQ 108
            + + +SF VFNLAD FI+IG  I+I D      I++ + K   D  Q
Sbjct: 130 FYYKNYSFPVFNLADCFITIGVIILIEDYYSTKKIIEEKAKEHYDNAQ 177


>gi|163744100|ref|ZP_02151466.1| lipoprotein signal peptidase [Phaeobacter gallaeciensis 2.10]
 gi|161382647|gb|EDQ07050.1| lipoprotein signal peptidase [Phaeobacter gallaeciensis 2.10]
          Length = 160

 Score = 84.7 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 28/90 (31%), Positives = 47/90 (52%), Gaps = 1/90 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
           + +  IL+ + ++I   +     + P    +  +   L+  GALGNVVD  LYGYV+D++
Sbjct: 63  DTTRWILIGLSLVICVVLVIWIARLPANARMMQLSAGLVIGGALGNVVDRLLYGYVLDFL 122

Query: 64  MIHTQTWSFA-VFNLADLFISIGTCIIIYD 92
            +     +   VFN+AD+FI  G   +I  
Sbjct: 123 NMSCCGINNPFVFNVADIFIFAGAAGLILF 152


>gi|224476299|ref|YP_002633905.1| lipoprotein signal peptidase [Staphylococcus carnosus subsp.
           carnosus TM300]
 gi|2497630|sp|Q59835|LSPA_STACT RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|459545|emb|CAA54991.1| signalpeptidase II [Staphylococcus carnosus]
 gi|222420906|emb|CAL27720.1| lipoprotein signal peptidase (signal peptidase II) [Staphylococcus
           carnosus subsp. carnosus TM300]
          Length = 159

 Score = 84.7 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 24/93 (25%), Positives = 47/93 (50%)

Query: 9   ILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQ 68
               + I+++  + F + K  K   +  +   L+  GALGN +D  L+G V+D+I     
Sbjct: 66  FFFIVTIVVLGLLVFFYIKEAKGNFLMQVAISLLFAGALGNFIDRMLHGEVVDFIDTKIF 125

Query: 69  TWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
           ++ F +FN AD  ++IG  +++   +    + K
Sbjct: 126 SYDFPIFNGADSSLTIGVILVLIALLFDSRKSK 158


>gi|293553486|ref|ZP_06674114.1| signal peptidase II [Enterococcus faecium E1039]
 gi|291602363|gb|EFF32587.1| signal peptidase II [Enterococcus faecium E1039]
          Length = 137

 Score = 84.3 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 45/97 (46%), Gaps = 3/97 (3%)

Query: 8   TILVSIRILIIAFIFFIWKKNP-KTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIH 66
                + ++ +  I  +  KN  K    F IG  LI  GA+GN +D    GYV+D     
Sbjct: 43  WFFTIVTLIAVVVILTLMIKNREKGNRWFMIGLSLILAGAIGNFIDRIRLGYVVDMFQTD 102

Query: 67  TQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
               SF +FN+AD+ +  G   I+   I+ +  Q+ K
Sbjct: 103 FM--SFPIFNVADVTLVCGVICILIYIILDEKDQRKK 137


>gi|323135628|ref|ZP_08070711.1| lipoprotein signal peptidase [Methylocystis sp. ATCC 49242]
 gi|322398719|gb|EFY01238.1| lipoprotein signal peptidase [Methylocystis sp. ATCC 49242]
          Length = 170

 Score = 84.3 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 24/98 (24%), Positives = 46/98 (46%), Gaps = 6/98 (6%)

Query: 10  LVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIH--- 66
           L++ + +I+A + F   +      +  +   L+  GALGN  D    G V D+  +H   
Sbjct: 73  LLAAQGVIVAGLAFWLTRAR--DRLTALALGLVIGGALGNATDRITRGAVADFFYLHTTL 130

Query: 67  -TQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
                +  VFN+AD+FI+ G  +++Y+ +        +
Sbjct: 131 PVGPLANYVFNVADVFITAGVALLLYESLFAPPESPAE 168


>gi|226226808|ref|YP_002760914.1| lipoprotein signal peptidase [Gemmatimonas aurantiaca T-27]
 gi|226089999|dbj|BAH38444.1| lipoprotein signal peptidase [Gemmatimonas aurantiaca T-27]
          Length = 162

 Score = 84.3 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 25/102 (24%), Positives = 46/102 (45%), Gaps = 1/102 (0%)

Query: 2   LSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCL-YGYVI 60
           L   S  I  ++ ++I++ +     +  +   +  IG  ++  GA+GN+VD       V+
Sbjct: 55  LGPGSRWIFATLAVVIVSVLLKATAELTRLSKLAAIGVPIVVGGAIGNLVDRIRMREGVV 114

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           D+I I      F  FN+AD  ++IG   +I         Q+ 
Sbjct: 115 DFIDIGIGNTRFWTFNVADSAVTIGAVCLILALWEQDKLQQA 156


>gi|163790407|ref|ZP_02184838.1| signal peptidase II [Carnobacterium sp. AT7]
 gi|159874311|gb|EDP68384.1| signal peptidase II [Carnobacterium sp. AT7]
          Length = 153

 Score = 84.3 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 28/98 (28%), Positives = 49/98 (50%), Gaps = 2/98 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
                  I I+++  + +  +K  K   +F I   LI  G++GN +D   + YVID + +
Sbjct: 57  QMWFFYLITIIVVGAVIYYLQKFGKNSRLFSIALALILAGSIGNFIDRIRFEYVIDMVRL 116

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
                 F +FN+AD+ +SIG  ++I    I +  +K K
Sbjct: 117 EFIN--FPIFNVADMSLSIGVFLMIIFVFIDERNEKKK 152


>gi|99035944|ref|ZP_01314990.1| hypothetical protein Wendoof_01000175 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
 gi|225629855|ref|ZP_03787765.1| lipoprotein signal peptidase [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
 gi|225630377|ref|YP_002727168.1| lipoprotein signal peptidase [Wolbachia sp. wRi]
 gi|225591291|gb|EEH12421.1| lipoprotein signal peptidase [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
 gi|225592358|gb|ACN95377.1| lipoprotein signal peptidase [Wolbachia sp. wRi]
          Length = 158

 Score = 84.3 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 30/92 (32%), Positives = 45/92 (48%), Gaps = 2/92 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
                 +  ILII  + ++  K+    +   +G+ L+  GA+GNVVD   +G V D+I  
Sbjct: 60  GGFFFSAFSILIIGILAYLIYKSDDQSTY--LGFSLMIGGAIGNVVDRIYWGAVYDFIYF 117

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQ 97
           H   W +  FNLADL I  G   ++Y   I  
Sbjct: 118 HIDDWYWPAFNLADLSIVCGMFTLLYKWYIYD 149


>gi|222524260|ref|YP_002568731.1| lipoprotein signal peptidase [Chloroflexus sp. Y-400-fl]
 gi|222448139|gb|ACM52405.1| lipoprotein signal peptidase [Chloroflexus sp. Y-400-fl]
          Length = 169

 Score = 84.3 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 27/91 (29%), Positives = 46/91 (50%), Gaps = 4/91 (4%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           +    S  + +   ++I   I+    + P  + +  I   LI  GALGNV+D    GYV+
Sbjct: 64  LFQGKSDILTIVALVIITGAIYLYITQLPNRRRLIQIAMGLILGGALGNVIDRIRLGYVV 123

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIY 91
           D+I +      F +FNLAD  I++G  +++ 
Sbjct: 124 DFIQVGW----FPIFNLADSAITVGAALLML 150


>gi|288575343|ref|ZP_06393647.1| signal peptidase II [Neisseria mucosa ATCC 25996]
 gi|288567871|gb|EFC89431.1| signal peptidase II [Neisseria mucosa ATCC 25996]
          Length = 71

 Score = 84.3 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 40/61 (65%)

Query: 41  LITTGALGNVVDHCLYGYVIDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
           +I  GALGNV+D  ++G+V+D+++ + + W +  FN+AD FI +G  +++ D +  +   
Sbjct: 1   MIIGGALGNVIDRLIHGHVVDFLLFYWKDWYYPAFNVADSFICVGAVLLVLDGLFHKKDP 60

Query: 101 K 101
           K
Sbjct: 61  K 61


>gi|225851055|ref|YP_002731289.1| lipoprotein signal peptidase [Persephonella marina EX-H1]
 gi|225646239|gb|ACO04425.1| signal peptidase II [Persephonella marina EX-H1]
          Length = 165

 Score = 84.3 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 26/94 (27%), Positives = 50/94 (53%)

Query: 9   ILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQ 68
           ++++  +  I  + + + K  +  +       LI  GA+GN+ D    G V D+I I+ +
Sbjct: 68  LIIASTVAAILTMIYAYIKRSQLSNWEFYSLSLIAGGAIGNLYDRIFIGSVRDFIDIYIK 127

Query: 69  TWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
            + +  FN+AD  IS+G    I+ +I L++R+K 
Sbjct: 128 DYHWPAFNIADASISLGIAGFIFYEIFLKNRKKE 161


>gi|148654436|ref|YP_001274641.1| lipoprotein signal peptidase [Roseiflexus sp. RS-1]
 gi|148566546|gb|ABQ88691.1| lipoprotein signal peptidase [Roseiflexus sp. RS-1]
          Length = 197

 Score = 84.3 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 26/105 (24%), Positives = 48/105 (45%), Gaps = 4/105 (3%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKK-NPKTKSIFDIGYILITTGALGNVVDHCLYGYV 59
           M     P       I+I     + ++   P    +  +   LI  GA+GN++D   +GYV
Sbjct: 70  MFDVGFPHFFTVTSIIISLGAMYFYRYHLPGPHLLPQVCLGLIVGGAIGNIIDRLRFGYV 129

Query: 60  IDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
           ID+I +H       +FN+AD  I++G  I+     ++   ++ + 
Sbjct: 130 IDFIHVHWFPG---IFNVADSSITVGVAILALFLALIGDGEQRRA 171


>gi|28211277|ref|NP_782221.1| lipoprotein signal peptidase [Clostridium tetani E88]
 gi|81841190|sp|Q894D4|LSPA_CLOTE RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|28203717|gb|AAO36158.1| lipoprotein signal peptidase [Clostridium tetani E88]
          Length = 156

 Score = 84.3 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 53/97 (54%), Gaps = 1/97 (1%)

Query: 9   ILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQ 68
            L+SI ++ I  + F    N     I  I   LI +GA+GN++D   Y YV+D+I  H +
Sbjct: 58  FLISITMVAILLMMFYLFINKTNPKILKISLSLIISGAIGNLIDRIKYRYVVDFIFFHYK 117

Query: 69  T-WSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
             + F +FN+AD+ +S+GT ++I   I     +  KI
Sbjct: 118 DKYHFPIFNIADVLVSLGTILLIIFIIKEDGYEDRKI 154


>gi|188996143|ref|YP_001930394.1| lipoprotein signal peptidase [Sulfurihydrogenibium sp. YO3AOP1]
 gi|226694757|sp|B2V758|LSPA_SULSY RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|188931210|gb|ACD65840.1| lipoprotein signal peptidase [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 163

 Score = 84.3 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 22/87 (25%), Positives = 44/87 (50%)

Query: 14  RILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQTWSFA 73
            I  +    +++K N K  ++  +   LI  G++GN+ D  + G V D++  +     + 
Sbjct: 74  IIAAVITAGYVFKSNAKLSNLEVLSLALICGGSVGNLYDRFMLGQVRDFLDFYINDHHWP 133

Query: 74  VFNLADLFISIGTCIIIYDDIILQHRQ 100
            FN+AD  I+IG  + I  ++  + R+
Sbjct: 134 AFNVADASITIGIALFIGYELFWKKRR 160


>gi|56460736|ref|YP_156017.1| lipoprotein signal peptidase [Idiomarina loihiensis L2TR]
 gi|56179746|gb|AAV82468.1| Lipoprotein signal peptidase [Idiomarina loihiensis L2TR]
          Length = 167

 Score = 84.3 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 25/91 (27%), Positives = 46/91 (50%), Gaps = 2/91 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  + + +L+   +  +     K      I Y LI  GA+GN++D    GYV+D +
Sbjct: 67  GWQRYFFIGVALLMSVALTRLIFN--KVSKRDGISYGLILGGAVGNLIDRLFRGYVVDSL 124

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDI 94
            +  QTW   VFN+AD+ I++G  +++  ++
Sbjct: 125 HLGWQTWQLPVFNIADIAITLGVILLLLSNL 155


>gi|42520601|ref|NP_966516.1| lipoprotein signal peptidase [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|42410340|gb|AAS14450.1| lipoprotein signal peptidase [Wolbachia endosymbiont of Drosophila
           melanogaster]
          Length = 158

 Score = 84.3 bits (208), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 30/92 (32%), Positives = 45/92 (48%), Gaps = 2/92 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
                 +  ILII  + ++  K+    +   +G+ L+  GA+GNVVD   +G V D+I  
Sbjct: 60  GGFFFSAFSILIIGILAYLIYKSDDQSTY--LGFSLMIGGAIGNVVDRIYWGAVYDFIYF 117

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQ 97
           H   W +  FNLADL I  G   ++Y   I  
Sbjct: 118 HIDDWYWPAFNLADLSIVCGMFTLLYKWYIYD 149


>gi|125973426|ref|YP_001037336.1| signal peptidase II [Clostridium thermocellum ATCC 27405]
 gi|256004404|ref|ZP_05429385.1| lipoprotein signal peptidase [Clostridium thermocellum DSM 2360]
 gi|281417628|ref|ZP_06248648.1| lipoprotein signal peptidase [Clostridium thermocellum JW20]
 gi|152032416|sp|A3DDW4|LSPA_CLOTH RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|125713651|gb|ABN52143.1| signal peptidase II, Aspartic peptidase, MEROPS family A08
           [Clostridium thermocellum ATCC 27405]
 gi|255991688|gb|EEU01789.1| lipoprotein signal peptidase [Clostridium thermocellum DSM 2360]
 gi|281409030|gb|EFB39288.1| lipoprotein signal peptidase [Clostridium thermocellum JW20]
 gi|316940338|gb|ADU74372.1| lipoprotein signal peptidase [Clostridium thermocellum DSM 1313]
          Length = 151

 Score = 84.3 bits (208), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 26/98 (26%), Positives = 47/98 (47%), Gaps = 3/98 (3%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLY-GYVIDYIM 64
              ILV + +++   I +   KN  +   +     +I  GALGN++D       V+D++ 
Sbjct: 56  GRYILVPVTVVLSILIVYFIFKN--SNKFYRFSLSMILGGALGNLIDRVFRTDGVVDFLD 113

Query: 65  IHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
                + F VFN+AD F+ +GT ++ Y  + +    K 
Sbjct: 114 FQFGNYHFPVFNVADTFVVVGTLLLAYYTLFIYKEDKK 151


>gi|323702037|ref|ZP_08113705.1| lipoprotein signal peptidase [Desulfotomaculum nigrificans DSM 574]
 gi|323532919|gb|EGB22790.1| lipoprotein signal peptidase [Desulfotomaculum nigrificans DSM 574]
          Length = 147

 Score = 84.3 bits (208), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 30/99 (30%), Positives = 48/99 (48%), Gaps = 5/99 (5%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           ML+       V I +L++  +   ++   K   ++     LI  GA+GN+VD   Y  VI
Sbjct: 53  MLAG-KTWFFVGITLLVLLAMLIGYRWIAKAGRLYQWALGLIAGGAIGNLVDRMSYTRVI 111

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
           D++        + VFNLAD FI IG  +I+ D +    +
Sbjct: 112 DFLDFRV----WPVFNLADTFICIGVGLILLDALKEFKK 146


>gi|228992628|ref|ZP_04152554.1| Lipoprotein signal peptidase [Bacillus pseudomycoides DSM 12442]
 gi|228998674|ref|ZP_04158261.1| Lipoprotein signal peptidase [Bacillus mycoides Rock3-17]
 gi|229006176|ref|ZP_04163862.1| Lipoprotein signal peptidase [Bacillus mycoides Rock1-4]
 gi|228755017|gb|EEM04376.1| Lipoprotein signal peptidase [Bacillus mycoides Rock1-4]
 gi|228761142|gb|EEM10101.1| Lipoprotein signal peptidase [Bacillus mycoides Rock3-17]
 gi|228766960|gb|EEM15597.1| Lipoprotein signal peptidase [Bacillus pseudomycoides DSM 12442]
          Length = 157

 Score = 84.3 bits (208), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 29/95 (30%), Positives = 49/95 (51%)

Query: 8   TILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHT 67
                I ++ + FI F  KK  KT  +  I   LI  GA+GN +D      V+D+I ++ 
Sbjct: 63  WFFYIITVVFVGFIVFYMKKYAKTDRLLGISLGLILGGAIGNFIDRVFRQEVVDFIHVYI 122

Query: 68  QTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
            ++++ VFN+AD  + IG  +II   ++   + K 
Sbjct: 123 FSYNYPVFNIADSALCIGVVLIIIQTLLEGKKMKE 157


>gi|254283928|ref|ZP_04958896.1| signal peptidase II [gamma proteobacterium NOR51-B]
 gi|219680131|gb|EED36480.1| signal peptidase II [gamma proteobacterium NOR51-B]
          Length = 169

 Score = 84.3 bits (208), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 27/101 (26%), Positives = 45/101 (44%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                   ++  ++   + F   +  + K    +   LI  G LGN  D  L GYV+D+I
Sbjct: 68  GWQRWFFSAVACVVSGVVVFWLGRLERGKLWHALALGLILGGGLGNFYDRVLLGYVVDFI 127

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
            +H   W +  FN+AD  IS G  ++I D ++   R   + 
Sbjct: 128 SLHYGDWYWPAFNVADSAISAGAVVLILDSLVGSDRTSNEA 168


>gi|325295047|ref|YP_004281561.1| lipoprotein signal peptidase [Desulfurobacterium thermolithotrophum
           DSM 11699]
 gi|325065495|gb|ADY73502.1| Lipoprotein signal peptidase [Desulfurobacterium thermolithotrophum
           DSM 11699]
          Length = 153

 Score = 84.3 bits (208), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 47/89 (52%)

Query: 9   ILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQ 68
            L+ I  +IIAFI +          +F IG  LI  GA+GN+ D  LYG VID++  +  
Sbjct: 65  FLLFIPAVIIAFILYYILFKSIKSRLFAIGLGLILGGAVGNLYDRVLYGKVIDFLDFYIG 124

Query: 69  TWSFAVFNLADLFISIGTCIIIYDDIILQ 97
            + +  FN+AD+ + +G  +++      +
Sbjct: 125 PYHWPTFNIADVSVFVGCFLLLIHHFKEE 153


>gi|229140542|ref|ZP_04269097.1| Lipoprotein signal peptidase [Bacillus cereus BDRD-ST26]
 gi|229198005|ref|ZP_04324719.1| Lipoprotein signal peptidase [Bacillus cereus m1293]
 gi|228585484|gb|EEK43588.1| Lipoprotein signal peptidase [Bacillus cereus m1293]
 gi|228643103|gb|EEK99379.1| Lipoprotein signal peptidase [Bacillus cereus BDRD-ST26]
          Length = 157

 Score = 83.9 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 30/95 (31%), Positives = 50/95 (52%)

Query: 8   TILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHT 67
                I ++ +AFI F  KK  KT  +  I   LI  GA+GN +D      V+D+I ++ 
Sbjct: 63  WFFYIITVVFVAFIVFYMKKYAKTDKLLGISLGLILGGAIGNFIDRVFRQEVVDFIHVYI 122

Query: 68  QTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
            ++++ VFN+AD  + IG  +II   ++   + K 
Sbjct: 123 FSYNYPVFNIADSALCIGVVLIIIQTLLEGKKTKE 157


>gi|325680275|ref|ZP_08159835.1| signal peptidase II [Ruminococcus albus 8]
 gi|324107984|gb|EGC02240.1| signal peptidase II [Ruminococcus albus 8]
          Length = 165

 Score = 83.9 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 42/96 (43%), Gaps = 2/96 (2%)

Query: 7   PTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIH 66
              LV + I++         K  K   +  I   +I +G +GN++D      VIDYI   
Sbjct: 63  TWFLVLLPIVVCIAGIVYMYKIRKGSKLEMISVAMIISGGVGNLIDRVRMHEVIDYIKF- 121

Query: 67  TQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
            +  +F +FN AD+ I IG  +     II   ++  
Sbjct: 122 -EPINFPIFNFADICIVIGAILFCLSIIISDVKKSK 156


>gi|325111033|ref|YP_004272101.1| Lipoprotein signal peptidase [Planctomyces brasiliensis DSM 5305]
 gi|324971301|gb|ADY62079.1| Lipoprotein signal peptidase [Planctomyces brasiliensis DSM 5305]
          Length = 519

 Score = 83.9 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 31/108 (28%), Positives = 52/108 (48%), Gaps = 6/108 (5%)

Query: 3   SNVSPTILVSIR-ILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGY-VI 60
           S     +L+ I   L++  I +I  K     + +  G++L+  G LGN++D  LY   VI
Sbjct: 83  SPWPRFLLMVIGNGLMLLVIGWILWKQTGLNARWRTGWLLVFLGGLGNLIDRLLYDGRVI 142

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDFPQ 108
           D++ +        +FNLAD++IS G  I+I   +        + D P 
Sbjct: 143 DFLNMGIGGLRTGIFNLADVYISAGLLILIGCSLFEPR----ETDTPH 186


>gi|254417753|ref|ZP_05031477.1| signal peptidase II [Brevundimonas sp. BAL3]
 gi|196183930|gb|EDX78906.1| signal peptidase II [Brevundimonas sp. BAL3]
          Length = 174

 Score = 83.9 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 25/94 (26%), Positives = 41/94 (43%), Gaps = 5/94 (5%)

Query: 1   MLSN---VSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYG 57
           + +    V    L ++  LII  +     +      +      LI  GA+GN+VD   +G
Sbjct: 64  LFAGSGAVGRWALSAVASLIIGALLAWIWRTRSA--VTAAAAGLIAGGAIGNLVDRLRFG 121

Query: 58  YVIDYIMIHTQTWSFAVFNLADLFISIGTCIIIY 91
            V D+I +H     +  FNLAD  I  G  +++ 
Sbjct: 122 AVTDFIDLHWGAAHWPTFNLADAAIVCGVALLLL 155


>gi|121533718|ref|ZP_01665545.1| lipoprotein signal peptidase [Thermosinus carboxydivorans Nor1]
 gi|121307709|gb|EAX48624.1| lipoprotein signal peptidase [Thermosinus carboxydivorans Nor1]
          Length = 152

 Score = 83.9 bits (207), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 24/100 (24%), Positives = 44/100 (44%), Gaps = 4/100 (4%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
                +++  L++  + +   + P    +   G  L+  GA GNV+D    GYV+D+   
Sbjct: 56  QRIFFIAVAALMLGAVAYYVPRIPTGMMLLRWGTGLMAGGAAGNVIDRIRTGYVVDFFDF 115

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
                 + VFN+AD+ I  G   II+  +     +   +D
Sbjct: 116 RI----WPVFNIADIAIVTGVACIIFTLLKSGQEKDDSLD 151


>gi|302383343|ref|YP_003819166.1| lipoprotein signal peptidase [Brevundimonas subvibrioides ATCC
           15264]
 gi|302193971|gb|ADL01543.1| lipoprotein signal peptidase [Brevundimonas subvibrioides ATCC
           15264]
          Length = 168

 Score = 83.9 bits (207), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 25/96 (26%), Positives = 44/96 (45%), Gaps = 2/96 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
             +   L    +++ A + +        +        L+  GA+GN +D   +GYV+D+I
Sbjct: 65  GAARWALSVFSLIVAAGLAWWA--LQAQRRTLVAAIGLVIGGAVGNAIDRIRFGYVVDFI 122

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
                     VFN+AD  I+IG C++I D I  + +
Sbjct: 123 DFSGTGLFPWVFNIADSAITIGVCLLILDSIRSERK 158


>gi|259417728|ref|ZP_05741647.1| signal peptidase II [Silicibacter sp. TrichCH4B]
 gi|259346634|gb|EEW58448.1| signal peptidase II [Silicibacter sp. TrichCH4B]
          Length = 160

 Score = 83.9 bits (207), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 30/96 (31%), Positives = 54/96 (56%), Gaps = 1/96 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
           + S  IL++I ++I A +F   +++     +  I   L+  GALGNV+D  LYGYV+D++
Sbjct: 63  DSSRWILIAISLVICAAVFIWVRRSHSNSRMMLISAGLVIGGALGNVLDRVLYGYVLDFL 122

Query: 64  MIHTQTWSFA-VFNLADLFISIGTCIIIYDDIILQH 98
            +    ++   VFN+AD+F+  G   +I  +   + 
Sbjct: 123 NMSCCGFNNPYVFNVADIFVFGGAAGLILFEGRAKK 158


>gi|152032414|sp|Q7NS58|LSPA_CHRVO RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
          Length = 162

 Score = 83.9 bits (207), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 48/97 (49%), Gaps = 2/97 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +   +   +  ++ +   K   +  + ++    I  GALGNV+D   YG+VID+I
Sbjct: 67  GWQKYLFTILAFAVSGWLGWNIVKRRFSG-LMNLAAAFIMGGALGNVIDRLAYGHVIDFI 125

Query: 64  MIHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQHR 99
           M+H    W +  FNLAD FI +G  +++ D +    R
Sbjct: 126 MVHYYNEWYYPAFNLADSFICVGAALMVADSMKKPSR 162


>gi|228475067|ref|ZP_04059795.1| signal peptidase II [Staphylococcus hominis SK119]
 gi|314936641|ref|ZP_07843988.1| signal peptidase II [Staphylococcus hominis subsp. hominis C80]
 gi|228271052|gb|EEK12440.1| signal peptidase II [Staphylococcus hominis SK119]
 gi|313655260|gb|EFS19005.1| signal peptidase II [Staphylococcus hominis subsp. hominis C80]
          Length = 158

 Score = 83.9 bits (207), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 24/93 (25%), Positives = 46/93 (49%)

Query: 9   ILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQ 68
               I ++I+A +   + K  K  +   +   L+  GALGN +D    G V+D+I  +  
Sbjct: 66  FFYIITLIILAVLIIFYIKETKYNAFMQVAISLLFAGALGNFIDRLFNGEVVDFIDTNIF 125

Query: 69  TWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
            + F +FN+AD  ++IG   +I   +    +++
Sbjct: 126 GYDFPIFNIADSSLTIGVIFVIIALVKDATKKE 158


>gi|229031525|ref|ZP_04187525.1| Lipoprotein signal peptidase [Bacillus cereus AH1271]
 gi|228729814|gb|EEL80794.1| Lipoprotein signal peptidase [Bacillus cereus AH1271]
          Length = 157

 Score = 83.9 bits (207), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 29/95 (30%), Positives = 49/95 (51%)

Query: 8   TILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHT 67
                I ++ +AFI    KK  KT  +  I   LI  GA+GN +D      V+D+I ++ 
Sbjct: 63  WFFYIITVVFVAFIVIYMKKYAKTDKLLGISLGLILGGAIGNFIDRVFRQEVVDFIHVYI 122

Query: 68  QTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
            ++++ VFN+AD  + IG  +II   ++   + K 
Sbjct: 123 FSYNYPVFNIADSALCIGVVLIIIQTLLEGKKTKE 157


>gi|296284863|ref|ZP_06862861.1| lipoprotein signal peptidase [Citromicrobium bathyomarinum JL354]
          Length = 175

 Score = 83.5 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 34/95 (35%), Positives = 47/95 (49%), Gaps = 3/95 (3%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
              +LV     I   + F   +      I   G  LI  GALGN++D  LYGYVIDY  +
Sbjct: 70  QRWLLVMGTGAIALIVLFWMLRERTKGDI--FGLALILGGALGNILDRVLYGYVIDYADL 127

Query: 66  HTQTWS-FAVFNLADLFISIGTCIIIYDDIILQHR 99
           H   +  F +FN+AD  I+IG  II+     L+ +
Sbjct: 128 HFGAFRPFMIFNVADACITIGVLIILARSFFLRDK 162


>gi|154250744|ref|YP_001411568.1| lipoprotein signal peptidase [Parvibaculum lavamentivorans DS-1]
 gi|154154694|gb|ABS61911.1| lipoprotein signal peptidase [Parvibaculum lavamentivorans DS-1]
          Length = 184

 Score = 83.5 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 25/87 (28%), Positives = 44/87 (50%), Gaps = 2/87 (2%)

Query: 9   ILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQ 68
           IL    +L+I  +     +      +  +   LI  GA+GNV D   YG V D+   H  
Sbjct: 78  ILAGFALLVICGLGLWLARV--EYKVTALAIGLILGGAIGNVYDRIAYGAVADFFSFHAF 135

Query: 69  TWSFAVFNLADLFISIGTCIIIYDDII 95
            + + +FN+AD++I++G  +II + + 
Sbjct: 136 GFYWYIFNIADVWIALGVILIILESVW 162


>gi|291459222|ref|ZP_06598612.1| signal peptidase II [Oribacterium sp. oral taxon 078 str. F0262]
 gi|291418476|gb|EFE92195.1| signal peptidase II [Oribacterium sp. oral taxon 078 str. F0262]
          Length = 169

 Score = 83.5 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 54/97 (55%), Gaps = 4/97 (4%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYI--LITTGALGNVVDHCLYGYVIDYI 63
              +   I +L+++ I  + ++ P+ +  F +     LI +GA+GN +D    GYV+D+I
Sbjct: 63  QRMLFFIITVLVLSVIVCLIRRLPEKRRYFPLFLSSLLIFSGAIGNFIDRMRNGYVVDFI 122

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
             +    +F VFN+AD++++ G  ++IY  + +   +
Sbjct: 123 --YFMPINFPVFNVADIYVTSGCALMIYLFLFVYRDE 157


>gi|163739803|ref|ZP_02147210.1| lipoprotein signal peptidase [Phaeobacter gallaeciensis BS107]
 gi|161386837|gb|EDQ11199.1| lipoprotein signal peptidase [Phaeobacter gallaeciensis BS107]
          Length = 160

 Score = 83.5 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 29/90 (32%), Positives = 46/90 (51%), Gaps = 1/90 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
           + +  +L+S+ +LI   +     + P       +   L+  GALGNVVD  LYGYV+D++
Sbjct: 63  DTTRWVLISLSMLICMVLVIWISRLPADARAMQLSAGLVIGGALGNVVDRLLYGYVLDFL 122

Query: 64  MIHTQTWSFA-VFNLADLFISIGTCIIIYD 92
                      VFN+AD+FI +G   +I  
Sbjct: 123 NTSCCGIENPFVFNVADVFIFVGAAGLILF 152


>gi|237755611|ref|ZP_04584226.1| signal peptidase II [Sulfurihydrogenibium yellowstonense SS-5]
 gi|237692238|gb|EEP61231.1| signal peptidase II [Sulfurihydrogenibium yellowstonense SS-5]
          Length = 163

 Score = 83.5 bits (206), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 23/87 (26%), Positives = 44/87 (50%)

Query: 14  RILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQTWSFA 73
            I  +    +++K N K  ++  I   LI  G++GN+ D  + G V D++  +     + 
Sbjct: 74  IIAAVITAGYVFKSNAKLSNLEVISLALICGGSVGNLYDRFMLGQVRDFLDFYINDHHWP 133

Query: 74  VFNLADLFISIGTCIIIYDDIILQHRQ 100
            FN+AD  I+IG  + I  ++  + R+
Sbjct: 134 AFNVADASITIGIALFIGYELFWKKRK 160


>gi|91205701|ref|YP_538056.1| lipoprotein signal peptidase [Rickettsia bellii RML369-C]
 gi|157826840|ref|YP_001495904.1| lipoprotein signal peptidase [Rickettsia bellii OSU 85-389]
 gi|122425492|sp|Q1RI47|LSPA_RICBR RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|166232873|sp|A8GVJ0|LSPA_RICB8 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|91069245|gb|ABE04967.1| Lipoprotein signal peptidase [Rickettsia bellii RML369-C]
 gi|157802144|gb|ABV78867.1| lipoprotein signal peptidase [Rickettsia bellii OSU 85-389]
          Length = 196

 Score = 83.5 bits (206), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 28/102 (27%), Positives = 51/102 (50%), Gaps = 2/102 (1%)

Query: 5   VSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIM 64
            S  + +    +I+ +++++   +         GY  +  GA+GN++D    G V D+I 
Sbjct: 72  YSNIVFLITNTIIVCYLYYLMMSSKTIGGFA--GYSFVIGGAIGNLIDRSFRGAVFDFIH 129

Query: 65  IHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDF 106
            + Q +SF VFNLAD FI++G  I++ D    +   + K   
Sbjct: 130 FYYQDYSFPVFNLADCFITLGVIILVEDYYSAKKNIEEKAKE 171


>gi|302341852|ref|YP_003806381.1| lipoprotein signal peptidase [Desulfarculus baarsii DSM 2075]
 gi|301638465|gb|ADK83787.1| lipoprotein signal peptidase [Desulfarculus baarsii DSM 2075]
          Length = 155

 Score = 83.5 bits (206), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 22/79 (27%), Positives = 39/79 (49%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
              +LV++ +  +    ++         +      LI  GALGN++D    G V+D+I+ 
Sbjct: 63  GRWLLVAVSVAALGLCLWLAVGPWGRGRLGFWALALICGGALGNLIDRLRLGQVVDFILA 122

Query: 66  HTQTWSFAVFNLADLFISI 84
           H Q + +  FN+AD  I+I
Sbjct: 123 HWQQYHWPAFNVADSAITI 141


>gi|238022926|ref|ZP_04603352.1| hypothetical protein GCWU000324_02847 [Kingella oralis ATCC 51147]
 gi|237865734|gb|EEP66872.1| hypothetical protein GCWU000324_02847 [Kingella oralis ATCC 51147]
          Length = 111

 Score = 83.5 bits (206), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 22/95 (23%), Positives = 45/95 (47%), Gaps = 1/95 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                + + +  +I  ++     KN     + +    +I  GALGNV+D  ++  V+D++
Sbjct: 16  GAQKYLFIVLAFVISGYLARGIAKNEFG-KLGNWAAAMIIGGALGNVIDRFVHEKVVDFL 74

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
           + +     +  FN+AD FI +G  ++  D I  + 
Sbjct: 75  LFYWGEHYYPAFNVADSFICVGAVLLAIDSIKHKK 109


>gi|118602653|ref|YP_903868.1| lipoprotein signal peptidase [Candidatus Ruthia magnifica str. Cm
           (Calyptogena magnifica)]
 gi|118567592|gb|ABL02397.1| lipoprotein signal peptidase [Candidatus Ruthia magnifica str. Cm
           (Calyptogena magnifica)]
          Length = 152

 Score = 83.5 bits (206), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 23/88 (26%), Positives = 46/88 (52%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                 L S+  +    I  +  K      +  +  +LI +GA+GN++D     +V+D+I
Sbjct: 60  GWQRYFLSSVSAIASIVISVLILKTSLKHQLKLVSLVLILSGAIGNMIDRIANSFVVDFI 119

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIY 91
            ++   +++ +FN AD+FIS+G  ++I 
Sbjct: 120 DLYYAGFNYPIFNFADIFISVGVVVLII 147


>gi|183982374|ref|YP_001850665.1| lipoprotein signal peptidase LspA [Mycobacterium marinum M]
 gi|183175700|gb|ACC40810.1| lipoprotein signal peptidase LspA [Mycobacterium marinum M]
          Length = 196

 Score = 83.5 bits (206), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 22/95 (23%), Positives = 44/95 (46%), Gaps = 12/95 (12%)

Query: 7   PTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCL------YGYVI 60
             +L  I   ++  IF++ ++       + +G  +I  GA+GN+VD          G+V+
Sbjct: 93  TWVLTLIATGVVVGIFWMGRRL--VSPWWAVGLGMILGGAMGNLVDRFFRAPGPLRGHVV 150

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDII 95
           D+  +      + VFN+AD  +  G  +++   I 
Sbjct: 151 DFFSVGW----WPVFNVADPSVVGGAILLVILSIF 181


>gi|326203543|ref|ZP_08193407.1| lipoprotein signal peptidase [Clostridium papyrosolvens DSM 2782]
 gi|325986363|gb|EGD47195.1| lipoprotein signal peptidase [Clostridium papyrosolvens DSM 2782]
          Length = 163

 Score = 83.5 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 24/99 (24%), Positives = 46/99 (46%), Gaps = 3/99 (3%)

Query: 7   PTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCL-YGYVIDYIMI 65
              LV +  ++   + +   K+        +   LI  GALGN+ D     G V+D++  
Sbjct: 56  TIFLVLMVSIVSLAMLYFLVKHK--HKFLRLSLSLILGGALGNLYDRIFSNGSVVDFLEF 113

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
           H  ++ F  FN+AD+ + +GT ++    + L   +K + 
Sbjct: 114 HFGSYVFPTFNVADILVVVGTILLAIYILFLYKEEKPEA 152


>gi|55977161|gb|AAV68376.1| LspA [Herminiimonas arsenicoxydans]
          Length = 124

 Score = 83.5 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 20/73 (27%), Positives = 35/73 (47%), Gaps = 2/73 (2%)

Query: 4  NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                 +++  ++  ++    +K  +  ++    Y LI  GALGN +D  L GYV+DY+
Sbjct: 17 GWQRYFFITLAFVVSMWLALELRK--QLPTLSAWAYSLILGGALGNAIDRLLRGYVVDYL 74

Query: 64 MIHTQTWSFAVFN 76
            H   W +  FN
Sbjct: 75 DFHWSGWHWPAFN 87


>gi|326386298|ref|ZP_08207922.1| signal peptidase II [Novosphingobium nitrogenifigens DSM 19370]
 gi|326209523|gb|EGD60316.1| signal peptidase II [Novosphingobium nitrogenifigens DSM 19370]
          Length = 187

 Score = 83.5 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 27/98 (27%), Positives = 50/98 (51%), Gaps = 3/98 (3%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S  +  IL+++   I   +     +  +      +G  ++  GALGN+ D  ++G+VIDY
Sbjct: 79  STETRLILLAVTGAIALGVAIWMLREKRQ--WDIVGLAMVLGGALGNIYDRSVHGFVIDY 136

Query: 63  IMIHTQTWS-FAVFNLADLFISIGTCIIIYDDIILQHR 99
             +H   W  F +FNLAD  I++G  I++   ++   +
Sbjct: 137 ADLHIGEWRPFLIFNLADAAITLGVLILLARSLLSGEK 174


>gi|291287675|ref|YP_003504491.1| lipoprotein signal peptidase [Denitrovibrio acetiphilus DSM 12809]
 gi|290884835|gb|ADD68535.1| lipoprotein signal peptidase [Denitrovibrio acetiphilus DSM 12809]
          Length = 158

 Score = 83.5 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 31/93 (33%), Positives = 50/93 (53%), Gaps = 1/93 (1%)

Query: 9   ILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQ 68
             V I  + I  + ++  K  K   I  + Y LI  GA+GN +D    G V+D++  + +
Sbjct: 66  FFVIITAVAILAVIYLMSKE-KDMKIRLVSYTLILAGAIGNFIDRIYIGKVVDFLHFYYK 124

Query: 69  TWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
            + +  FN+AD+ IS+G  I+  D IIL +R K
Sbjct: 125 QYQWPAFNVADIAISVGIGILFLDYIILSNRSK 157


>gi|254419191|ref|ZP_05032915.1| signal peptidase II [Brevundimonas sp. BAL3]
 gi|196185368|gb|EDX80344.1| signal peptidase II [Brevundimonas sp. BAL3]
          Length = 168

 Score = 83.5 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 25/99 (25%), Positives = 43/99 (43%), Gaps = 2/99 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
             +   L    +++ A + +        + +       +  GALGNV+D   +GYV+D+I
Sbjct: 72  GEARWGLTIFSVIVSAGLAWWA--TQSNRRLLITAIGFVMGGALGNVIDRVRFGYVVDFI 129

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
                     VFN+AD  I+IG  ++I D  +     K 
Sbjct: 130 DFSGTGVFPWVFNIADSAITIGVILLILDSFLSDKAAKA 168


>gi|304320116|ref|YP_003853759.1| lipoprotein signal peptidase [Parvularcula bermudensis HTCC2503]
 gi|303299019|gb|ADM08618.1| lipoprotein signal peptidase [Parvularcula bermudensis HTCC2503]
          Length = 218

 Score = 83.5 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 25/95 (26%), Positives = 45/95 (47%), Gaps = 3/95 (3%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
           S  +L  + + + A       +    + I  +G  LI  GA+GN +D   YGYV+D++  
Sbjct: 89  SRILLTVLALGVAAGFVHWAGRL--DRRIAALGAGLIVGGAVGNAIDRTFYGYVVDFLDF 146

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
               + +  FN+AD  I++G   + YD   +   +
Sbjct: 147 SAIGFPWK-FNIADTSINLGVAALAYDAFFIVPNR 180


>gi|319937280|ref|ZP_08011687.1| lipoprotein signal peptidase [Coprobacillus sp. 29_1]
 gi|319807646|gb|EFW04239.1| lipoprotein signal peptidase [Coprobacillus sp. 29_1]
          Length = 169

 Score = 83.1 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 25/91 (27%), Positives = 59/91 (64%)

Query: 9   ILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQ 68
           + + + ++ I  IF+ +K++   + +   G +L+ +GA+GN++D  ++GYV D+I  +  
Sbjct: 70  VFLIVAVVAIIGIFYYFKQSHAYQKLTRFGLVLVLSGAIGNLIDRIVFGYVRDFIGFNIF 129

Query: 69  TWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
            +SF +FN+AD+ I+IG  +++ +  + +++
Sbjct: 130 GYSFPIFNVADMAITIGIGLVVLEVAMEEYK 160


>gi|71082863|ref|YP_265582.1| lipoprotein signal peptidase [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|123647408|sp|Q4FPB0|LSPA_PELUB RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|71061976|gb|AAZ20979.1| Lipoprotein signal peptidase [Candidatus Pelagibacter ubique
           HTCC1062]
          Length = 166

 Score = 83.1 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 33/105 (31%), Positives = 52/105 (49%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           + S     I  SI ILI   I  I     K  +I    + LI  GA GN  D  +Y  V 
Sbjct: 62  LFSIDGSVIYNSITILIGLIIIAIIFMMLKNDNIQRYFFALIAGGAFGNFYDRIVYTAVP 121

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
           D+I +H   + + VFN+AD+FI+IG   +I  ++   +++  + +
Sbjct: 122 DFIDLHFYGFHWFVFNVADIFITIGVFCLILVELFFNNKKTNEKN 166


>gi|220920436|ref|YP_002495737.1| lipoprotein signal peptidase [Methylobacterium nodulans ORS 2060]
 gi|254810449|sp|B8IB41|LSPA_METNO RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|219945042|gb|ACL55434.1| lipoprotein signal peptidase [Methylobacterium nodulans ORS 2060]
          Length = 165

 Score = 83.1 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 39/79 (49%)

Query: 26  KKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQTWSFAVFNLADLFISIG 85
                   +      LI  GA+GN +D   YG V D++ +H   WS+ VFN+AD  I +G
Sbjct: 83  WMARTGTRLLAGALGLIVGGAIGNAIDRIAYGAVFDFVHLHAGGWSWYVFNVADAGIVLG 142

Query: 86  TCIIIYDDIILQHRQKGKI 104
              ++YD +  + R   +I
Sbjct: 143 VAGLLYDAVRAERRNAREI 161


>gi|149919703|ref|ZP_01908181.1| Peptidase A8, signal peptidase II [Plesiocystis pacifica SIR-1]
 gi|149819474|gb|EDM78904.1| Peptidase A8, signal peptidase II [Plesiocystis pacifica SIR-1]
          Length = 257

 Score = 83.1 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 17/109 (15%), Positives = 43/109 (39%), Gaps = 18/109 (16%)

Query: 5   VSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLY-------- 56
            + T  +++    +A++ ++  + P  ++   +   LI  GA GN+ D  +         
Sbjct: 93  WARTFFITVTFAALAYMGYLASQMPTKRAYGFVAVGLIAAGAAGNLHDRFVRVDTVWDKA 152

Query: 57  -------GYVIDYIMIHTQTW---SFAVFNLADLFISIGTCIIIYDDII 95
                    V+D++  +        + +FN+AD  +  G  +++     
Sbjct: 153 AGAFVEKHGVVDFLQFYYPWNPEKYWPIFNVADSALVCGVFLLLIYLHF 201


>gi|309778047|ref|ZP_07672987.1| signal peptidase II [Erysipelotrichaceae bacterium 3_1_53]
 gi|308914184|gb|EFP59984.1| signal peptidase II [Erysipelotrichaceae bacterium 3_1_53]
          Length = 158

 Score = 83.1 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 21/88 (23%), Positives = 42/88 (47%)

Query: 9   ILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQ 68
               I I  +  +   ++    +  +  IG +L+  G LGN +D   + YV D++     
Sbjct: 61  FFYLISIAFLIGMLIFYRSTDSSDRLTRIGVVLMMAGTLGNFIDRLAFQYVRDFLDFIIL 120

Query: 69  TWSFAVFNLADLFISIGTCIIIYDDIIL 96
            + F VFN+AD+ + +G  +I+   ++ 
Sbjct: 121 GYDFPVFNVADISLCVGVGLIVLSMVLE 148


>gi|229019096|ref|ZP_04175931.1| Lipoprotein signal peptidase [Bacillus cereus AH1273]
 gi|229025340|ref|ZP_04181758.1| Lipoprotein signal peptidase [Bacillus cereus AH1272]
 gi|228735925|gb|EEL86502.1| Lipoprotein signal peptidase [Bacillus cereus AH1272]
 gi|228742196|gb|EEL92361.1| Lipoprotein signal peptidase [Bacillus cereus AH1273]
          Length = 157

 Score = 83.1 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 30/95 (31%), Positives = 50/95 (52%)

Query: 8   TILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHT 67
                I ++ +AFI F  KK  KT  +  I   LI  GA+GN +D      V+D+I ++ 
Sbjct: 63  WFFYIITVVFVAFIVFYMKKYAKTDKLLGISLGLILGGAIGNFIDRVFRQEVVDFIHVYI 122

Query: 68  QTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
            ++++ VFN+AD  + IG  +II   ++   + K 
Sbjct: 123 FSYNYPVFNIADSALCIGVVLIIIQTVLEGKKTKE 157


>gi|118467010|ref|YP_882413.1| lipoprotein signal peptidase [Mycobacterium avium 104]
 gi|152032419|sp|A0QHM5|LSPA_MYCA1 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|118168297|gb|ABK69194.1| signal peptidase II [Mycobacterium avium 104]
          Length = 182

 Score = 83.1 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 22/98 (22%), Positives = 45/98 (45%), Gaps = 12/98 (12%)

Query: 7   PTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCL------YGYVI 60
             +L  I   ++  IF++ ++       + +G  +I  GA+GN+VD          G+V+
Sbjct: 76  TWVLTLIATGVVVGIFWMGRRL--VSPWWAVGLGMILGGAMGNLVDRFFRAPGPLRGHVV 133

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
           D++ +      + VFN+AD  +  G  +++   I    
Sbjct: 134 DFLSVGW----WPVFNVADPSVVGGAILLVVLSIFGYD 167


>gi|255022987|ref|ZP_05294973.1| lipoprotein signal peptidase [Listeria monocytogenes FSL J1-208]
          Length = 154

 Score = 83.1 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 49/95 (51%)

Query: 8   TILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHT 67
                I +++I  I +I +K  K K +F I    I  GA+GN +D  ++  V+D++    
Sbjct: 58  WFFYLITVIVIGIIIYIMQKYAKGKRLFSISLAFILGGAIGNFIDRIMHQEVVDFVQTVW 117

Query: 68  QTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
             + F +FN+AD  +S+G  +++    +   + KG
Sbjct: 118 GNYYFPIFNVADAALSVGVVLMLVYVFVDDRKTKG 152


>gi|254775680|ref|ZP_05217196.1| lipoprotein signal peptidase [Mycobacterium avium subsp. avium ATCC
           25291]
          Length = 184

 Score = 83.1 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 22/98 (22%), Positives = 45/98 (45%), Gaps = 12/98 (12%)

Query: 7   PTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCL------YGYVI 60
             +L  I   ++  IF++ ++       + +G  +I  GA+GN+VD          G+V+
Sbjct: 78  TWVLTLIATGVVVGIFWMGRRL--VSPWWAVGLGMILGGAMGNLVDRFFRAPGPLRGHVV 135

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
           D++ +      + VFN+AD  +  G  +++   I    
Sbjct: 136 DFLSVGW----WPVFNVADPSVVGGAILLVVLSIFGYD 169


>gi|269926451|ref|YP_003323074.1| lipoprotein signal peptidase [Thermobaculum terrenum ATCC BAA-798]
 gi|269790111|gb|ACZ42252.1| lipoprotein signal peptidase [Thermobaculum terrenum ATCC BAA-798]
          Length = 178

 Score = 83.1 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 22/96 (22%), Positives = 45/96 (46%), Gaps = 3/96 (3%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
           +  I     +L+   I    ++      +  +   +   GA+GN+ D   YG+V+D+I +
Sbjct: 73  ASLIFAIAAVLVAVIILLSSRRIAYAPWLVRLALGMELGGAIGNLTDRIRYGHVVDFIDV 132

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
               +   VFN++D  I+IG  +++   I+    +K
Sbjct: 133 RIWPF---VFNVSDASITIGVVLLLAYLILHSGGEK 165


>gi|41407348|ref|NP_960184.1| lipoprotein signal peptidase [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|41395700|gb|AAS03567.1| LspA [Mycobacterium avium subsp. paratuberculosis K-10]
          Length = 184

 Score = 83.1 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 22/98 (22%), Positives = 45/98 (45%), Gaps = 12/98 (12%)

Query: 7   PTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCL------YGYVI 60
             +L  I   ++  IF++ ++       + +G  +I  GA+GN+VD          G+V+
Sbjct: 78  TWVLTLIATGVVVGIFWMGRRL--VSPWWAVGLGMILGGAMGNLVDRFFRAPGPLRGHVV 135

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
           D++ +      + VFN+AD  +  G  +++   I    
Sbjct: 136 DFLSVGW----WPVFNVADPSVVGGAILLVVLSIFGYD 169


>gi|255021604|ref|ZP_05293647.1| Lipoprotein signal peptidase [Acidithiobacillus caldus ATCC 51756]
 gi|254968992|gb|EET26511.1| Lipoprotein signal peptidase [Acidithiobacillus caldus ATCC 51756]
          Length = 152

 Score = 83.1 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 27/93 (29%), Positives = 43/93 (46%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +L+ I +L+   I  I ++             LI  GA+GN++D    GYV+D+I
Sbjct: 59  GWQRWLLILIALLVAVVIVAILRRLKAGSHWTATALALILGGAMGNLIDRIRLGYVVDFI 118

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIIL 96
             H     +  FN+AD  ISIG  +++ D    
Sbjct: 119 GAHWGHLYWPYFNIADSAISIGAVMLVIDAFRR 151


>gi|219849169|ref|YP_002463602.1| lipoprotein signal peptidase [Chloroflexus aggregans DSM 9485]
 gi|219543428|gb|ACL25166.1| lipoprotein signal peptidase [Chloroflexus aggregans DSM 9485]
          Length = 168

 Score = 83.1 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 26/91 (28%), Positives = 46/91 (50%), Gaps = 4/91 (4%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           +    S  + V   +++   I+    + P  + +  +   LI  GALGNV+D    GYV+
Sbjct: 63  LFQGKSDILTVVAFVIMSGAIYLYVTQLPNRRKLVQVAMGLILGGALGNVIDRIRLGYVV 122

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIY 91
           D+I +      F +FNLAD  I++G  +++ 
Sbjct: 123 DFIQVGW----FPIFNLADSAITVGAALLML 149


>gi|114777450|ref|ZP_01452447.1| lipoprotein signal peptidase [Mariprofundus ferrooxydans PV-1]
 gi|114552232|gb|EAU54734.1| lipoprotein signal peptidase [Mariprofundus ferrooxydans PV-1]
          Length = 153

 Score = 82.7 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 23/94 (24%), Positives = 42/94 (44%), Gaps = 4/94 (4%)

Query: 8   TILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHT 67
            +L+++ I I   +   W K      I     ++I  GA GN+ D    GYV+D+I  + 
Sbjct: 60  WLLLAVTIGIAIAVLLWWWKERHHSGITSWLLVMILAGAAGNIWDRIQLGYVVDFIDWYL 119

Query: 68  Q----TWSFAVFNLADLFISIGTCIIIYDDIILQ 97
           +     + +  FN+AD  IS+   +++       
Sbjct: 120 RIGGSEYHWPAFNIADACISVAVVLLLITSFKKS 153


>gi|300024112|ref|YP_003756723.1| lipoprotein signal peptidase [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299525933|gb|ADJ24402.1| lipoprotein signal peptidase [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 174

 Score = 82.7 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 24/95 (25%), Positives = 43/95 (45%), Gaps = 1/95 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S +   +L    +       ++W        +  IG  LI  GA+GN +D    G V D+
Sbjct: 79  SPIGQYLLTGFALFAST-CLWLWLNRSGASRLMSIGLGLIIGGAVGNAIDRLRLGGVADF 137

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQ 97
             +H   + + VFN+AD+ I  G  +++Y+    +
Sbjct: 138 FSLHAYGYYWYVFNIADVAIVAGVLVLLYESFWGE 172


>gi|91762714|ref|ZP_01264679.1| Lipoprotein signal peptidase [Candidatus Pelagibacter ubique
           HTCC1002]
 gi|91718516|gb|EAS85166.1| Lipoprotein signal peptidase [Candidatus Pelagibacter ubique
           HTCC1002]
          Length = 166

 Score = 82.7 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 33/103 (32%), Positives = 51/103 (49%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           + S     I  SI ILI   I  I     K  +I    + LI  GA GN  D  +Y  V 
Sbjct: 62  LFSIDGSVIYNSITILIGLIIIAIIFMMLKNDNIQRYFFALIAGGAFGNFYDRIVYTAVP 121

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
           D+I +H   + + VFN+AD+FI+IG   +I  ++   +++  +
Sbjct: 122 DFIDLHFYGFHWFVFNVADIFITIGVFCLILVELFFNNKKTNE 164


>gi|227551403|ref|ZP_03981452.1| lipoprotein signal peptidase [Enterococcus faecium TX1330]
 gi|257887488|ref|ZP_05667141.1| lipoprotein signal peptidase [Enterococcus faecium 1,141,733]
 gi|257895983|ref|ZP_05675636.1| lipoprotein signal peptidase [Enterococcus faecium Com12]
 gi|257898612|ref|ZP_05678265.1| lipoprotein signal peptidase [Enterococcus faecium Com15]
 gi|293377441|ref|ZP_06623643.1| lipoprotein signal peptidase family protein [Enterococcus faecium
           PC4.1]
 gi|293570493|ref|ZP_06681548.1| lipoprotein signal peptidase [Enterococcus faecium E980]
 gi|227179522|gb|EEI60494.1| lipoprotein signal peptidase [Enterococcus faecium TX1330]
 gi|257823542|gb|EEV50474.1| lipoprotein signal peptidase [Enterococcus faecium 1,141,733]
 gi|257832548|gb|EEV58969.1| lipoprotein signal peptidase [Enterococcus faecium Com12]
 gi|257836524|gb|EEV61598.1| lipoprotein signal peptidase [Enterococcus faecium Com15]
 gi|291609439|gb|EFF38706.1| lipoprotein signal peptidase [Enterococcus faecium E980]
 gi|292643959|gb|EFF62067.1| lipoprotein signal peptidase family protein [Enterococcus faecium
           PC4.1]
          Length = 154

 Score = 82.7 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 44/97 (45%), Gaps = 3/97 (3%)

Query: 8   TILVSIRILIIAFIFFIWKKNP-KTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIH 66
                + ++ +  I  +  KN  K    F IG  LI  GA+GN +D    GYV+D     
Sbjct: 60  WFFTIVTLIAVVVILTLMIKNREKGNRWFMIGLSLILAGAIGNFIDRLRLGYVVDMFQTD 119

Query: 67  TQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
                F +FN+AD+ +  G   I+   I+ +  Q+ K
Sbjct: 120 FMN--FPIFNVADVTLVCGVICILIYIILDEKDQRKK 154


>gi|257889577|ref|ZP_05669230.1| lipoprotein signal peptidase [Enterococcus faecium 1,231,410]
 gi|257825937|gb|EEV52563.1| lipoprotein signal peptidase [Enterococcus faecium 1,231,410]
          Length = 154

 Score = 82.7 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 45/97 (46%), Gaps = 3/97 (3%)

Query: 8   TILVSIRILIIAFIFFIWKKNP-KTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIH 66
                + ++ +  I  +  KN  K    F IG  LI  GA+GN +D    GYV+D     
Sbjct: 60  WFFTIVTLIAVVVILTLMIKNREKGNRWFMIGLSLILAGAIGNFIDRIRLGYVVDMFQTD 119

Query: 67  TQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
               SF +FN+AD+ +  G   ++   I+ +  Q+ K
Sbjct: 120 FM--SFPIFNVADVTLVCGVICMLIYIILDEKDQRKK 154


>gi|218659677|ref|ZP_03515607.1| rRNA methylase protein [Rhizobium etli IE4771]
          Length = 343

 Score = 82.7 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 52/73 (71%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           MLS +    +V +R++I+AF+ ++W +  K + +  +GY LI  GA+GN++D   YG+VI
Sbjct: 271 MLSGMDGWFIVGMRLIIVAFVIWLWYRTAKDRWLAHLGYALIIAGAIGNLIDRFAYGHVI 330

Query: 61  DYIMIHTQTWSFA 73
           DYI+ +T++WSFA
Sbjct: 331 DYILFYTESWSFA 343


>gi|257878225|ref|ZP_05657878.1| lipoprotein signal peptidase [Enterococcus faecium 1,230,933]
 gi|257892483|ref|ZP_05672136.1| lipoprotein signal peptidase [Enterococcus faecium 1,231,408]
 gi|260559775|ref|ZP_05831954.1| lipoprotein signal peptidase [Enterococcus faecium C68]
 gi|293559347|ref|ZP_06675889.1| signal peptidase II [Enterococcus faecium E1162]
 gi|293569845|ref|ZP_06680932.1| signal peptidase II [Enterococcus faecium E1071]
 gi|294621731|ref|ZP_06700895.1| signal peptidase II [Enterococcus faecium U0317]
 gi|314939742|ref|ZP_07846964.1| signal peptidase II [Enterococcus faecium TX0133a04]
 gi|314941757|ref|ZP_07848634.1| signal peptidase II [Enterococcus faecium TX0133C]
 gi|314948302|ref|ZP_07851694.1| signal peptidase II [Enterococcus faecium TX0082]
 gi|314952390|ref|ZP_07855397.1| signal peptidase II [Enterococcus faecium TX0133A]
 gi|314991991|ref|ZP_07857444.1| signal peptidase II [Enterococcus faecium TX0133B]
 gi|314995711|ref|ZP_07860801.1| signal peptidase II [Enterococcus faecium TX0133a01]
 gi|257812453|gb|EEV41211.1| lipoprotein signal peptidase [Enterococcus faecium 1,230,933]
 gi|257828862|gb|EEV55469.1| lipoprotein signal peptidase [Enterococcus faecium 1,231,408]
 gi|260073999|gb|EEW62322.1| lipoprotein signal peptidase [Enterococcus faecium C68]
 gi|291587593|gb|EFF19470.1| signal peptidase II [Enterococcus faecium E1071]
 gi|291598740|gb|EFF29793.1| signal peptidase II [Enterococcus faecium U0317]
 gi|291606711|gb|EFF36103.1| signal peptidase II [Enterococcus faecium E1162]
 gi|313590102|gb|EFR68947.1| signal peptidase II [Enterococcus faecium TX0133a01]
 gi|313593426|gb|EFR72271.1| signal peptidase II [Enterococcus faecium TX0133B]
 gi|313595507|gb|EFR74352.1| signal peptidase II [Enterococcus faecium TX0133A]
 gi|313599435|gb|EFR78278.1| signal peptidase II [Enterococcus faecium TX0133C]
 gi|313640971|gb|EFS05551.1| signal peptidase II [Enterococcus faecium TX0133a04]
 gi|313645283|gb|EFS09863.1| signal peptidase II [Enterococcus faecium TX0082]
          Length = 154

 Score = 82.7 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 45/97 (46%), Gaps = 3/97 (3%)

Query: 8   TILVSIRILIIAFIFFIWKKNP-KTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIH 66
                + ++ +  I  +  KN  K    F IG  LI  GA+GN +D    GYV+D     
Sbjct: 60  WFFTIVTLIAVVVILTLMIKNREKGNRWFMIGLSLILAGAIGNFIDRIRLGYVVDMFQTD 119

Query: 67  TQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
               SF +FN+AD+ +  G   ++   I+ +  Q+ K
Sbjct: 120 FM--SFPIFNVADVTLVCGVICMLIYIILDEKDQRKK 154


>gi|254475456|ref|ZP_05088842.1| signal peptidase II [Ruegeria sp. R11]
 gi|214029699|gb|EEB70534.1| signal peptidase II [Ruegeria sp. R11]
          Length = 160

 Score = 82.7 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 27/90 (30%), Positives = 46/90 (51%), Gaps = 1/90 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
           + +  IL+ + ++I   +     + P       I   L+  GALGNVVD  ++GYV+D++
Sbjct: 63  DTTRWILIGLSLVICVALVIWILRLPAQARAMQISAGLVIGGALGNVVDRVVFGYVLDFL 122

Query: 64  MIHTQTWSFA-VFNLADLFISIGTCIIIYD 92
            +     +   VFN+AD+FI  G   +I  
Sbjct: 123 NMSCCGINNPFVFNVADIFIFAGAAGLILF 152


>gi|302389578|ref|YP_003825399.1| lipoprotein signal peptidase [Thermosediminibacter oceani DSM
           16646]
 gi|302200206|gb|ADL07776.1| lipoprotein signal peptidase [Thermosediminibacter oceani DSM
           16646]
          Length = 150

 Score = 82.7 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 31/95 (32%), Positives = 49/95 (51%), Gaps = 4/95 (4%)

Query: 8   TILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHT 67
               +  +++IA +FF   + P  + +  +   LI  GALGN+VD   +GYV+D+I    
Sbjct: 58  FFFSTASLIVIAALFFYISRIPPEQRLLRMALSLILGGALGNLVDRLRFGYVVDFIDFRI 117

Query: 68  QTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
               + VFNLAD  I IG  +++Y  I     +K 
Sbjct: 118 ----WPVFNLADSAIVIGEVVLVYILIFDPLFKKS 148


>gi|295099510|emb|CBK88599.1| lipoprotein signal peptidase [Eubacterium cylindroides T2-87]
          Length = 167

 Score = 82.7 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 26/103 (25%), Positives = 52/103 (50%), Gaps = 2/103 (1%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           +      T    + I+ +  I +I+         + +   L+ +GA+GN +D  + GYV 
Sbjct: 60  LFEGFGMTFFAIVTIVALILIGYIYFMV--NDYRYQLALALVFSGAIGNFIDRLVLGYVR 117

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
           D+  ++     F VFN+AD+ I+IG  I++   I  ++++K +
Sbjct: 118 DFFSVYIFGSPFPVFNVADICITIGFAILLIIYIYDEYKEKKR 160


>gi|240849691|ref|YP_002971079.1| lipoprotein signal peptidase [Bartonella grahamii as4aup]
 gi|240266814|gb|ACS50402.1| lipoprotein signal peptidase [Bartonella grahamii as4aup]
          Length = 167

 Score = 82.7 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 32/88 (36%), Positives = 51/88 (57%), Gaps = 1/88 (1%)

Query: 20  FIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQT-WSFAVFNLA 78
           F+  +WK     KS+   G ILI  GA+GN+VD   + +V DYI+ H    + FA+FNLA
Sbjct: 76  FLLRLWKNTEHNKSLMRFGLILIIGGAIGNLVDRIRFHHVTDYILFHIDDIFYFAIFNLA 135

Query: 79  DLFISIGTCIIIYDDIILQHRQKGKIDF 106
           D FI++G   I+ +++    ++K   + 
Sbjct: 136 DSFITLGVIAILIEELRTWMKEKRHSNS 163


>gi|46200964|ref|ZP_00207917.1| COG0597: Lipoprotein signal peptidase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 172

 Score = 82.7 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 28/99 (28%), Positives = 46/99 (46%), Gaps = 2/99 (2%)

Query: 5   VSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIM 64
            +  IL ++ ++I A + F   K      +  +    I  GALGNVVD   +G V D++ 
Sbjct: 76  WNALILSALAMVICAGMIFWLAK--AESLLIQVALGGIIGGALGNVVDRARFGAVADFLD 133

Query: 65  IHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
            H   + +  FNLAD  I++G   +I+D +         
Sbjct: 134 FHLAGYHWPAFNLADSAITVGAVFLIFDSLFAGRDSSKN 172


>gi|94968887|ref|YP_590935.1| signal peptidase II [Candidatus Koribacter versatilis Ellin345]
 gi|94550937|gb|ABF40861.1| signal peptidase II [Candidatus Koribacter versatilis Ellin345]
          Length = 174

 Score = 82.7 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 24/89 (26%), Positives = 48/89 (53%)

Query: 10  LVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQT 69
           LV   I+ +  +  +  +N +  +       LI  GALGN+ D  L+G+V D+++++ + 
Sbjct: 74  LVIFSIVALVIVLVLLVRNSRAFTWNGFSLALILGGALGNLWDRVLHGWVTDFLLVYYKR 133

Query: 70  WSFAVFNLADLFISIGTCIIIYDDIILQH 98
           W +  FN+AD  I +G  ++I + +  + 
Sbjct: 134 WEWPAFNVADSAICVGAVLLIAEMLFKRE 162


>gi|322374527|ref|ZP_08049041.1| signal peptidase II [Streptococcus sp. C300]
 gi|321280027|gb|EFX57066.1| signal peptidase II [Streptococcus sp. C300]
          Length = 155

 Score = 82.7 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 23/103 (22%), Positives = 47/103 (45%), Gaps = 3/103 (2%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           ML +    +   I ++++    +   K+ +       G  LI  G LGN +D    G+V+
Sbjct: 56  MLQD-QQWLFAVITLVVMVGAIWYLHKHMEDSLWLVFGLTLIIAGGLGNFIDRMSQGFVV 114

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
           D    H    +FA+FN+AD ++++G  +++   +  +      
Sbjct: 115 DM--FHLDFINFAIFNVADSYLTVGVIVLLIAMLKEEVNGNKN 155


>gi|42782986|ref|NP_980233.1| lipoprotein signal peptidase [Bacillus cereus ATCC 10987]
 gi|206976767|ref|ZP_03237671.1| signal peptidase II [Bacillus cereus H3081.97]
 gi|217961314|ref|YP_002339882.1| lipoprotein signal peptidase [Bacillus cereus AH187]
 gi|222097339|ref|YP_002531396.1| lipoprotein signal peptidase [Bacillus cereus Q1]
 gi|81830985|sp|Q732H6|LSPA_BACC1 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|226740866|sp|B7HLM7|LSPA_BACC7 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|254810435|sp|B9IVX0|LSPA_BACCQ RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|42738913|gb|AAS42841.1| lipoprotein signal peptidase [Bacillus cereus ATCC 10987]
 gi|206745077|gb|EDZ56480.1| signal peptidase II [Bacillus cereus H3081.97]
 gi|217063797|gb|ACJ78047.1| signal peptidase II [Bacillus cereus AH187]
 gi|221241397|gb|ACM14107.1| lipoprotein signal peptidase [Bacillus cereus Q1]
 gi|324327792|gb|ADY23052.1| lipoprotein signal peptidase [Bacillus thuringiensis serovar
           finitimus YBT-020]
          Length = 152

 Score = 82.7 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 30/95 (31%), Positives = 50/95 (52%)

Query: 8   TILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHT 67
                I ++ +AFI F  KK  KT  +  I   LI  GA+GN +D      V+D+I ++ 
Sbjct: 58  WFFYIITVVFVAFIVFYMKKYAKTDKLLGISLGLILGGAIGNFIDRVFRQEVVDFIHVYI 117

Query: 68  QTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
            ++++ VFN+AD  + IG  +II   ++   + K 
Sbjct: 118 FSYNYPVFNIADSALCIGVVLIIIQTLLEGKKTKE 152


>gi|206890614|ref|YP_002248497.1| signal peptidase II [Thermodesulfovibrio yellowstonii DSM 11347]
 gi|226694758|sp|B5YJT2|LSPA_THEYD RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|206742552|gb|ACI21609.1| signal peptidase II [Thermodesulfovibrio yellowstonii DSM 11347]
          Length = 147

 Score = 82.7 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 31/96 (32%), Positives = 54/96 (56%), Gaps = 4/96 (4%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           M   +     + I +++  F+ +++ K+ +   I    Y LI  GALGN++D  +YGYVI
Sbjct: 56  MFKFLGSGFFIIIALVVTGFLVYMYFKDTQNWFI----YSLIIAGALGNIIDRLIYGYVI 111

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIIL 96
           D+I +H +   +  FN+AD  ISIG  + +Y ++  
Sbjct: 112 DFIDLHLKNLHWPAFNVADSAISIGIVLFVYKNLKK 147


>gi|15606879|ref|NP_214259.1| lipoprotein signal peptidase [Aquifex aeolicus VF5]
 gi|8134558|sp|O67692|LSPA_AQUAE RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|2984115|gb|AAC07652.1| lipoprotein signal peptidase [Aquifex aeolicus VF5]
          Length = 167

 Score = 82.4 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 40/89 (44%)

Query: 17  IIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQTWSFAVFN 76
           +IA I            I  I   LI  GALGN+ D    G V D+I +H   + +  FN
Sbjct: 76  VIALIITFLYALYSGDRIVAISMGLIGGGALGNLYDRLFLGMVRDFIHLHIGEYYWPAFN 135

Query: 77  LADLFISIGTCIIIYDDIILQHRQKGKID 105
           +AD  ISIG  ++I      +   K  ++
Sbjct: 136 IADASISIGIALLILKYFFTKPALKNLVN 164


>gi|225572137|ref|ZP_03781001.1| hypothetical protein RUMHYD_00431 [Blautia hydrogenotrophica DSM
           10507]
 gi|225040403|gb|EEG50649.1| hypothetical protein RUMHYD_00431 [Blautia hydrogenotrophica DSM
           10507]
          Length = 168

 Score = 82.4 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 23/97 (23%), Positives = 51/97 (52%), Gaps = 4/97 (4%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNP--KTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
              + + +  + +    + + + P  K   +F +  +L+  GALGN+VD  L+ YV+D+I
Sbjct: 63  QQWLFILLCCVFLVIAAYFYYRLPLEKKYWLFRLMAVLLAAGALGNLVDRILHKYVVDFI 122

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
                   F +FN+AD  + IG  +++++ +++   +
Sbjct: 123 YFSL--IHFPIFNVADCCVVIGGILMLFNVLVVYKEE 157


>gi|229013078|ref|ZP_04170243.1| Lipoprotein signal peptidase [Bacillus mycoides DSM 2048]
 gi|229061499|ref|ZP_04198843.1| Lipoprotein signal peptidase [Bacillus cereus AH603]
 gi|229134703|ref|ZP_04263512.1| Lipoprotein signal peptidase [Bacillus cereus BDRD-ST196]
 gi|229168634|ref|ZP_04296356.1| Lipoprotein signal peptidase [Bacillus cereus AH621]
 gi|228614790|gb|EEK71893.1| Lipoprotein signal peptidase [Bacillus cereus AH621]
 gi|228648749|gb|EEL04775.1| Lipoprotein signal peptidase [Bacillus cereus BDRD-ST196]
 gi|228717733|gb|EEL69383.1| Lipoprotein signal peptidase [Bacillus cereus AH603]
 gi|228748332|gb|EEL98192.1| Lipoprotein signal peptidase [Bacillus mycoides DSM 2048]
          Length = 157

 Score = 82.4 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 30/95 (31%), Positives = 50/95 (52%)

Query: 8   TILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHT 67
                I ++ +AFI F  KK  KT  +  I   LI  GA+GN +D      V+D+I ++ 
Sbjct: 63  WFFYIITVIFVAFIVFYMKKYAKTDKLLGISLGLILGGAIGNFIDRVFRQEVVDFIHVYI 122

Query: 68  QTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
            ++++ VFN+AD  + IG  +II   ++   + K 
Sbjct: 123 FSYNYPVFNIADSALCIGVVLIIIQTVLEGKKAKE 157


>gi|222475486|ref|YP_002563903.1| lipoprotein signal peptidase (lspA) [Anaplasma marginale str.
           Florida]
 gi|254995294|ref|ZP_05277484.1| lipoprotein signal peptidase (lspA) [Anaplasma marginale str.
           Mississippi]
 gi|255003474|ref|ZP_05278438.1| lipoprotein signal peptidase (lspA) [Anaplasma marginale str.
           Puerto Rico]
 gi|255004599|ref|ZP_05279400.1| lipoprotein signal peptidase (lspA) [Anaplasma marginale str.
           Virginia]
 gi|254810430|sp|B9KGU3|LSPA_ANAMF RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|222419624|gb|ACM49647.1| lipoprotein signal peptidase (lspA) [Anaplasma marginale str.
           Florida]
          Length = 170

 Score = 82.4 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 46/94 (48%), Gaps = 2/94 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
           S  I   + + +I  +F ++ ++   K    I   ++  GALGN+ D   +G V D+I +
Sbjct: 62  SNLIFTYVSLGVILMLFVLFVQSKCNK--STICMGVVIGGALGNLADRLRFGAVYDFISL 119

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
           H   + +  FN AD+ ++ G    +  +++   +
Sbjct: 120 HAGEFHWPAFNFADVCVTCGVICFLCLEVMYHAK 153


>gi|16801024|ref|NP_471292.1| lipoprotein signal peptidase [Listeria innocua Clip11262]
 gi|217964004|ref|YP_002349682.1| signal peptidase II [Listeria monocytogenes HCC23]
 gi|290893027|ref|ZP_06556016.1| signal peptidase II [Listeria monocytogenes FSL J2-071]
 gi|38258215|sp|Q92AG4|LSPA_LISIN RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|254810448|sp|B8DDQ9|LSPA_LISMH RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|16414459|emb|CAC97188.1| lsp [Listeria innocua Clip11262]
 gi|217333274|gb|ACK39068.1| signal peptidase II [Listeria monocytogenes HCC23]
 gi|290557387|gb|EFD90912.1| signal peptidase II [Listeria monocytogenes FSL J2-071]
 gi|307571426|emb|CAR84605.1| lspA [Listeria monocytogenes L99]
 gi|313608112|gb|EFR84173.1| signal peptidase II [Listeria monocytogenes FSL F2-208]
 gi|313623252|gb|EFR93500.1| signal peptidase II [Listeria innocua FSL J1-023]
          Length = 154

 Score = 82.4 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 27/95 (28%), Positives = 49/95 (51%)

Query: 8   TILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHT 67
                I +++I  I +I +K  K K +F I    I  GA+GN +D  L+  V+D++    
Sbjct: 58  WFFYLITVIVIGIIIYIMQKYAKGKRLFSISLAFILGGAIGNFIDRILHQEVVDFVQTVW 117

Query: 68  QTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
             + F +FN+AD  +S+G  +++    +   + KG
Sbjct: 118 GNYYFPIFNVADAALSVGVVLMLVYVFVDDRKTKG 152


>gi|313901895|ref|ZP_07835314.1| lipoprotein signal peptidase [Thermaerobacter subterraneus DSM
           13965]
 gi|313467836|gb|EFR63331.1| lipoprotein signal peptidase [Thermaerobacter subterraneus DSM
           13965]
          Length = 163

 Score = 82.4 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 25/108 (23%), Positives = 50/108 (46%), Gaps = 2/108 (1%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           +L N      + + +++IA I +   + P       +   L   GA+GN++D   +GYV+
Sbjct: 52  LLQN-QTLFFIVVAVVVIAAILYWLPRLPGRAGSARLALGLQLGGAVGNLIDRLRWGYVV 110

Query: 61  DYIMIHTQTWS-FAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDFP 107
           D++ +       + VFN+AD  I  GT +++   +  +      +  P
Sbjct: 111 DFVDLEFWPLHRWPVFNVADAAIVTGTALLVLWLLADRDAAPDPVQGP 158


>gi|291301468|ref|YP_003512746.1| lipoprotein signal peptidase [Stackebrandtia nassauensis DSM 44728]
 gi|290570688|gb|ADD43653.1| lipoprotein signal peptidase [Stackebrandtia nassauensis DSM 44728]
          Length = 195

 Score = 82.4 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 26/103 (25%), Positives = 48/103 (46%), Gaps = 8/103 (7%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCL------Y 56
           ++     L  + I ++  I +   +       + I   LI  GALGN+VD         +
Sbjct: 78  ASDYTWALSLVAITVVCLIVWYAFR-RLGSVGWAIALGLIAGGALGNIVDRMFRQPGFLH 136

Query: 57  GYVIDYIM-IHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
           G+V+D+I   H     +A+FNLAD  + +G  ++I  ++  + 
Sbjct: 137 GHVVDFISLFHPAGGYWAIFNLADSSLVVGVALVILLEVRGRR 179


>gi|163867315|ref|YP_001608509.1| lipoprotein signal peptidase [Bartonella tribocorum CIP 105476]
 gi|189028757|sp|A9IL10|LSPA_BART1 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|161016956|emb|CAK00514.1| Lipoprotein signal peptidase [Bartonella tribocorum CIP 105476]
          Length = 167

 Score = 82.4 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 28/87 (32%), Positives = 51/87 (58%), Gaps = 1/87 (1%)

Query: 20  FIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQT-WSFAVFNLA 78
           F+ ++WK     K +   G +LI  GA+GN++D   + +V DYI+ +    + FA+FNLA
Sbjct: 76  FLLWLWKNTEDNKFLMRFGLVLIIGGAIGNLIDRIRFHHVTDYILFYIDDIFYFAIFNLA 135

Query: 79  DLFISIGTCIIIYDDIILQHRQKGKID 105
           D FI++G  +I+ +++    + K   +
Sbjct: 136 DSFITLGVIVILIEELRTWMKAKRDSN 162


>gi|302876868|ref|YP_003845501.1| lipoprotein signal peptidase [Clostridium cellulovorans 743B]
 gi|307687553|ref|ZP_07629999.1| lipoprotein signal peptidase [Clostridium cellulovorans 743B]
 gi|302579725|gb|ADL53737.1| lipoprotein signal peptidase [Clostridium cellulovorans 743B]
          Length = 155

 Score = 82.4 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 52/97 (53%), Gaps = 2/97 (2%)

Query: 8   TILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHT 67
            I + I I++   + ++  KN +   +F I   +I +GA+GN++D    G V D+   H 
Sbjct: 58  YIFIPITIIVTVVLSYMIYKNKE--KLFRISLAVILSGAIGNLIDRLFLGSVTDFFEFHF 115

Query: 68  QTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
            ++ F VFN+AD+ + +G+  ++   +     ++ KI
Sbjct: 116 GSYVFPVFNVADICVVLGSVALVIFVLFFYDEEQDKI 152


>gi|223934287|ref|ZP_03626211.1| lipoprotein signal peptidase [Streptococcus suis 89/1591]
 gi|302023693|ref|ZP_07248904.1| lipoprotein signal peptidase [Streptococcus suis 05HAS68]
 gi|330832719|ref|YP_004401544.1| lipoprotein signal peptidase [Streptococcus suis ST3]
 gi|223897043|gb|EEF63480.1| lipoprotein signal peptidase [Streptococcus suis 89/1591]
 gi|329306942|gb|AEB81358.1| lipoprotein signal peptidase [Streptococcus suis ST3]
          Length = 154

 Score = 82.4 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 24/94 (25%), Positives = 41/94 (43%), Gaps = 2/94 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
                  + I+ +  + + + K  K          L+  GALGN +D    GYV+D    
Sbjct: 59  QQWFFTIMTIVAVTGLVWYYIKQIKGNIWTLFSLSLMIAGALGNFIDRLRLGYVVDM--F 116

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
           H    SF VFN+AD+ +++G  I+    +  +  
Sbjct: 117 HLDFISFPVFNVADVCLTVGVGILFICIMKEESN 150


>gi|163846481|ref|YP_001634525.1| lipoprotein signal peptidase [Chloroflexus aurantiacus J-10-fl]
 gi|163667770|gb|ABY34136.1| lipoprotein signal peptidase [Chloroflexus aurantiacus J-10-fl]
          Length = 169

 Score = 82.4 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 27/91 (29%), Positives = 46/91 (50%), Gaps = 4/91 (4%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           +    S  + +   ++I   I+    + P  + +  I   LI  GALGNV+D    GYV+
Sbjct: 64  LFHGKSDILTIVALVIITGAIYLYITQLPNRRRLIQIAMGLILGGALGNVIDRIRLGYVV 123

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIY 91
           D+I +      F +FNLAD  I++G  +++ 
Sbjct: 124 DFIQVGW----FPIFNLADSAITVGAALLML 150


>gi|46908076|ref|YP_014465.1| lipoprotein signal peptidase [Listeria monocytogenes serotype 4b
           str. F2365]
 gi|47094209|ref|ZP_00231923.1| lipoprotein signal peptidase [Listeria monocytogenes str. 4b H7858]
 gi|226224447|ref|YP_002758554.1| signal peptidase II [Listeria monocytogenes Clip81459]
 gi|254826114|ref|ZP_05231115.1| signal peptidase II [Listeria monocytogenes FSL J1-194]
 gi|254852750|ref|ZP_05242098.1| signal peptidase II [Listeria monocytogenes FSL R2-503]
 gi|254931986|ref|ZP_05265345.1| signal peptidase II [Listeria monocytogenes HPB2262]
 gi|254994199|ref|ZP_05276389.1| lipoprotein signal peptidase [Listeria monocytogenes FSL J2-064]
 gi|255522643|ref|ZP_05389880.1| lipoprotein signal peptidase [Listeria monocytogenes FSL J1-175]
 gi|300763843|ref|ZP_07073840.1| signal peptidase II [Listeria monocytogenes FSL N1-017]
 gi|52000806|sp|Q71YH2|LSPA_LISMF RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|259495133|sp|C1KWE3|LSPA_LISMC RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|46881346|gb|AAT04642.1| signal peptidase II [Listeria monocytogenes serotype 4b str. F2365]
 gi|47017416|gb|EAL08235.1| lipoprotein signal peptidase [Listeria monocytogenes str. 4b H7858]
 gi|225876909|emb|CAS05618.1| Putative signal peptidase II [Listeria monocytogenes serotype 4b
           str. CLIP 80459]
 gi|258606074|gb|EEW18682.1| signal peptidase II [Listeria monocytogenes FSL R2-503]
 gi|293583537|gb|EFF95569.1| signal peptidase II [Listeria monocytogenes HPB2262]
 gi|293595354|gb|EFG03115.1| signal peptidase II [Listeria monocytogenes FSL J1-194]
 gi|300515579|gb|EFK42629.1| signal peptidase II [Listeria monocytogenes FSL N1-017]
 gi|328466194|gb|EGF37351.1| lipoprotein signal peptidase [Listeria monocytogenes 1816]
 gi|328473566|gb|EGF44403.1| lipoprotein signal peptidase [Listeria monocytogenes 220]
 gi|332312285|gb|EGJ25380.1| Lipoprotein signal peptidase [Listeria monocytogenes str. Scott A]
          Length = 154

 Score = 82.4 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 27/95 (28%), Positives = 49/95 (51%)

Query: 8   TILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHT 67
                I +++I  I +I +K  K K +F I    I  GA+GN +D  L+  V+D++    
Sbjct: 58  WFFYLITVVVIGIIIYIMQKYAKGKRLFSISLAFILGGAIGNFIDRVLHQEVVDFVQTVW 117

Query: 68  QTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
             + F +FN+AD  +S+G  +++    +   + KG
Sbjct: 118 GNYYFPIFNVADAALSVGVVLMLVYVFVDDRKTKG 152


>gi|313618259|gb|EFR90323.1| signal peptidase II [Listeria innocua FSL S4-378]
          Length = 154

 Score = 82.4 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 27/95 (28%), Positives = 49/95 (51%)

Query: 8   TILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHT 67
                I +++I  I +I +K  K K +F I    I  GA+GN +D  L+  V+D++    
Sbjct: 58  WFFYLITVIVIGIIIYIMQKYAKGKRLFSISLAFILGGAIGNFIDRILHQEVVDFVQTVW 117

Query: 68  QTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
             + F +FN+AD  +S+G  +++    +   + KG
Sbjct: 118 GNYYFPIFNVADAALSVGVVLMLVYVFVDDRKTKG 152


>gi|92118629|ref|YP_578358.1| lipoprotein signal peptidase [Nitrobacter hamburgensis X14]
 gi|122417076|sp|Q1QIP9|LSPA_NITHX RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|91801523|gb|ABE63898.1| signal peptidase II, Aspartic peptidase, MEROPS family A08
           [Nitrobacter hamburgensis X14]
          Length = 164

 Score = 82.4 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 33/104 (31%), Positives = 54/104 (51%), Gaps = 6/104 (5%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S V  TIL++I+   +  +     ++     +  IG  LI  GA+GN +D   YG V+D+
Sbjct: 62  SPVGATILLAIKAGAVVLLAIWMARSQT--RLATIGLGLIIGGAIGNAIDRFAYGAVVDF 119

Query: 63  IMIHT----QTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           ++ H     +T+S+ VFNLAD+ I  G   ++YD  +     K 
Sbjct: 120 VLFHVPLAGKTYSWYVFNLADVAIVAGVIALLYDSFLRTPAAKA 163


>gi|331266600|ref|YP_004326230.1| signal peptidase II (lipoprotein signal peptidase) [Streptococcus
           oralis Uo5]
 gi|326683272|emb|CBZ00890.1| signal peptidase II (lipoprotein signal peptidase) [Streptococcus
           oralis Uo5]
          Length = 155

 Score = 82.0 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 24/103 (23%), Positives = 47/103 (45%), Gaps = 3/103 (2%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           ML +        I ++++A   +   K+ +       G  LI  G LGN +D    G+V+
Sbjct: 56  MLQD-QQWFFAIITLVVMAGAIWYLHKHMEDSLWLVFGLTLIIAGGLGNFIDRMSQGFVV 114

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
           D    H    +FA+FN+AD ++++G  +++   +  +      
Sbjct: 115 DM--FHLDFINFAIFNVADSYLTVGVIVLLIAMLKEEVNGNKN 155


>gi|225181683|ref|ZP_03735123.1| lipoprotein signal peptidase [Dethiobacter alkaliphilus AHT 1]
 gi|225167664|gb|EEG76475.1| lipoprotein signal peptidase [Dethiobacter alkaliphilus AHT 1]
          Length = 139

 Score = 82.0 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 24/92 (26%), Positives = 46/92 (50%), Gaps = 4/92 (4%)

Query: 9   ILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQ 68
           + V I + ++  I    +K P    +  +   L   GA+GN++D   +G+VID+      
Sbjct: 50  LFVIITVAVVLLIIGFLRKLPAEYRLMRVALALQLAGAIGNLIDRLRFGFVIDFFDFRV- 108

Query: 69  TWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
              + VFN+AD+ I +G  ++++D I     +
Sbjct: 109 ---WPVFNVADIAIVVGIGLLLFDLIRTSREE 137


>gi|225419733|ref|ZP_03762036.1| hypothetical protein CLOSTASPAR_06071 [Clostridium asparagiforme
           DSM 15981]
 gi|225041623|gb|EEG51869.1| hypothetical protein CLOSTASPAR_06071 [Clostridium asparagiforme
           DSM 15981]
          Length = 173

 Score = 82.0 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 22/103 (21%), Positives = 54/103 (52%), Gaps = 5/103 (4%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIF--DIGYILITTGALGNVVDHCLYGY 58
           M+          I ++++A + ++  K P T+      +  ++++ GA+GN++D    GY
Sbjct: 60  MMQGKQ-FFFFLIALVVLAAVVYLLWKMPVTERYMPMAVCLMMVSAGAVGNMIDRIGQGY 118

Query: 59  VIDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
           V+D++  + +  +F +FN+AD +++I   ++I         ++
Sbjct: 119 VVDFL--YFKLINFPIFNVADCYVTISAFLLILLVFFYYREEE 159


>gi|56419680|ref|YP_146998.1| lipoprotein signal peptidase [Geobacillus kaustophilus HTA426]
 gi|81819761|sp|Q5L0V0|LSPA_GEOKA RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|56379522|dbj|BAD75430.1| signal peptidase II [Geobacillus kaustophilus HTA426]
          Length = 154

 Score = 82.0 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 26/103 (25%), Positives = 51/103 (49%), Gaps = 1/103 (0%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           ML      +   I ++++A I    ++   ++ +  +G  L+  GA+GN +D      V+
Sbjct: 52  MLEG-QFWLFYLITVIVVAAIVIYIRRLKPSERLAGVGLGLMLGGAIGNFLDRVFRKEVV 110

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
           D+I  +  T+SF VFN+AD  +++G  ++          +KG 
Sbjct: 111 DFIHAYIGTYSFPVFNVADSALTVGVILLFVHMFFFATPEKGN 153


>gi|257884652|ref|ZP_05664305.1| lipoprotein signal peptidase [Enterococcus faecium 1,231,501]
 gi|257820490|gb|EEV47638.1| lipoprotein signal peptidase [Enterococcus faecium 1,231,501]
          Length = 154

 Score = 82.0 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 45/97 (46%), Gaps = 3/97 (3%)

Query: 8   TILVSIRILIIAFIFFIWKKNP-KTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIH 66
                + ++ +  I  +  KN  K    F IG  LI  GA+GN +D    GYV+D     
Sbjct: 60  WFFTIVTLIAVVVILTLMIKNREKGNRWFMIGLSLILAGAIGNFIDRIRLGYVVDMFQTD 119

Query: 67  TQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
               SF +FN+AD+ +  G   I+   I+ +  Q+ K
Sbjct: 120 FM--SFPIFNVADVTLVCGVICILIYIILDEKDQRKK 154


>gi|255348773|ref|ZP_05380780.1| lipoprotein signal peptidase [Chlamydia trachomatis 70]
 gi|255503313|ref|ZP_05381703.1| lipoprotein signal peptidase [Chlamydia trachomatis 70s]
 gi|255506992|ref|ZP_05382631.1| lipoprotein signal peptidase [Chlamydia trachomatis D(s)2923]
 gi|289525450|emb|CBJ14927.1| lipoprotein signal peptidase [Chlamydia trachomatis Sweden2]
 gi|296435002|gb|ADH17180.1| lipoprotein signal peptidase [Chlamydia trachomatis E/150]
 gi|296438722|gb|ADH20875.1| lipoprotein signal peptidase [Chlamydia trachomatis E/11023]
          Length = 167

 Score = 82.0 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 34/101 (33%), Positives = 50/101 (49%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           + +     +L+    +I+    F+  K         I   LI  GALGNV D  LYG V+
Sbjct: 65  LFTQYKIPLLIFRVCVILGLALFLRIKYKSLHRRTRIALTLILAGALGNVGDILLYGKVV 124

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
           D++ +   +W F  FNLAD FISIGT ++I      +  +K
Sbjct: 125 DFLSLSYYSWRFPSFNLADAFISIGTLLLIGHLYFTKESKK 165


>gi|319406412|emb|CBI80052.1| Lipoprotein signal peptidase [Bartonella sp. 1-1C]
          Length = 162

 Score = 82.0 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 36/106 (33%), Positives = 64/106 (60%), Gaps = 1/106 (0%)

Query: 2   LSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVID 61
           LS+     ++++ ++II F+ ++ K   K K +   G  LI  GA+GN++D   + YVID
Sbjct: 53  LSSYPHWGIIALTLIIIVFLLWLLKNTAKDKFLSHFGITLIIGGAIGNLIDRVRFHYVID 112

Query: 62  YIMIHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDF 106
           Y++ H +  +SFAVFNLAD FI++G   ++ D+  +  ++K   + 
Sbjct: 113 YLLFHIRDVFSFAVFNLADTFITLGAVAVLIDEFCICAKKKRYSNN 158


>gi|293365184|ref|ZP_06611901.1| signal peptidase II [Streptococcus oralis ATCC 35037]
 gi|307703722|ref|ZP_07640663.1| signal peptidase II [Streptococcus oralis ATCC 35037]
 gi|291316634|gb|EFE57070.1| signal peptidase II [Streptococcus oralis ATCC 35037]
 gi|307622557|gb|EFO01553.1| signal peptidase II [Streptococcus oralis ATCC 35037]
          Length = 155

 Score = 82.0 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 23/103 (22%), Positives = 47/103 (45%), Gaps = 3/103 (2%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           ML +    +   I ++++    +   K+ +       G  LI  G LGN +D    G+V+
Sbjct: 56  MLQD-QQWLFAVITLVVMVGAIWYLHKHMEDSLWMVFGLTLIIAGGLGNFIDRMSQGFVV 114

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
           D    H    +FA+FN+AD ++++G  +++   +  +      
Sbjct: 115 DM--FHLDFINFAIFNVADSYLTVGVIVLLIAMLKEEVNGNKN 155


>gi|261419334|ref|YP_003253016.1| lipoprotein signal peptidase [Geobacillus sp. Y412MC61]
 gi|319766150|ref|YP_004131651.1| lipoprotein signal peptidase [Geobacillus sp. Y412MC52]
 gi|261375791|gb|ACX78534.1| lipoprotein signal peptidase [Geobacillus sp. Y412MC61]
 gi|317111016|gb|ADU93508.1| lipoprotein signal peptidase [Geobacillus sp. Y412MC52]
          Length = 154

 Score = 82.0 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 26/103 (25%), Positives = 51/103 (49%), Gaps = 1/103 (0%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           ML      +   I ++++A I    ++   ++ +  +G  L+  GA+GN +D      V+
Sbjct: 52  MLEG-QFWLFYLITVIVVAAIVIYIRRLKPSERLAGVGLGLMLGGAIGNFLDRVFRKEVV 110

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
           D+I  +  T+SF VFN+AD  +++G  ++          +KG 
Sbjct: 111 DFIHAYIGTYSFPVFNVADSALTVGVILLFVHMFFFATPEKGN 153


>gi|196228766|ref|ZP_03127632.1| lipoprotein signal peptidase [Chthoniobacter flavus Ellin428]
 gi|196227047|gb|EDY21551.1| lipoprotein signal peptidase [Chthoniobacter flavus Ellin428]
          Length = 171

 Score = 82.0 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 22/96 (22%), Positives = 43/96 (44%), Gaps = 3/96 (3%)

Query: 8   TILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHT 67
           T  + I I+ +  +   +KK             L+  G LGN+ D  ++G+V+D+++ + 
Sbjct: 59  TFFILISIVALVALLVFYKKGAFKDRPSRWASALLCAGILGNLTDRIVHGHVVDFLLFNL 118

Query: 68  QTWS---FAVFNLADLFISIGTCIIIYDDIILQHRQ 100
                  +  FN+AD  I I T + I   +  +  +
Sbjct: 119 HVRYADPWPAFNVADSCICIATGLFIISAMFDRKPE 154


>gi|307293211|ref|ZP_07573057.1| lipoprotein signal peptidase [Sphingobium chlorophenolicum L-1]
 gi|306881277|gb|EFN12493.1| lipoprotein signal peptidase [Sphingobium chlorophenolicum L-1]
          Length = 171

 Score = 82.0 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 28/84 (33%), Positives = 43/84 (51%), Gaps = 3/84 (3%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
           +V   ILV + +LI  F+     +    + +      L+  GA+GN++D    GYV+DY 
Sbjct: 69  DVMRWILVGMTMLIAGFVGVWMWREKARQDVA--ALGLVLGGAIGNIIDRVRLGYVVDYA 126

Query: 64  MIHTQTWS-FAVFNLADLFISIGT 86
            +H   W  F +FNLAD  I+ G 
Sbjct: 127 DLHFGEWRPFLIFNLADAAITFGV 150


>gi|260574502|ref|ZP_05842506.1| lipoprotein signal peptidase [Rhodobacter sp. SW2]
 gi|259023398|gb|EEW26690.1| lipoprotein signal peptidase [Rhodobacter sp. SW2]
          Length = 164

 Score = 82.0 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 25/105 (23%), Positives = 46/105 (43%), Gaps = 2/105 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
           ++   +LV++ + I A+++    +             L+  GALGNVVD   YG V D++
Sbjct: 61  DLMRWVLVALALGISAWVWRWIAREGHGPWA-RASAGLLIGGALGNVVDRLAYGAVADFL 119

Query: 64  MIHTQTWSFA-VFNLADLFISIGTCIIIYDDIILQHRQKGKIDFP 107
            +          FN+AD+ I +G   ++         + G+   P
Sbjct: 120 NMSCCGIENPYAFNVADIAIFLGAVGLVLFTAESPKPRSGRRKTP 164


>gi|58584674|ref|YP_198247.1| lipoprotein signal peptidase [Wolbachia endosymbiont strain TRS of
           Brugia malayi]
 gi|58418990|gb|AAW71005.1| Lipoprotein signal peptidase [Wolbachia endosymbiont strain TRS of
           Brugia malayi]
          Length = 154

 Score = 82.0 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 32/100 (32%), Positives = 49/100 (49%), Gaps = 4/100 (4%)

Query: 1   MLSNV--SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGY 58
           M S +  S     +   LII  + ++  K    + +  +G+ L+  GA+GNVVD   +G 
Sbjct: 53  MFSTLPYSDLFFSAFSTLIIGVLAYLVYK--SNEQLTCLGFSLMIGGAIGNVVDRIYWGA 110

Query: 59  VIDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
           V D+I  H   W +  FNLADL+I  G   ++Y   I   
Sbjct: 111 VYDFIYFHIGDWYWPAFNLADLYIVCGMFTLLYKWYIYDR 150


>gi|327441138|dbj|BAK17503.1| lipoprotein signal peptidase [Solibacillus silvestris StLB046]
          Length = 158

 Score = 82.0 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 23/99 (23%), Positives = 47/99 (47%), Gaps = 3/99 (3%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           ML      +   + + +I  I +      K K +F    +L+  GA+GN +D    G V+
Sbjct: 53  MLEG-QMWLFSVVTVAVIIAIIYFNHTEAKGKPLFHASLMLLLGGAVGNFIDRLFRGEVV 111

Query: 61  DYIMIHT--QTWSFAVFNLADLFISIGTCIIIYDDIILQ 97
           D++ ++     + F +FN+AD  ++I   ++    I+ +
Sbjct: 112 DFVDVYIPVINYHFPIFNIADAALTIAVVMLFITIILEE 150


>gi|225848035|ref|YP_002728198.1| lipoprotein signal peptidase [Sulfurihydrogenibium azorense Az-Fu1]
 gi|225644345|gb|ACN99395.1| signal peptidase II [Sulfurihydrogenibium azorense Az-Fu1]
          Length = 164

 Score = 82.0 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 48/96 (50%), Gaps = 1/96 (1%)

Query: 5   VSPTILVSIRILIIAF-IFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
           V   ILV   I+ I   + +  K   K  ++  I   LI  G+LGN+ D    G V D++
Sbjct: 64  VRKFILVGSSIVAIIVSVVYFLKSKDKLSNLEIISLALIGGGSLGNLYDRFFLGQVRDFL 123

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
             + +   +  FN+AD  I++G  + I+ ++ L+ R
Sbjct: 124 DFYIKDHHWPAFNIADASITVGIGLFIFYELHLKKR 159


>gi|254465973|ref|ZP_05079384.1| signal peptidase II [Rhodobacterales bacterium Y4I]
 gi|206686881|gb|EDZ47363.1| signal peptidase II [Rhodobacterales bacterium Y4I]
          Length = 160

 Score = 82.0 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 44/97 (45%), Gaps = 4/97 (4%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
           +  IL+++  +I   +     +         +   L+  GALGNV D  LYGYV+D++  
Sbjct: 65  ARWILIALSAVICVVLAVWVCRGQDKSRGMQLSAGLVIGGALGNVADRLLYGYVLDFLNT 124

Query: 66  HTQTWSFA-VFNLADLFISIGTCIIIYDDIILQHRQK 101
                    VFN+AD+FI  G   +I        R+K
Sbjct: 125 SCCGIQNPFVFNVADIFIFAGAAGLI---FFDGRRKK 158


>gi|166155494|ref|YP_001653749.1| lipoprotein signal peptidase [Chlamydia trachomatis
           L2b/UCH-1/proctitis]
 gi|226801489|sp|B0BC43|LSPA_CHLTB RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|165931482|emb|CAP07058.1| lipoprotein signal peptidase [Chlamydia trachomatis
           L2b/UCH-1/proctitis]
          Length = 167

 Score = 82.0 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 33/101 (32%), Positives = 50/101 (49%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           + +     +L+    +I+    F+  K         I   LI  GALGNV D  L+G V+
Sbjct: 65  LFAQYKIPLLIFRVCVILGLALFLRIKYKSLHRRTRIALTLILAGALGNVGDILLHGKVV 124

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
           D++ +   +W F  FNLAD FISIGT ++I      +  +K
Sbjct: 125 DFLFLSYYSWRFPSFNLADAFISIGTLLLIGHLYFNKESKK 165


>gi|56417121|ref|YP_154195.1| lipoprotein signal peptidase [Anaplasma marginale str. St. Maries]
 gi|81821250|sp|Q5P9U0|LSPA_ANAMM RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|56388353|gb|AAV86940.1| lipoprotein signal peptidase [Anaplasma marginale str. St. Maries]
          Length = 170

 Score = 82.0 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 46/94 (48%), Gaps = 2/94 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
           S  I   + + +I  +F ++ ++   K    I   ++  GALGN+ D   +G V D++ +
Sbjct: 62  SNLIFTYVSLGVILMLFVLFVQSKCNK--STICMGVVIGGALGNLADRLRFGAVYDFVSL 119

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
           H   + +  FN AD+ ++ G    +  +I+   +
Sbjct: 120 HAGEFHWPAFNFADVCVTCGVICFLCLEIMYHAK 153


>gi|15605133|ref|NP_219918.1| lipoprotein signal peptidase [Chlamydia trachomatis D/UW-3/CX]
 gi|76789139|ref|YP_328225.1| lipoprotein signal peptidase [Chlamydia trachomatis A/HAR-13]
 gi|237804755|ref|YP_002888909.1| lipoprotein signal peptidase [Chlamydia trachomatis B/TZ1A828/OT]
 gi|255311214|ref|ZP_05353784.1| lipoprotein signal peptidase [Chlamydia trachomatis 6276]
 gi|255317516|ref|ZP_05358762.1| lipoprotein signal peptidase [Chlamydia trachomatis 6276s]
 gi|8134560|sp|O84413|LSPA_CHLTR RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|123606895|sp|Q3KLU5|LSPA_CHLTA RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|3328836|gb|AAC68005.1| Lipoprotein Signal Peptidase [Chlamydia trachomatis D/UW-3/CX]
 gi|76167669|gb|AAX50677.1| lipoprotein signal peptidase [Chlamydia trachomatis A/HAR-13]
 gi|231273055|emb|CAX09968.1| lipoprotein signal peptidase [Chlamydia trachomatis B/TZ1A828/OT]
 gi|296435929|gb|ADH18103.1| lipoprotein signal peptidase [Chlamydia trachomatis G/9768]
 gi|296437790|gb|ADH19951.1| lipoprotein signal peptidase [Chlamydia trachomatis G/11074]
 gi|297140290|gb|ADH97048.1| lipoprotein signal peptidase [Chlamydia trachomatis G/9301]
 gi|297748538|gb|ADI51084.1| Lipoprotein signal peptidase [Chlamydia trachomatis D-EC]
 gi|297749418|gb|ADI52096.1| Lipoprotein signal peptidase [Chlamydia trachomatis D-LC]
          Length = 167

 Score = 82.0 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 33/101 (32%), Positives = 50/101 (49%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           + +     +L+    +I+    F+  K         +   LI  GALGNV D  LYG V+
Sbjct: 65  LFTQYKIPLLIFRVCVILGLALFLRIKYKSLHRRTRVALTLILAGALGNVGDILLYGKVV 124

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
           D++ +   +W F  FNLAD FISIGT ++I      +  +K
Sbjct: 125 DFLSLSYYSWRFPSFNLADAFISIGTLLLIGHLYFTKESKK 165


>gi|255027650|ref|ZP_05299636.1| lipoprotein signal peptidase [Listeria monocytogenes FSL J2-003]
          Length = 148

 Score = 82.0 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 27/95 (28%), Positives = 49/95 (51%)

Query: 8   TILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHT 67
                I +++I  I +I +K  K K +F I    I  GA+GN +D  L+  V+D++    
Sbjct: 52  WFFYLITVVVIGIIIYIMQKYAKGKRLFSISLAFILGGAIGNFIDRVLHQEVVDFVQTVW 111

Query: 68  QTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
             + F +FN+AD  +S+G  +++    +   + KG
Sbjct: 112 GNYYFPIFNVADASLSVGVVLMLVYVFVDDRKTKG 146


>gi|237802833|ref|YP_002888027.1| lipoprotein signal peptidase [Chlamydia trachomatis B/Jali20/OT]
 gi|231274067|emb|CAX10861.1| lipoprotein signal peptidase [Chlamydia trachomatis B/Jali20/OT]
          Length = 167

 Score = 82.0 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 33/101 (32%), Positives = 50/101 (49%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           + +     +L+    +I+    F+  K         +   LI  GALGNV D  LYG V+
Sbjct: 65  LFTQYKIPLLIFRVCVILGLALFLRIKYKSLHRRTRVALTLILAGALGNVGDILLYGKVV 124

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
           D++ +   +W F  FNLAD FISIGT ++I      +  +K
Sbjct: 125 DFLSLSYYSWRFPSFNLADAFISIGTLLLIGHLYFTKESKK 165


>gi|327489657|gb|EGF21449.1| signal peptidase II [Streptococcus sanguinis SK1058]
          Length = 155

 Score = 82.0 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 25/103 (24%), Positives = 45/103 (43%), Gaps = 3/103 (2%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           ML N    +   +  L+I    +   K+         G  L+  G LGN +D    G+V+
Sbjct: 56  MLEN-QQWLFTLVTFLVIGGAVYYLMKHLHASKWMLAGLTLVIAGGLGNFIDRIRQGFVV 114

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
           D   +      FA+FN+AD++++IG  I++   +  +      
Sbjct: 115 DMFQLEFIN--FAIFNVADMYLTIGVAILLLMILKEEKDGSKN 155


>gi|315282848|ref|ZP_07871167.1| signal peptidase II [Listeria marthii FSL S4-120]
 gi|313613518|gb|EFR87343.1| signal peptidase II [Listeria marthii FSL S4-120]
          Length = 154

 Score = 82.0 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 27/95 (28%), Positives = 49/95 (51%)

Query: 8   TILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHT 67
                I +++I  I +I +K  K K +F I    I  GA+GN +D  L+  V+D++    
Sbjct: 58  WFFYLITVVVIGIIIYIMQKYAKGKRLFSISLAFILGGAIGNFIDRVLHQEVVDFVQTVW 117

Query: 68  QTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
             + F +FN+AD  +S+G  +++    +   + KG
Sbjct: 118 GNYYFPIFNVADASLSVGVVLMLVYVFVDDRKTKG 152


>gi|262202889|ref|YP_003274097.1| lipoprotein signal peptidase [Gordonia bronchialis DSM 43247]
 gi|262086236|gb|ACY22204.1| lipoprotein signal peptidase [Gordonia bronchialis DSM 43247]
          Length = 219

 Score = 82.0 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 21/104 (20%), Positives = 45/104 (43%), Gaps = 13/104 (12%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYG--- 57
           M S     IL  I ++++  I     +       + +G  ++  GA+GN+VD        
Sbjct: 87  MASGY-TWILSCIALVVVVVIVRYSGRLRSA--WWVLGLGMVLGGAIGNLVDRIFRAPQP 143

Query: 58  ---YVIDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
              +V+D++ +      + VFN+AD  +  G  +++   ++   
Sbjct: 144 LQGHVVDFVKVGW----WPVFNVADSAVVCGAILLVVLSLLGYD 183


>gi|166154619|ref|YP_001654737.1| lipoprotein signal peptidase [Chlamydia trachomatis 434/Bu]
 gi|301335886|ref|ZP_07224130.1| lipoprotein signal peptidase [Chlamydia trachomatis L2tet1]
 gi|238687381|sp|B0B7X8|LSPA_CHLT2 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|165930607|emb|CAP04104.1| lipoprotein signal peptidase [Chlamydia trachomatis 434/Bu]
          Length = 167

 Score = 82.0 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 33/101 (32%), Positives = 50/101 (49%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           + +     +L+    +I+    F+  K         I   LI  GALGNV D  L+G V+
Sbjct: 65  LFAQYKIPLLIFRVCVILGLALFLRIKYKSLHRRTRIALTLILAGALGNVGDILLHGKVV 124

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
           D++ +   +W F  FNLAD FISIGT ++I      +  +K
Sbjct: 125 DFLFLSYYSWRFPSFNLADAFISIGTLLLIGHLYFTKESKK 165


>gi|315612945|ref|ZP_07887856.1| signal peptidase II [Streptococcus sanguinis ATCC 49296]
 gi|315315055|gb|EFU63096.1| signal peptidase II [Streptococcus sanguinis ATCC 49296]
          Length = 155

 Score = 82.0 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 25/103 (24%), Positives = 48/103 (46%), Gaps = 3/103 (2%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           ML +    +   I ++++    +   K+ +       G ILI  G LGN +D    G+V+
Sbjct: 56  MLQD-QQWLFAVITLVVMVGAIWYLHKHMEDSLWLVFGLILIIAGGLGNFIDRMSQGFVV 114

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
           D    H    +FA+FN+AD ++++G  I++   +  +      
Sbjct: 115 DM--FHLDFINFAIFNVADSYLTVGVIILLIAMLKEEVNGNKN 155


>gi|261207802|ref|ZP_05922487.1| lipoprotein signal peptidase [Enterococcus faecium TC 6]
 gi|289566254|ref|ZP_06446686.1| signal peptidase (SPase) II [Enterococcus faecium D344SRF]
 gi|294616593|ref|ZP_06696369.1| signal peptidase II [Enterococcus faecium E1636]
 gi|294617891|ref|ZP_06697500.1| signal peptidase II [Enterococcus faecium E1679]
 gi|260078185|gb|EEW65891.1| lipoprotein signal peptidase [Enterococcus faecium TC 6]
 gi|289161961|gb|EFD09829.1| signal peptidase (SPase) II [Enterococcus faecium D344SRF]
 gi|291590543|gb|EFF22276.1| signal peptidase II [Enterococcus faecium E1636]
 gi|291595836|gb|EFF27120.1| signal peptidase II [Enterococcus faecium E1679]
          Length = 154

 Score = 81.6 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 45/97 (46%), Gaps = 3/97 (3%)

Query: 8   TILVSIRILIIAFIFFIWKKNP-KTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIH 66
                + ++ +  I  +  KN  K    F IG  L+  GA+GN +D    GYV+D     
Sbjct: 60  WFFTIVTLIAVVVILTLMIKNREKGNRWFMIGLSLVLAGAIGNFIDRIRLGYVVDMFQTD 119

Query: 67  TQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
               SF +FN+AD+ +  G   I+   I+ +  Q+ K
Sbjct: 120 FM--SFPIFNVADVTLVCGVICILIYIILDEKDQRKK 154


>gi|258515576|ref|YP_003191798.1| lipoprotein signal peptidase [Desulfotomaculum acetoxidans DSM 771]
 gi|257779281|gb|ACV63175.1| lipoprotein signal peptidase [Desulfotomaculum acetoxidans DSM 771]
          Length = 158

 Score = 81.6 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 51/97 (52%), Gaps = 5/97 (5%)

Query: 9   ILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQ 68
             ++I +L++A   F +++  KT ++  +   LI  G+LGN++D    G V+D++     
Sbjct: 59  FFIAISLLVVAGTLFFYRQIIKT-TLLQLQVGLIVGGSLGNLLDRLRIGQVVDFLDFRI- 116

Query: 69  TWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
              + VFN+AD  I IG  ++I+D +    +     D
Sbjct: 117 ---WPVFNIADTAIVIGVGLLIWDTLFHSKKHPRDGD 150


>gi|303238886|ref|ZP_07325417.1| lipoprotein signal peptidase [Acetivibrio cellulolyticus CD2]
 gi|302593519|gb|EFL63236.1| lipoprotein signal peptidase [Acetivibrio cellulolyticus CD2]
          Length = 188

 Score = 81.6 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 25/94 (26%), Positives = 48/94 (51%), Gaps = 3/94 (3%)

Query: 9   ILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGY-VIDYIMIHT 67
            L+ + +++   + +   K+     +F     +I  GALGN++D       V+D++  H 
Sbjct: 92  FLIPVTVIVSIALVYFMSKSK--NKMFKASISMILGGALGNLIDRAFRKGGVVDFLDFHF 149

Query: 68  QTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
            T++F  FN+AD FI IGT ++    + +   +K
Sbjct: 150 GTYNFPTFNVADSFIVIGTILLSIYILFVMKDEK 183


>gi|255528133|ref|ZP_05394961.1| peptidase A8 signal peptidase II [Clostridium carboxidivorans P7]
 gi|296186659|ref|ZP_06855061.1| putative lipoprotein signal peptidase [Clostridium carboxidivorans
           P7]
 gi|255508174|gb|EET84586.1| peptidase A8 signal peptidase II [Clostridium carboxidivorans P7]
 gi|296048696|gb|EFG88128.1| putative lipoprotein signal peptidase [Clostridium carboxidivorans
           P7]
          Length = 112

 Score = 81.6 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 26/91 (28%), Positives = 47/91 (51%), Gaps = 1/91 (1%)

Query: 9   ILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQ 68
            L  +  +++A I +   K   T  +  I   LI +GA+GN++D   Y YV+D++ +H +
Sbjct: 22  FLSIVTFIVMAGIVYYIIKYKPTSKLLRISLALIISGAIGNLIDRTYYKYVVDFLTLHYK 81

Query: 69  T-WSFAVFNLADLFISIGTCIIIYDDIILQH 98
             + F  FN+AD+ +  GT ++    I    
Sbjct: 82  DVYYFPTFNVADVLVVTGTFLLAIYLIKEDK 112


>gi|313632721|gb|EFR99691.1| signal peptidase II [Listeria seeligeri FSL N1-067]
 gi|313637302|gb|EFS02796.1| signal peptidase II [Listeria seeligeri FSL S4-171]
          Length = 154

 Score = 81.6 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 27/95 (28%), Positives = 49/95 (51%)

Query: 8   TILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHT 67
                I +++I  I +I +K  K K +F I    I  GA+GN +D  L+  V+D++    
Sbjct: 58  WFFYLITVIVIGIIIYIMQKYAKGKRLFSISLAFILGGAIGNFIDRVLHQEVVDFVQTVW 117

Query: 68  QTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
             + F +FN+AD  +S+G  +++    +   + KG
Sbjct: 118 GNYYFPIFNVADASLSVGVVLMLVYVFVDDRKTKG 152


>gi|253751574|ref|YP_003024715.1| lipoprotein signal peptidase [Streptococcus suis SC84]
 gi|253753475|ref|YP_003026616.1| lipoprotein signal peptidase [Streptococcus suis P1/7]
 gi|253755699|ref|YP_003028839.1| lipoprotein signal peptidase [Streptococcus suis BM407]
 gi|251815863|emb|CAZ51474.1| lipoprotein signal peptidase [Streptococcus suis SC84]
 gi|251818163|emb|CAZ55960.1| lipoprotein signal peptidase [Streptococcus suis BM407]
 gi|251819721|emb|CAR45562.1| lipoprotein signal peptidase [Streptococcus suis P1/7]
 gi|319758009|gb|ADV69951.1| prolipoprotein signal peptidase; Lsp [Streptococcus suis JS14]
          Length = 154

 Score = 81.6 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 24/94 (25%), Positives = 41/94 (43%), Gaps = 2/94 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
                  + I+ +  + + + K  K          L+  GALGN +D    GYV+D    
Sbjct: 59  QQWFFTIMTIVAVTGLVWYYIKQIKGNIWTLFSLSLMIAGALGNFIDRLRLGYVVDM--F 116

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
           H    SF VFN+AD+ +++G  I+    +  +  
Sbjct: 117 HLDFISFPVFNVADVCLTVGVGILFICIMKEESN 150


>gi|317129280|ref|YP_004095562.1| lipoprotein signal peptidase [Bacillus cellulosilyticus DSM 2522]
 gi|315474228|gb|ADU30831.1| lipoprotein signal peptidase [Bacillus cellulosilyticus DSM 2522]
          Length = 154

 Score = 81.6 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 23/95 (24%), Positives = 48/95 (50%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
              +   +  +++ FI +  +   +      I   LI  GA+GN +D  +YG V+D+I +
Sbjct: 56  QMWLFYIVTAIVVGFIIYYIQTKVENNKWLGISLGLILGGAIGNFIDRVIYGEVVDFIDV 115

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
              ++++ +FN+AD  + IG   +I+   +   +Q
Sbjct: 116 FIFSYNYPIFNVADCALVIGFIFVIFIIYLEDKKQ 150


>gi|294012276|ref|YP_003545736.1| signal peptidase II [Sphingobium japonicum UT26S]
 gi|292675606|dbj|BAI97124.1| signal peptidase II [Sphingobium japonicum UT26S]
          Length = 171

 Score = 81.6 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 29/84 (34%), Positives = 44/84 (52%), Gaps = 3/84 (3%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
           +V   +LV + ILI AF+     +    + +      L+  GA+GN++D    GYV+DY 
Sbjct: 69  DVMRWLLVGMTILIAAFVGVWMWREKARQDVA--ALGLVLGGAVGNIIDRVRLGYVVDYA 126

Query: 64  MIHTQTWS-FAVFNLADLFISIGT 86
            +H   W  F +FNLAD  I+ G 
Sbjct: 127 DLHFGEWRPFLIFNLADAAITFGV 150


>gi|299821726|ref|ZP_07053614.1| signal peptidase II [Listeria grayi DSM 20601]
 gi|299817391|gb|EFI84627.1| signal peptidase II [Listeria grayi DSM 20601]
          Length = 163

 Score = 81.6 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 26/79 (32%), Positives = 41/79 (51%)

Query: 25  WKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQTWSFAVFNLADLFISI 84
            ++  K K++F I   LI  GALGN +D      V+D++      + F +FNLAD  +SI
Sbjct: 84  MQRYAKGKTLFGISLALILGGALGNFIDRLWRHEVVDFVQTVWGNYYFPIFNLADAALSI 143

Query: 85  GTCIIIYDDIILQHRQKGK 103
           G   ++    +   + KGK
Sbjct: 144 GVVCMLIFVFLDDRKTKGK 162


>gi|152976254|ref|YP_001375771.1| lipoprotein signal peptidase [Bacillus cereus subsp. cytotoxis NVH
           391-98]
 gi|226740867|sp|A7GRL8|LSPA_BACCN RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|152025006|gb|ABS22776.1| lipoprotein signal peptidase [Bacillus cytotoxicus NVH 391-98]
          Length = 152

 Score = 81.6 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 29/95 (30%), Positives = 49/95 (51%)

Query: 8   TILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHT 67
                I ++ + FI F  KK  KT  +  I   LI  GA+GN +D      V+D+I ++ 
Sbjct: 58  WFFYIITVVFVGFIVFYMKKYAKTDKLLGISLGLILGGAIGNFIDRVFRQEVVDFIHVYI 117

Query: 68  QTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
            ++++ VFN+AD  + IG  +II   ++   + K 
Sbjct: 118 FSYNYPVFNIADSALCIGVVLIIIQTLLEGKKMKE 152


>gi|320104334|ref|YP_004179925.1| lipoprotein signal peptidase [Isosphaera pallida ATCC 43644]
 gi|319751616|gb|ADV63376.1| lipoprotein signal peptidase [Isosphaera pallida ATCC 43644]
          Length = 213

 Score = 81.6 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 26/106 (24%), Positives = 47/106 (44%), Gaps = 3/106 (2%)

Query: 5   VSPTILVSIRILIIAFIFFIWK-KNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
            SP +   + + +  F+ +    +         +G  LIT GALGN  D  ++G V D++
Sbjct: 79  YSPLVFALLSVAVTLFVLYWLFIRGAARDFWLTLGLALITAGALGNCYDRLVFGKVRDFV 138

Query: 64  MIHTQTWSF--AVFNLADLFISIGTCIIIYDDIILQHRQKGKIDFP 107
             H     F  A+FN AD  + +G  I++   +  +  +   +  P
Sbjct: 139 HFHIDPIGFDCAIFNFADNMLLLGAAILVILALRPEAPRDQPVSQP 184


>gi|297530696|ref|YP_003671971.1| lipoprotein signal peptidase [Geobacillus sp. C56-T3]
 gi|297253948|gb|ADI27394.1| lipoprotein signal peptidase [Geobacillus sp. C56-T3]
          Length = 154

 Score = 81.6 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 26/103 (25%), Positives = 51/103 (49%), Gaps = 1/103 (0%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           ML      +   I ++++A I    ++   ++ +  +G  L+  GA+GN +D      V+
Sbjct: 52  MLEG-QFWLFYLITVIVVAAIVIYIRRLKPSERLAGVGLGLMLGGAIGNFLDRVFRKEVV 110

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
           D+I  +  T+SF VFN+AD  +++G  ++          +KG 
Sbjct: 111 DFIHAYIGTYSFPVFNVADSALTVGVILLFVHMFFFATPEKGN 153


>gi|84500526|ref|ZP_00998775.1| lipoprotein signal peptidase [Oceanicola batsensis HTCC2597]
 gi|84391479|gb|EAQ03811.1| lipoprotein signal peptidase [Oceanicola batsensis HTCC2597]
          Length = 155

 Score = 81.6 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 23/88 (26%), Positives = 44/88 (50%), Gaps = 2/88 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
           S  IL+++ +LI   + +   +    +    +   L+  GA+GNV+D  LYG V D++ +
Sbjct: 63  SRWILIAVALLISVGVLYWAYRERP-RRAGLVATGLLVGGAIGNVIDRLLYGAVADFLNV 121

Query: 66  HTQTWSFA-VFNLADLFISIGTCIIIYD 92
                     FN+AD+ I +G  +++  
Sbjct: 122 SCCGIDNPFAFNVADMAIFVGAAVLVLL 149


>gi|295396962|ref|ZP_06807084.1| signal peptidase II [Aerococcus viridans ATCC 11563]
 gi|294974815|gb|EFG50520.1| signal peptidase II [Aerococcus viridans ATCC 11563]
          Length = 157

 Score = 81.6 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 29/102 (28%), Positives = 48/102 (47%), Gaps = 3/102 (2%)

Query: 2   LSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVID 61
            S     +   I + ++A + ++  K  K   +  IG   +  GALGN +D     YVID
Sbjct: 54  FSG-QMWLFYIITVAVVAVLVYMLHKEAKGAPLLAIGLSFMIAGALGNFIDRLHLKYVID 112

Query: 62  YIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
              +      F +FN+AD++++IG  ++I   II    Q  K
Sbjct: 113 TFRLEFMD--FPIFNVADVWLTIGVIMMIVYMIITPEDQLEK 152


>gi|289548099|ref|YP_003473087.1| lipoprotein signal peptidase [Thermocrinis albus DSM 14484]
 gi|289181716|gb|ADC88960.1| lipoprotein signal peptidase [Thermocrinis albus DSM 14484]
          Length = 172

 Score = 81.6 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 24/95 (25%), Positives = 45/95 (47%), Gaps = 2/95 (2%)

Query: 1   MLSNVSPTILVSIRIL--IIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGY 58
           + S+    I + I +L  ++A I   +    + + +      LI  G+LGN+ D    G 
Sbjct: 59  LFSDSHDLIRLPILLLAPVLALIITFFYSLKRKEPVTGFLMGLIGGGSLGNLYDRLFLGQ 118

Query: 59  VIDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDD 93
           V D++ +H   +S+  FN+AD  I+ G  + +   
Sbjct: 119 VRDFLYLHYGWFSWPAFNIADASITCGIFLYLLYS 153


>gi|319407884|emb|CBI81536.1| Lipoprotein signal peptidase [Bartonella schoenbuchensis R1]
          Length = 162

 Score = 81.6 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 36/102 (35%), Positives = 61/102 (59%), Gaps = 1/102 (0%)

Query: 2   LSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVID 61
           LS+ S   +++  ++II F+ + WK   + K +   G +LI  GA+GN++D   + YV D
Sbjct: 58  LSSFSHWGIIAFTLIIIVFLLWFWKNIERDKILTHFGIVLILGGAIGNLIDRVRFHYVTD 117

Query: 62  YIMIHT-QTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           YI  H    +SFA+FNLAD FI++G+  ++ D+  +   +K 
Sbjct: 118 YISFHIDGIFSFAIFNLADTFITLGSIAVLIDEFRILASKKK 159


>gi|83309934|ref|YP_420198.1| lipoprotein signal peptidase [Magnetospirillum magneticum AMB-1]
 gi|82944775|dbj|BAE49639.1| Lipoprotein signal peptidase [Magnetospirillum magneticum AMB-1]
          Length = 172

 Score = 81.6 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 25/99 (25%), Positives = 46/99 (46%), Gaps = 2/99 (2%)

Query: 5   VSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIM 64
            +  IL ++ ++I A + F   K      +  +    I  GALGNV+D   +G V D++ 
Sbjct: 76  WNALILSALAMVICAGMTFWLAK--AETFLVQVALGGIIGGALGNVIDRARFGAVADFLD 133

Query: 65  IHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
           +H   + +  FN+AD  I++G   ++ D +         
Sbjct: 134 LHVAGYHWPAFNVADSAITVGAVFLVVDSLFAGRDSSKN 172


>gi|295399733|ref|ZP_06809714.1| lipoprotein signal peptidase [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|312111748|ref|YP_003990064.1| lipoprotein signal peptidase [Geobacillus sp. Y4.1MC1]
 gi|294978136|gb|EFG53733.1| lipoprotein signal peptidase [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|311216849|gb|ADP75453.1| lipoprotein signal peptidase [Geobacillus sp. Y4.1MC1]
          Length = 154

 Score = 81.6 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 24/99 (24%), Positives = 49/99 (49%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
              +   I ++++  +    ++ P+ + ++ I   L+  GALGN +D      V+D+I +
Sbjct: 56  QFWLFYLITVIVVIGLVIYIQRLPRGEKMYGIALGLMLGGALGNFIDRLFRKEVVDFIHV 115

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
           +  T+SF VFN+AD  + IG  ++         ++K   
Sbjct: 116 YIGTYSFPVFNIADSALCIGVALVFLQTFFAGTKEKENQ 154


>gi|257063801|ref|YP_003143473.1| lipoprotein signal peptidase [Slackia heliotrinireducens DSM 20476]
 gi|256791454|gb|ACV22124.1| lipoprotein signal peptidase [Slackia heliotrinireducens DSM 20476]
          Length = 201

 Score = 81.6 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 22/90 (24%), Positives = 46/90 (51%), Gaps = 2/90 (2%)

Query: 10  LVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQT 69
           LV   +++ A++ +          +  +   L+ +G LGN +D  + GYVID++      
Sbjct: 79  LVVCALVVAAWLMWDKAMGRPATLVETLALSLVFSGGLGNCIDRFMQGYVIDFLDFTFMD 138

Query: 70  WSFAVFNLADLFISIGTCIIIYDDIILQHR 99
             F VFN+AD+ ++ G  +++   ++L+  
Sbjct: 139 --FPVFNVADIGVTCGFALLVIAYLVLERN 166


>gi|300780855|ref|ZP_07090709.1| signal peptidase II [Corynebacterium genitalium ATCC 33030]
 gi|300532562|gb|EFK53623.1| signal peptidase II [Corynebacterium genitalium ATCC 33030]
          Length = 203

 Score = 81.2 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 28/106 (26%), Positives = 51/106 (48%), Gaps = 12/106 (11%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHC------LYGYV 59
           S  I  +I+++ +     +  +         +G  LI  GALGN++D         +G+V
Sbjct: 97  STWIFTTIQLVFVVGALLVAPRIR--DKWEALGIALIAGGALGNLIDRLFRDPGFWFGHV 154

Query: 60  IDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
           +DYI +     SFAVFN+AD+ I++G  + +    +  + +    D
Sbjct: 155 VDYISVG----SFAVFNVADIAINVGVAVFVLSLFLGDNNEDKDED 196


>gi|224824628|ref|ZP_03697735.1| lipoprotein signal peptidase [Lutiella nitroferrum 2002]
 gi|224603121|gb|EEG09297.1| lipoprotein signal peptidase [Lutiella nitroferrum 2002]
          Length = 167

 Score = 81.2 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 25/97 (25%), Positives = 49/97 (50%), Gaps = 2/97 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +   +   +  ++ +   +   +  + ++    I  GALGNV+D  ++G+VID+I
Sbjct: 72  GWQKLVFTLLAFAVSGWLGWNIVQGRFSCRM-NLAAAFIMGGALGNVIDRLIHGHVIDFI 130

Query: 64  MIHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQHR 99
           ++H    W +  FNLAD FI +G  +++ D +    R
Sbjct: 131 LVHYYNAWYYPAFNLADSFICVGAGLMVLDGLKKPSR 167


>gi|297183630|gb|ADI19756.1| hypothetical protein [uncultured gamma proteobacterium EB000_37F04]
          Length = 174

 Score = 81.2 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 25/91 (27%), Positives = 41/91 (45%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                 L  I +L+  FI     +      I  +   LI  G +GN++D    G+V+D+I
Sbjct: 71  GWQRYFLSGIALLVSLFIVVWLWRLAPADRILTVPLGLILGGGVGNLIDRVAQGHVVDFI 130

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDI 94
            +H + W +  FNLAD  I+ G    +   +
Sbjct: 131 SLHYEQWFWPAFNLADAAITAGASCWLIIML 161


>gi|319892188|ref|YP_004149063.1| Lipoprotein signal peptidase [Staphylococcus pseudintermedius
           HKU10-03]
 gi|317161884|gb|ADV05427.1| Lipoprotein signal peptidase [Staphylococcus pseudintermedius
           HKU10-03]
 gi|323464711|gb|ADX76864.1| signal peptidase II [Staphylococcus pseudintermedius ED99]
          Length = 161

 Score = 81.2 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 29/98 (29%), Positives = 50/98 (51%), Gaps = 1/98 (1%)

Query: 8   TILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHT 67
           T    I I+++  +   + K  K   +  I   L+ +GALGN +D    G V+D+I    
Sbjct: 65  TFFYIITIIVLIALIVFYIKEAKNNMLMQIAISLLFSGALGNFIDRVSSGEVVDFIDTVI 124

Query: 68  QTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
             + F +FN+AD  ++IG  ++I   ++    QKGK+ 
Sbjct: 125 FGYDFPIFNIADASLTIGVVLLII-VLLKDQNQKGKVS 161


>gi|16803884|ref|NP_465369.1| lipoprotein signal peptidase [Listeria monocytogenes EGD-e]
 gi|47097694|ref|ZP_00235204.1| lipoprotein signal peptidase [Listeria monocytogenes str. 1/2a
           F6854]
 gi|224500074|ref|ZP_03668423.1| lipoprotein signal peptidase [Listeria monocytogenes Finland 1988]
 gi|224501355|ref|ZP_03669662.1| lipoprotein signal peptidase [Listeria monocytogenes FSL R2-561]
 gi|254829160|ref|ZP_05233847.1| signal peptidase II [Listeria monocytogenes FSL N3-165]
 gi|254831555|ref|ZP_05236210.1| lipoprotein signal peptidase [Listeria monocytogenes 10403S]
 gi|254899459|ref|ZP_05259383.1| lipoprotein signal peptidase [Listeria monocytogenes J0161]
 gi|254912402|ref|ZP_05262414.1| signal peptidase II [Listeria monocytogenes J2818]
 gi|254936729|ref|ZP_05268426.1| signal peptidase II [Listeria monocytogenes F6900]
 gi|255029305|ref|ZP_05301256.1| lipoprotein signal peptidase [Listeria monocytogenes LO28]
 gi|284802290|ref|YP_003414155.1| lipoprotein signal peptidase [Listeria monocytogenes 08-5578]
 gi|284995432|ref|YP_003417200.1| lipoprotein signal peptidase [Listeria monocytogenes 08-5923]
 gi|38258202|sp|Q8Y656|LSPA_LISMO RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|16411298|emb|CAC99922.1| lsp [Listeria monocytogenes EGD-e]
 gi|47013932|gb|EAL04955.1| lipoprotein signal peptidase [Listeria monocytogenes str. 1/2a
           F6854]
 gi|258601570|gb|EEW14895.1| signal peptidase II [Listeria monocytogenes FSL N3-165]
 gi|258609326|gb|EEW21934.1| signal peptidase II [Listeria monocytogenes F6900]
 gi|284057852|gb|ADB68793.1| lipoprotein signal peptidase [Listeria monocytogenes 08-5578]
 gi|284060899|gb|ADB71838.1| lipoprotein signal peptidase [Listeria monocytogenes 08-5923]
 gi|293590384|gb|EFF98718.1| signal peptidase II [Listeria monocytogenes J2818]
          Length = 154

 Score = 81.2 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 27/95 (28%), Positives = 49/95 (51%)

Query: 8   TILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHT 67
                I +++I  I +I +K  K K +F I    I  GA+GN +D  L+  V+D++    
Sbjct: 58  WFFYLITVVVIGIIIYIMQKYAKGKRLFSISLAFILGGAIGNFIDRVLHQEVVDFVQTVW 117

Query: 68  QTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
             + F +FN+AD  +S+G  +++    +   + KG
Sbjct: 118 GNYYFPIFNVADASLSVGVVLMLVYVFVDDRKTKG 152


>gi|315303760|ref|ZP_07874263.1| signal peptidase II [Listeria ivanovii FSL F6-596]
 gi|313627869|gb|EFR96499.1| signal peptidase II [Listeria ivanovii FSL F6-596]
          Length = 154

 Score = 81.2 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 27/95 (28%), Positives = 49/95 (51%)

Query: 8   TILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHT 67
                I +++I  I +I +K  K K +F +    I  GA+GN +D  L+  V+D++    
Sbjct: 58  WFFYLITVIVIGIIIYIMQKYAKGKRLFSVSLAFILGGAIGNFIDRILHQEVVDFVQTVW 117

Query: 68  QTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
             + F +FN+AD  +SIG  +++    +   + KG
Sbjct: 118 GNYYFPIFNVADASLSIGVVLMLVYVFVDDRKTKG 152


>gi|160938832|ref|ZP_02086183.1| hypothetical protein CLOBOL_03726 [Clostridium bolteae ATCC
           BAA-613]
 gi|158437795|gb|EDP15555.1| hypothetical protein CLOBOL_03726 [Clostridium bolteae ATCC
           BAA-613]
          Length = 169

 Score = 81.2 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 50/94 (53%), Gaps = 4/94 (4%)

Query: 9   ILVSIRILIIAFIFFIWKKNPKTKSI--FDIGYILITTGALGNVVDHCLYGYVIDYIMIH 66
               I +L++  + ++  K P         +  ++I+ GA+GN++D    GYV+D++  +
Sbjct: 68  FFFLIAVLVLGAVAYLIYKMPSDGKYRPLAVCLMMISAGAVGNMIDRVSQGYVVDFL--Y 125

Query: 67  TQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
            +  +F +FN+AD +++IG   +++  +     +
Sbjct: 126 FKLINFPIFNVADCYVTIGAACLVFLIMFYYKDE 159


>gi|289435187|ref|YP_003465059.1| hypothetical protein lse_1824 [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|289171431|emb|CBH27975.1| lspA [Listeria seeligeri serovar 1/2b str. SLCC3954]
          Length = 154

 Score = 81.2 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 27/95 (28%), Positives = 49/95 (51%)

Query: 8   TILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHT 67
                I +++I  I +I +K  K K +F I    I  GA+GN +D  L+  V+D++    
Sbjct: 58  WFFYLITVIVIGIIIYIMQKYAKGKRLFSISLAFILGGAIGNFIDRVLHQEVVDFVQTVW 117

Query: 68  QTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
             + F +FN+AD  +S+G  +++    +   + KG
Sbjct: 118 GNYYFPIFNVADASLSVGVVLMLVYVFVDDRKTKG 152


>gi|312114442|ref|YP_004012038.1| lipoprotein signal peptidase [Rhodomicrobium vannielii ATCC 17100]
 gi|311219571|gb|ADP70939.1| lipoprotein signal peptidase [Rhodomicrobium vannielii ATCC 17100]
          Length = 166

 Score = 81.2 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 29/102 (28%), Positives = 44/102 (43%), Gaps = 2/102 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S     IL++        +F           +      LI  GALGN +D   YG V D+
Sbjct: 66  SAAGQWILIAFAFAATLALFLWLAHMQT--RLSAAAVGLIMGGALGNAIDRMQYGAVADF 123

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
              H  ++ + VFNLAD+ I  G   ++YD +   H++ G  
Sbjct: 124 FSFHVGSFHWYVFNLADVAIVAGVGGLLYDSLKSSHKEAGNQ 165


>gi|269836532|ref|YP_003318760.1| lipoprotein signal peptidase [Sphaerobacter thermophilus DSM 20745]
 gi|269785795|gb|ACZ37938.1| lipoprotein signal peptidase [Sphaerobacter thermophilus DSM 20745]
          Length = 192

 Score = 81.2 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 19/73 (26%), Positives = 37/73 (50%), Gaps = 4/73 (5%)

Query: 25  WKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQTWSFAVFNLADLFISI 84
           + +  +      +   L   GA+GN++D   YGYV+D+I +     +F  FN+AD  I++
Sbjct: 92  FWRMIRESPWLSLALGLQFGGAIGNIIDRLRYGYVVDFIDVP----NFPTFNVADSAITV 147

Query: 85  GTCIIIYDDIILQ 97
           G  ++    +  +
Sbjct: 148 GVILLGIYLLRTE 160


>gi|205373290|ref|ZP_03226094.1| lipoprotein signal peptidase [Bacillus coahuilensis m4-4]
          Length = 96

 Score = 81.2 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 21/81 (25%), Positives = 41/81 (50%)

Query: 22  FFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQTWSFAVFNLADLF 81
            F      K   +F +   L+  GA+GN +D      V+D+I  +  ++ F +FN+AD  
Sbjct: 15  LFYLHTEAKGNKLFSVSLALLLGGAIGNFIDRIFRKEVVDFIDTYIGSYDFPIFNIADSS 74

Query: 82  ISIGTCIIIYDDIILQHRQKG 102
           ++IG   ++   I+ + ++K 
Sbjct: 75  LTIGVIFVMISIILDERKKKE 95


>gi|116873279|ref|YP_850060.1| lipoprotein signal peptidase [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|123466456|sp|A0AJU9|LSPA_LISW6 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|116742157|emb|CAK21281.1| lipoprotein signal peptidase [Listeria welshimeri serovar 6b str.
           SLCC5334]
          Length = 154

 Score = 81.2 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 27/95 (28%), Positives = 49/95 (51%)

Query: 8   TILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHT 67
                I +++I  I +I +K  K K +F I    I  GA+GN +D  L+  V+D++    
Sbjct: 58  WFFYLITVIVIGIIIYIMQKYAKGKRLFSISLAFILGGAIGNFIDRVLHQEVVDFVQTVW 117

Query: 68  QTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
             + F +FN+AD  +S+G  +++    +   + KG
Sbjct: 118 GNYYFPIFNVADASLSVGVVLMLVYVFVDDRKTKG 152


>gi|134299544|ref|YP_001113040.1| lipoprotein signal peptidase [Desulfotomaculum reducens MI-1]
 gi|134052244|gb|ABO50215.1| signal peptidase II, Aspartic peptidase, MEROPS family A08
           [Desulfotomaculum reducens MI-1]
          Length = 149

 Score = 81.2 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 24/102 (23%), Positives = 47/102 (46%), Gaps = 5/102 (4%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           ML+     I + I + ++  +   ++   +   ++     ++  GALGN+VD   +  VI
Sbjct: 53  MLAG-KTWIFIGITLAVLGAMVLGYRWISQAGVLYQWALGMVAGGALGNLVDRIRFAKVI 111

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           D++        + +FNLAD  I IG   I++D +      + 
Sbjct: 112 DFLDFRI----WPIFNLADTAICIGVAFILWDALGEFRATRK 149


>gi|170740459|ref|YP_001769114.1| lipoprotein signal peptidase [Methylobacterium sp. 4-46]
 gi|238058055|sp|B0UDF9|LSPA_METS4 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|168194733|gb|ACA16680.1| lipoprotein signal peptidase [Methylobacterium sp. 4-46]
          Length = 165

 Score = 81.2 bits (200), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 23/74 (31%), Positives = 36/74 (48%)

Query: 26  KKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQTWSFAVFNLADLFISIG 85
                   +  +   LI  GA+GN VD   YG V D++ +H   WS+ VFN+AD  I  G
Sbjct: 83  WMARAGSRLLVLSLGLIVGGAVGNAVDRVAYGAVFDFVHLHAGGWSWYVFNVADAGIVAG 142

Query: 86  TCIIIYDDIILQHR 99
              ++ + +  + R
Sbjct: 143 VAGLLVETVWSEAR 156


>gi|312865150|ref|ZP_07725378.1| signal peptidase II [Streptococcus downei F0415]
 gi|311099261|gb|EFQ57477.1| signal peptidase II [Streptococcus downei F0415]
          Length = 154

 Score = 80.8 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 25/94 (26%), Positives = 40/94 (42%), Gaps = 2/94 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
                  I IL++    +   K+            LI +G LGN +D    GYV+D + +
Sbjct: 59  QQWFFTLITILVVGLAIWYLYKHLTGSFWLLASLSLIISGGLGNFIDRLRLGYVVDMVHL 118

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
                 FA+FNLAD  +S+G  ++I      +  
Sbjct: 119 DFMD--FAIFNLADSCLSVGVFLLIIAFWREEQD 150


>gi|16803141|ref|NP_464626.1| hypothetical protein lmo1101 [Listeria monocytogenes EGD-e]
 gi|16410503|emb|CAC99179.1| lmo1101 [Listeria monocytogenes EGD-e]
          Length = 166

 Score = 80.8 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 47/92 (51%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
             T    I ++ +  + + + +    + I  IG  L+ +G LGN +D  L+ YV D +  
Sbjct: 67  QMTFFYVITLVALILLGWYFYRLKDYQIIQKIGVALMVSGTLGNFIDRLLFQYVRDSLDF 126

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQ 97
           H   ++F +FN+AD+ +  G   II D+++  
Sbjct: 127 HILGYNFPIFNVADVLLICGVLFIIIDEVLKS 158


>gi|326333483|ref|ZP_08199725.1| signal peptidase II [Nocardioidaceae bacterium Broad-1]
 gi|325948728|gb|EGD40826.1| signal peptidase II [Nocardioidaceae bacterium Broad-1]
          Length = 202

 Score = 80.8 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 14/94 (14%), Positives = 40/94 (42%), Gaps = 12/94 (12%)

Query: 7   PTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYG------YVI 60
                ++ I+    + +  ++       +     ++  G  GN++D  L        +V+
Sbjct: 85  TWFFTTLSIVATIGVLWFARRAR--HRGWAFALGILVAGISGNLIDRLLREPGFYVGHVV 142

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDI 94
           D++ +     ++ +FN+AD+ I++   +I+    
Sbjct: 143 DFLQLP----NWPIFNVADMCINVAAVMIVILSF 172


>gi|315640857|ref|ZP_07895956.1| signal peptidase II [Enterococcus italicus DSM 15952]
 gi|315483396|gb|EFU73893.1| signal peptidase II [Enterococcus italicus DSM 15952]
          Length = 155

 Score = 80.8 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 25/97 (25%), Positives = 43/97 (44%), Gaps = 2/97 (2%)

Query: 9   ILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQ 68
               I ++ +A I +   KN     +  +G+ LI  GA+GN +D    GYV+D   +   
Sbjct: 61  FFTVITVVAVAAILYFMVKNRGGHVLLMVGFSLILAGAIGNFIDRIRLGYVVDMFQLDF- 119

Query: 69  TWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
              F +FN+AD+ + IG   +       +  +    D
Sbjct: 120 -IQFPIFNVADMSLCIGVACLFIYTFFEERLKGTHND 155


>gi|163941633|ref|YP_001646517.1| lipoprotein signal peptidase [Bacillus weihenstephanensis KBAB4]
 gi|226740869|sp|A9VTD3|LSPA_BACWK RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|163863830|gb|ABY44889.1| lipoprotein signal peptidase [Bacillus weihenstephanensis KBAB4]
          Length = 152

 Score = 80.8 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 30/95 (31%), Positives = 50/95 (52%)

Query: 8   TILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHT 67
                I ++ +AFI F  KK  KT  +  I   LI  GA+GN +D      V+D+I ++ 
Sbjct: 58  WFFYIITVIFVAFIVFYMKKYAKTDKLLGISLGLILGGAIGNFIDRVFRQEVVDFIHVYI 117

Query: 68  QTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
            ++++ VFN+AD  + IG  +II   ++   + K 
Sbjct: 118 FSYNYPVFNIADSALCIGVVLIIIQTVLEGKKAKE 152


>gi|148239676|ref|YP_001225063.1| lipoprotein signal peptidase [Synechococcus sp. WH 7803]
 gi|147848215|emb|CAK23766.1| Lipoprotein signal peptidase [Synechococcus sp. WH 7803]
          Length = 168

 Score = 80.8 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 21/93 (22%), Positives = 37/93 (39%), Gaps = 2/93 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
           S   L  + +L+   +     + PK      +    +  G LGN +D    GYV D++ +
Sbjct: 73  STLFLGVLSLLVTLGVGAWIWRQPKRDVWMGLALACLLGGTLGNGIDRWRLGYVTDFLEL 132

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
                 F +FN AD+ I++       D    + 
Sbjct: 133 --VPIQFPIFNWADVVINVAVVCFAIDAFRERR 163


>gi|298529298|ref|ZP_07016701.1| lipoprotein signal peptidase [Desulfonatronospira thiodismutans
           ASO3-1]
 gi|298510734|gb|EFI34637.1| lipoprotein signal peptidase [Desulfonatronospira thiodismutans
           ASO3-1]
          Length = 164

 Score = 80.8 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 25/102 (24%), Positives = 45/102 (44%), Gaps = 1/102 (0%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
           ++     +    L +  I  + +   +          LI  GALGN++D    G VID++
Sbjct: 64  SLRTYFFLGATGLAVVLIIHLLRTVQRQDYYLFTALGLILGGALGNMIDRIRLGMVIDFL 123

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
             H  +  +  FN+AD+ IS+G  ++I      + R +   D
Sbjct: 124 DFHLGSHHWPAFNVADIAISVGAVLLIV-SFYKKKRHEADSD 164


>gi|121601961|ref|YP_989622.1| signal peptidase II [Bartonella bacilliformis KC583]
 gi|167008956|sp|A1UUG9|LSPA_BARBK RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|120614138|gb|ABM44739.1| signal peptidase II [Bartonella bacilliformis KC583]
          Length = 165

 Score = 80.8 bits (199), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 36/99 (36%), Positives = 60/99 (60%), Gaps = 1/99 (1%)

Query: 8   TILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHT 67
             L+++ I II F+F++WK     K++   G +LI  GA+GN++D   +  V DYI+ + 
Sbjct: 64  WGLIALTITIIVFLFWLWKNTELDKALSRFGIVLIIGGAIGNLIDRIRFQAVTDYILFYI 123

Query: 68  QT-WSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
              +SFA+FNLAD FI++G   I+ D+  +  + K  +D
Sbjct: 124 DGVFSFAIFNLADTFITLGAISILIDEFCIWIKTKRHLD 162


>gi|296436856|gb|ADH19026.1| lipoprotein signal peptidase [Chlamydia trachomatis G/11222]
          Length = 167

 Score = 80.8 bits (199), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 33/101 (32%), Positives = 50/101 (49%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           + +     +L+    +I+    F+  K         +   LI  GALGNV D  LYG V+
Sbjct: 65  LFTQYKIPLLIFRVCVILGLALFLRIKYKSLYRRTRVALTLILAGALGNVGDILLYGKVV 124

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
           D++ +   +W F  FNLAD FISIGT ++I      +  +K
Sbjct: 125 DFLSLSYYSWRFPSFNLADAFISIGTLLLIGHLYFTKESKK 165


>gi|332185363|ref|ZP_08387111.1| signal peptidase II [Sphingomonas sp. S17]
 gi|332014341|gb|EGI56398.1| signal peptidase II [Sphingomonas sp. S17]
          Length = 168

 Score = 80.8 bits (199), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 29/84 (34%), Positives = 42/84 (50%), Gaps = 3/84 (3%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           SN S   LV++   I   + F   +      +  +    +  GALGN+VD    GYV+D+
Sbjct: 64  SNASRWALVAMTGAIAVAVAFWMTRERS--PVDQMALGCVLGGALGNIVDRVRLGYVVDF 121

Query: 63  IMIHTQTWS-FAVFNLADLFISIG 85
             +H   W  F VFN+AD  I+IG
Sbjct: 122 ADLHFGEWRPFLVFNVADAAITIG 145


>gi|239906854|ref|YP_002953595.1| lipoprotein signal peptidase [Desulfovibrio magneticus RS-1]
 gi|239796720|dbj|BAH75709.1| lipoprotein signal peptidase [Desulfovibrio magneticus RS-1]
          Length = 163

 Score = 80.8 bits (199), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 45/94 (47%)

Query: 5   VSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIM 64
                  +   L +  IF + +       +   G  LI  GA+GN++D    G V+D++ 
Sbjct: 65  WQTYFFFAATALAVLIIFHLLRMARDDDKLLITGLGLILGGAVGNLIDRIKTGEVVDFLD 124

Query: 65  IHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
            + +T+ +  FN+AD+ I +G+  +++    L+ 
Sbjct: 125 FYWKTFHWPAFNVADIAIFLGSLGLVFAFYRLRR 158


>gi|320160389|ref|YP_004173613.1| lipoprotein signal peptidase [Anaerolinea thermophila UNI-1]
 gi|319994242|dbj|BAJ63013.1| lipoprotein signal peptidase [Anaerolinea thermophila UNI-1]
          Length = 138

 Score = 80.8 bits (199), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 44/96 (45%), Gaps = 5/96 (5%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           +         + + IL+  FI   + + P       +   L   GALGN++D    G+V 
Sbjct: 26  LFQGKGDW-FIFLAILVAVFIVLYYPRVPDQDWSLRLAMSLQLGGALGNMIDRLKQGFVT 84

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIIL 96
           D+I + T    F VFN+AD  I+IG  I++    + 
Sbjct: 85  DFISVGT----FPVFNIADSSITIGVIILLLGVYLQ 116


>gi|83859477|ref|ZP_00952998.1| Putative lipoprotein signal peptidase [Oceanicaulis alexandrii
           HTCC2633]
 gi|83852924|gb|EAP90777.1| Putative lipoprotein signal peptidase [Oceanicaulis alexandrii
           HTCC2633]
          Length = 166

 Score = 80.8 bits (199), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 25/97 (25%), Positives = 47/97 (48%), Gaps = 3/97 (3%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S     +L  + + I   +     +   T+ +  + + LI  GA+GNV+D  +YG V+D+
Sbjct: 73  SPAQRYLLAGVSLAIAGMLVVWMFQT--TRRLQALAFGLIIGGAIGNVIDRFIYGAVVDF 130

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
                  +   VFN+AD  I +G  +++ D ++   R
Sbjct: 131 FDFS-GLYFPYVFNVADAGICVGVAVMVLDLVLNGDR 166


>gi|269468954|gb|EEZ80535.1| lipoprotein signal peptidase [uncultured SUP05 cluster bacterium]
          Length = 145

 Score = 80.4 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 27/94 (28%), Positives = 49/94 (52%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                 L ++ I+I   I     +      +      ++  GA+GN++D    G+V+D+I
Sbjct: 52  GWQRYFLPAVSIIISTAIAIWMMRINIKHVLKLSALSILLAGAVGNLIDRVWQGFVLDFI 111

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQ 97
            +H QT+ + VFN+AD+ IS+G  ++I+ DI   
Sbjct: 112 DLHYQTFYWPVFNVADILISLGVVLLIFSDIKKS 145


>gi|269798296|ref|YP_003312196.1| lipoprotein signal peptidase [Veillonella parvula DSM 2008]
 gi|269094925|gb|ACZ24916.1| lipoprotein signal peptidase [Veillonella parvula DSM 2008]
          Length = 146

 Score = 80.4 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 27/101 (26%), Positives = 50/101 (49%), Gaps = 5/101 (4%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           ML+N      + + I+++A   F WK+  K      IG  L+ +GA+GN +D  +   V+
Sbjct: 51  MLAN-QRWFFLLVAIILLAVCAFYWKRLAKGHWTLQIGSALLVSGAIGNGIDRYMIHGVV 109

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
           D+         + +FN+AD+ I IG   +++    L+   +
Sbjct: 110 DFFDFRI----WPIFNVADIGICIGVAFVVFYLFTLKEDHE 146


>gi|313892875|ref|ZP_07826452.1| signal peptidase II [Veillonella sp. oral taxon 158 str. F0412]
 gi|313442228|gb|EFR60643.1| signal peptidase II [Veillonella sp. oral taxon 158 str. F0412]
          Length = 146

 Score = 80.4 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 23/101 (22%), Positives = 48/101 (47%), Gaps = 5/101 (4%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           ML+N      + + ++++    + WK   K      IG  L+ +GA+GN +D  +   V+
Sbjct: 51  MLAN-QRWFFLLVAVILLGVCVYYWKYLSKGPWTLQIGSALLVSGAIGNGIDRYMIHGVV 109

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
           D+         + +FN+AD+ I +G   ++Y    ++   +
Sbjct: 110 DFFDFRV----WPIFNIADIGICVGVAFVVYHLFTVKEDHE 146


>gi|317131688|ref|YP_004091002.1| lipoprotein signal peptidase [Ethanoligenens harbinense YUAN-3]
 gi|315469667|gb|ADU26271.1| lipoprotein signal peptidase [Ethanoligenens harbinense YUAN-3]
          Length = 175

 Score = 80.4 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 20/95 (21%), Positives = 45/95 (47%), Gaps = 2/95 (2%)

Query: 5   VSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIM 64
               +L    I+++    ++         + ++   LI  G +GN++D    G V+D++ 
Sbjct: 80  FGRWLLAGFTIVLVGVCIWVLFAGKLRGWLGNLALTLIIAGGIGNLIDRLTTGEVVDFLY 139

Query: 65  IHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
           +      FA+FN+AD F+ +G  ++    ++ + R
Sbjct: 140 VKI--IHFAIFNVADSFVVVGAVLLCLCFLLQEKR 172


>gi|240167931|ref|ZP_04746590.1| lipoprotein signal peptidase [Mycobacterium kansasii ATCC 12478]
          Length = 178

 Score = 80.4 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 22/95 (23%), Positives = 46/95 (48%), Gaps = 12/95 (12%)

Query: 7   PTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCL------YGYVI 60
             +L  I   ++  IF++ ++       + +G  +I  GA+GN+VD          G+V+
Sbjct: 56  TWVLTLIATGVVVGIFWMGRRL--VSPWWALGLGMILGGAMGNLVDRFFRAPGPLRGHVV 113

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDII 95
           D++ +      + VFN+AD  +  G  +++   I+
Sbjct: 114 DFLSVGW----WPVFNVADPSVVGGAILLVVLSIL 144


>gi|297621959|ref|YP_003710096.1| putative lipoprotein signal peptidase LspA [Waddlia chondrophila
           WSU 86-1044]
 gi|297377260|gb|ADI39090.1| putative lipoprotein signal peptidase LspA [Waddlia chondrophila
           WSU 86-1044]
          Length = 187

 Score = 80.4 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 28/91 (30%), Positives = 47/91 (51%), Gaps = 2/91 (2%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           M SN    +L+   +LI+    ++   N     I  + ++ +  GA GNV+D+ +YG+V+
Sbjct: 85  MFSNFQVPLLILRVVLIMGLCLYLILFNKNKSLI--LPFLCVIAGAAGNVIDYFIYGHVV 142

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIY 91
           D        + + VFN+AD FI IG   +I 
Sbjct: 143 DMFHFVLWGYDYPVFNIADAFICIGMAFLIL 173


>gi|306829291|ref|ZP_07462481.1| signal peptidase II [Streptococcus mitis ATCC 6249]
 gi|304428377|gb|EFM31467.1| signal peptidase II [Streptococcus mitis ATCC 6249]
          Length = 153

 Score = 80.4 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 24/97 (24%), Positives = 47/97 (48%), Gaps = 3/97 (3%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           ML +        I ++++A   +   K+ +       G  LI  G LGN +D    G+V+
Sbjct: 56  MLQD-QQWFFAIITLVVMAGALWYLHKHMEDSLWMVFGLTLIIAGGLGNFIDRMSQGFVV 114

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQ 97
           D    H    +FA+FN+AD ++++G  +++   +  +
Sbjct: 115 DM--FHLDFINFAIFNVADSYLTVGVIVLLIAMLKEE 149


>gi|167745609|ref|ZP_02417736.1| hypothetical protein ANACAC_00301 [Anaerostipes caccae DSM 14662]
 gi|167654921|gb|EDR99050.1| hypothetical protein ANACAC_00301 [Anaerostipes caccae DSM 14662]
          Length = 164

 Score = 80.4 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 23/96 (23%), Positives = 49/96 (51%), Gaps = 4/96 (4%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSI--FDIGYILITTGALGNVVDHCLYGYVIDYI 63
              +   I +L +A + F + K P  K        Y+ +  GA+GN++D    GYV+D+ 
Sbjct: 59  QQWLFFVITVLAVALLTFAYSKLPDEKKYRPLRFCYVFLCAGAVGNLIDRIFRGYVVDF- 117

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
             + +  +F VFN+AD+++++   ++ +  ++    
Sbjct: 118 -FYFKPINFPVFNVADIYVTVSMAVLFFLILVYYKE 152


>gi|25028589|ref|NP_738643.1| putative lipoprotein signal peptidase [Corynebacterium efficiens
           YS-314]
 gi|23493874|dbj|BAC18843.1| putative lipoprotein signal peptidase [Corynebacterium efficiens
           YS-314]
          Length = 197

 Score = 80.4 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 27/109 (24%), Positives = 45/109 (41%), Gaps = 12/109 (11%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYG------YV 59
           S  +  +I+I+ +  I     +         +G  L+  GALGN++D           +V
Sbjct: 86  STWLFTTIQIVFVVGILIYAPRVR--HRWVGVGLALVAGGALGNLIDRLFREPSFFLGHV 143

Query: 60  IDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDFPQ 108
           +DYI +     SFAVFN+AD  I+ G  + +    +            Q
Sbjct: 144 VDYISVG----SFAVFNIADASITTGVVVFVIGIFMEDRDSSHTERAAQ 188


>gi|254821466|ref|ZP_05226467.1| lipoprotein signal peptidase [Mycobacterium intracellulare ATCC
           13950]
          Length = 189

 Score = 80.4 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 23/95 (24%), Positives = 45/95 (47%), Gaps = 12/95 (12%)

Query: 7   PTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCL------YGYVI 60
             +L  I   ++  IF++ ++       + +G  LI  GA+GN+VD          G+V+
Sbjct: 79  TWMLTLIATGVVVGIFWMGRRL--VSPWWAVGLGLILGGAMGNLVDRFFRAPGPLRGHVV 136

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDII 95
           D++ +      + VFN+AD  +  G  +++   I 
Sbjct: 137 DFLSVGW----WPVFNVADPSVVGGAILLVVLSIF 167


>gi|320531631|ref|ZP_08032573.1| signal peptidase II [Actinomyces sp. oral taxon 171 str. F0337]
 gi|320136160|gb|EFW28166.1| signal peptidase II [Actinomyces sp. oral taxon 171 str. F0337]
          Length = 267

 Score = 80.4 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 21/99 (21%), Positives = 39/99 (39%), Gaps = 12/99 (12%)

Query: 2   LSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYG---- 57
            +     +   I  L++  I  + +          +   L+  GA+GN++D  L      
Sbjct: 113 FATGQTWVFALIASLVVVIIIRVSRNLASRSW--AVALGLVLGGAVGNLIDRLLREPGFL 170

Query: 58  --YVIDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDI 94
             +VID+I      +   V N+AD+ I +    II   +
Sbjct: 171 RGHVIDFID--YGGY--FVGNVADIAIVLAAAGIIILSL 205


>gi|33867186|ref|NP_898744.1| putative lipoprotein signal peptidase [Rhodococcus erythropolis]
 gi|77454712|ref|YP_345580.1| putative signal peptidase II [Rhodococcus erythropolis PR4]
 gi|33669020|gb|AAP74014.1| putative lipoprotein signal peptidase [Rhodococcus erythropolis]
 gi|77019712|dbj|BAE46088.1| putative signal peptidase II [Rhodococcus erythropolis PR4]
          Length = 174

 Score = 80.4 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 23/96 (23%), Positives = 42/96 (43%), Gaps = 5/96 (5%)

Query: 3   SNVSPTILVSIRILIIAFI-FFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVID 61
             +   I++++   I   +  + W+  P    +  +G+  I  GA  NV+D  + G V D
Sbjct: 68  QQLPAWIILAVTAAITLGVGIYAWRTVPTASLVGTVGWSAILAGAAANVIDRAVDGKVTD 127

Query: 62  YIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQ 97
           Y         +  FNLAD +I+ G  +++   I   
Sbjct: 128 YFHTGW----WPTFNLADTYITCGVVLLVASLIFES 159


>gi|330977512|gb|EGH77458.1| lipoprotein signal peptidase [Pseudomonas syringae pv. aptata str.
           DSM 50252]
          Length = 149

 Score = 80.4 bits (198), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 25/85 (29%), Positives = 45/85 (52%), Gaps = 1/85 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +     +   I +++ A +    K+  +  +   +   L+  GALGN+ D  + G+VID+
Sbjct: 65  AGWQRWLFALIAVVVSAVLVVWLKRLGRDDTWLAVALALVLGGALGNLYDRIVLGHVIDF 124

Query: 63  IMIHTQT-WSFAVFNLADLFISIGT 86
           I++H Q  W F  FN+AD  I++G 
Sbjct: 125 ILVHWQNRWYFPAFNVADSAITVGA 149


>gi|209525440|ref|ZP_03273980.1| lipoprotein signal peptidase [Arthrospira maxima CS-328]
 gi|209494120|gb|EDZ94435.1| lipoprotein signal peptidase [Arthrospira maxima CS-328]
          Length = 158

 Score = 80.4 bits (198), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 27/94 (28%), Positives = 44/94 (46%), Gaps = 2/94 (2%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           + SN     L  + +L+   +       P+  S    GY LI  GALGN +D  + G+V+
Sbjct: 61  LFSNGGVYWLRWLSLLVSLGLMLWAWFGPRLISWEQWGYGLILGGALGNGIDRFVSGHVV 120

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDI 94
           D+         F VFN+AD+ I++G   ++    
Sbjct: 121 DFFDFRL--IQFPVFNVADISINVGIICLLIAAF 152


>gi|51473596|ref|YP_067353.1| lipoprotein signal peptidase [Rickettsia typhi str. Wilmington]
 gi|81826311|sp|Q68WX1|LSPA_RICTY RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|51459908|gb|AAU03871.1| Bacterial leader peptidase I [Rickettsia typhi str. Wilmington]
          Length = 196

 Score = 80.4 bits (198), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 30/94 (31%), Positives = 51/94 (54%), Gaps = 2/94 (2%)

Query: 5   VSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIM 64
            S  I +   ++I+ +++ +   +    S   +GY  +  GA+GN++D    G V D+I 
Sbjct: 72  YSNAIFLITNMIIVCYLYHLMICSKTIGSF--VGYNFVIGGAIGNLIDRFCRGAVFDFIH 129

Query: 65  IHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
            H + +SF VFNLAD FI++G  I+I D    + 
Sbjct: 130 FHYRNYSFPVFNLADCFITLGVIILIEDYFSTKK 163


>gi|71908237|ref|YP_285824.1| signal peptidase II [Dechloromonas aromatica RCB]
 gi|71847858|gb|AAZ47354.1| signal peptidase II, Aspartic peptidase, MEROPS family A08
           [Dechloromonas aromatica RCB]
          Length = 111

 Score = 80.4 bits (198), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 21/71 (29%), Positives = 37/71 (52%)

Query: 32  KSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQTWSFAVFNLADLFISIGTCIIIY 91
                  Y L+  GA+GN+VD  + G V+DY+  H   W ++ FNLAD  + +   I+++
Sbjct: 8   NRWQGWEYSLLLGGAVGNLVDRLVQGAVVDYLDFHAGGWHWSAFNLADTALCLSALILLW 67

Query: 92  DDIILQHRQKG 102
             ++   + K 
Sbjct: 68  GTLLSSAQSKA 78


>gi|187251550|ref|YP_001876032.1| lipoprotein signal peptidase [Elusimicrobium minutum Pei191]
 gi|186971710|gb|ACC98695.1| Lipoprotein signal peptidase [Elusimicrobium minutum Pei191]
          Length = 165

 Score = 80.4 bits (198), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 25/100 (25%), Positives = 46/100 (46%), Gaps = 4/100 (4%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           +  N +  + V +  +II  +    +       +  +G   I  GA+GN+ D    GYV+
Sbjct: 66  LFQNANLALAVMMCAVIIFLLVSWREIEKLRPPLGWLGLSFILGGAIGNLYDRIFLGYVV 125

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
           D+I +      + VFN+AD FI IG  ++    +    ++
Sbjct: 126 DFIDLRV----WPVFNIADSFICIGAVLLAAAMLFPGKKE 161


>gi|270292964|ref|ZP_06199175.1| signal peptidase II [Streptococcus sp. M143]
 gi|270278943|gb|EFA24789.1| signal peptidase II [Streptococcus sp. M143]
          Length = 153

 Score = 80.4 bits (198), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 23/97 (23%), Positives = 47/97 (48%), Gaps = 3/97 (3%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           ML +    +   I ++++    +   K+ +       G  LI  G LGN +D    G+V+
Sbjct: 56  MLQD-QQWLFAVITLVVMVGAIWYLHKHMEDSLWLVFGLTLIIAGGLGNFIDRMSQGFVV 114

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQ 97
           D    H    +FA+FN+AD ++++G  +++   +  +
Sbjct: 115 DM--FHLDFINFAIFNVADSYLTVGVIVLLIAMLKEE 149


>gi|282850534|ref|ZP_06259913.1| signal peptidase II [Veillonella parvula ATCC 17745]
 gi|282580027|gb|EFB85431.1| signal peptidase II [Veillonella parvula ATCC 17745]
          Length = 146

 Score = 80.0 bits (197), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 26/101 (25%), Positives = 48/101 (47%), Gaps = 5/101 (4%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           ML+N      + +  +++A   F WK+  K      IG  L+  GA+GN +D  +   V+
Sbjct: 51  MLAN-QRWFFLLVAFVLLAVCAFYWKRLAKGHWTLQIGSALLVAGAIGNGIDRYMIHGVV 109

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
           D+         + +FN+AD+ I IG   +++    L+   +
Sbjct: 110 DFFDFRV----WPIFNVADIGICIGVAFVVFYLFSLKEDHE 146


>gi|198282847|ref|YP_002219168.1| lipoprotein signal peptidase [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|218665135|ref|YP_002425047.1| signal peptidase II [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|198247368|gb|ACH82961.1| lipoprotein signal peptidase [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|218517348|gb|ACK77934.1| signal peptidase II [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 152

 Score = 80.0 bits (197), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 29/93 (31%), Positives = 47/93 (50%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                +L+ + +L++  I  I ++     +   I   LI  GA+GN++D    GYVID+I
Sbjct: 59  GWQRWLLIGVALLVVVVIVAILRRLKPGATWTAISLALILGGAVGNLIDRIRLGYVIDFI 118

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIIL 96
             H  +  +  FN+AD  ISIG  I++ D    
Sbjct: 119 GAHWGSLYWPYFNIADSAISIGAVILVLDAFRR 151


>gi|58698561|ref|ZP_00373461.1| lipoprotein signal peptidase [Wolbachia endosymbiont of Drosophila
           ananassae]
 gi|58534913|gb|EAL59012.1| lipoprotein signal peptidase [Wolbachia endosymbiont of Drosophila
           ananassae]
          Length = 117

 Score = 80.0 bits (197), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 30/92 (32%), Positives = 45/92 (48%), Gaps = 2/92 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
                 +  ILII  + ++  K+    +   +G+ L+  GA+GNVVD   +G V D+I  
Sbjct: 19  GGFFFSAFSILIIGILAYLIYKSDDQSTY--LGFSLMIGGAIGNVVDRIYWGAVYDFIYF 76

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQ 97
           H   W +  FNLADL I  G   ++Y   I  
Sbjct: 77  HIDDWYWPAFNLADLSIVCGMFTLLYKWYIYD 108


>gi|325694605|gb|EGD36514.1| signal peptidase II [Streptococcus sanguinis SK150]
          Length = 155

 Score = 80.0 bits (197), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 21/98 (21%), Positives = 41/98 (41%), Gaps = 2/98 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
              +   +  L+I    +   K+         G  L+  G LGN +D    G+V+D   +
Sbjct: 60  QQWLFTLVTFLVIGGAVYYLIKHLHASKWMLAGLTLVIAGGLGNFIDRIRQGFVVDMFQL 119

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
                 FA+FN+AD++++ G  I++   +  +      
Sbjct: 120 DFIN--FAIFNVADMYLTFGVAILLLMILKEEKDGSKN 155


>gi|239623976|ref|ZP_04667007.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47_FAA]
 gi|239522007|gb|EEQ61873.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47FAA]
          Length = 170

 Score = 80.0 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 17/94 (18%), Positives = 48/94 (51%), Gaps = 4/94 (4%)

Query: 9   ILVSIRILIIAFIFFIWKKNPKTKSI--FDIGYILITTGALGNVVDHCLYGYVIDYIMIH 66
               I + ++  + ++  + P  +      +  ++++ GA+GN++D    GYV+D++  +
Sbjct: 68  FFFLIALAVLGAVAYLMLRMPTDRRYRPLSVCLMMVSAGAVGNMIDRVTQGYVVDFL--Y 125

Query: 67  TQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
            +  +F +FN+AD +++I    ++   +     +
Sbjct: 126 FKLINFPIFNVADCYVTIAAACLVLLIMFYYKDE 159


>gi|103487837|ref|YP_617398.1| lipoprotein signal peptidase [Sphingopyxis alaskensis RB2256]
 gi|122984826|sp|Q1GQK7|LSPA_SPHAL RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|98977914|gb|ABF54065.1| signal peptidase II. Aspartic peptidase. MEROPS family A08
           [Sphingopyxis alaskensis RB2256]
          Length = 173

 Score = 80.0 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 47/89 (52%), Gaps = 6/89 (6%)

Query: 1   MLS---NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYG 57
           M +   + +   LV++  ++ A + F   +      +  I   LI  GALGN+VD   +G
Sbjct: 62  MFASCTDTTRWTLVAVTGIVAAAVAFWMTREQAKGDV--IALALILGGALGNIVDRVRFG 119

Query: 58  YVIDYIMIHTQTWS-FAVFNLADLFISIG 85
           YV+D+  +H   +  F +FN+AD  I+IG
Sbjct: 120 YVVDFADLHIGDFRPFMIFNVADACITIG 148


>gi|317490446|ref|ZP_07948928.1| signal peptidase II [Eggerthella sp. 1_3_56FAA]
 gi|325831524|ref|ZP_08164778.1| signal peptidase II [Eggerthella sp. HGA1]
 gi|316910439|gb|EFV32066.1| signal peptidase II [Eggerthella sp. 1_3_56FAA]
 gi|325486778|gb|EGC89226.1| signal peptidase II [Eggerthella sp. HGA1]
          Length = 233

 Score = 80.0 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 23/101 (22%), Positives = 46/101 (45%), Gaps = 4/101 (3%)

Query: 1   MLSNVSPTILVSIRILIIAFI-FFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYV 59
           M    S  +L  + +++   +  +++    +   +  +G  L+  G LGN  D    GYV
Sbjct: 116 MF-GDSTFLLGVMSLIVCVLLTVYLFFLAYRPNIVQVVGAALVVAGGLGNAFDRFALGYV 174

Query: 60  IDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
           +D+I        F VFN+AD+ ++ G  + +   I+    +
Sbjct: 175 VDFIEPVF--IDFPVFNVADIGVTCGFVLFLVGVIVSWRHE 213


>gi|330813623|ref|YP_004357862.1| lipoprotein signal peptidase [Candidatus Pelagibacter sp. IMCC9063]
 gi|327486718|gb|AEA81123.1| lipoprotein signal peptidase [Candidatus Pelagibacter sp. IMCC9063]
          Length = 162

 Score = 80.0 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 27/90 (30%), Positives = 46/90 (51%), Gaps = 2/90 (2%)

Query: 10  LVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQT 69
              +  L+I F+     +    +    I   LI  GALGN  D  +Y  V D+I +H   
Sbjct: 75  FSFLIFLVIIFLIVWLFR--SNRKFEKISIALIIGGALGNWFDRIVYNAVPDFIDLHYLD 132

Query: 70  WSFAVFNLADLFISIGTCIIIYDDIILQHR 99
           + + VFN++D+ IS+G  ++I  D  L+++
Sbjct: 133 FHWFVFNVSDIIISVGILLLILSDFFLKNK 162


>gi|328946168|gb|EGG40313.1| signal peptidase II [Streptococcus sanguinis SK1087]
          Length = 155

 Score = 80.0 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 21/98 (21%), Positives = 41/98 (41%), Gaps = 2/98 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
              +   +  L+I    +   K+         G  L+  G LGN +D    G+V+D   +
Sbjct: 60  QQWLFTLVTFLVIGGAVYYLIKHLNASKWMLAGLTLVIAGGLGNFIDRIRQGFVVDMFQL 119

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
                 FA+FN+AD++++ G  I++   +  +      
Sbjct: 120 DFIN--FAIFNVADMYLTFGVAILLLMILKEEKDGSKN 155


>gi|15827610|ref|NP_301873.1| lipoprotein signal peptidase [Mycobacterium leprae TN]
 gi|221230087|ref|YP_002503503.1| lipoprotein signal peptidase [Mycobacterium leprae Br4923]
 gi|32171516|sp|Q9X7E7|LSPA_MYCLE RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|254810451|sp|B8ZR76|LSPA_MYCLB RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|4539133|emb|CAB39579.1| putative lipoprotein signal peptidase [Mycobacterium leprae]
 gi|13093161|emb|CAC31580.1| lipoprotein signal peptidase [Mycobacterium leprae]
 gi|219933194|emb|CAR71294.1| lipoprotein signal peptidase [Mycobacterium leprae Br4923]
          Length = 201

 Score = 80.0 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 23/95 (24%), Positives = 47/95 (49%), Gaps = 12/95 (12%)

Query: 7   PTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCL------YGYVI 60
             +L  I   ++  IF++ ++   +   + +G  +I  GA+GN+VD          G+V+
Sbjct: 88  TWVLTLIATGVVIGIFWMGRRLVSS--WWALGLGMILGGAMGNLVDRFFRAPAPLRGHVV 145

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDII 95
           D++ I      + VFN+AD  + +G  +++   I 
Sbjct: 146 DFLSIGW----WPVFNVADPSVVVGAILLVVLSIF 176


>gi|85717168|ref|ZP_01048126.1| peptidase A8, signal peptidase II [Nitrobacter sp. Nb-311A]
 gi|85696001|gb|EAQ33901.1| peptidase A8, signal peptidase II [Nitrobacter sp. Nb-311A]
          Length = 173

 Score = 80.0 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 45/89 (50%), Gaps = 4/89 (4%)

Query: 18  IAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHT----QTWSFA 73
           +A +            +  IG  LI  GA+GN +D  +YG V+D+ + H     +T+S+ 
Sbjct: 84  VAVVLLAIWMARSHSRMATIGLGLIIGGAIGNAIDRFVYGAVMDFALFHVQFAGKTYSWY 143

Query: 74  VFNLADLFISIGTCIIIYDDIILQHRQKG 102
           VFNLAD+ I +G   ++YD  +     K 
Sbjct: 144 VFNLADVAIVVGVIALLYDSFLGTSAAKA 172


>gi|39937436|ref|NP_949712.1| lipoprotein signal peptidase [Rhodopseudomonas palustris CGA009]
 gi|39651295|emb|CAE29817.1| Signal peptidase II, family A8 [Rhodopseudomonas palustris CGA009]
          Length = 182

 Score = 80.0 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 30/106 (28%), Positives = 52/106 (49%), Gaps = 5/106 (4%)

Query: 2   LSNVSPT-ILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
            S   PT  ++ +    +A +         T  +  IG  LI  GA+GN +D   YG V+
Sbjct: 76  FSGQGPTGQILMLAFKAVAIVALAIWMARSTTKLATIGLGLIIGGAIGNAIDRLAYGAVV 135

Query: 61  DYIMIHT----QTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           D+ ++H     + +++ VFN+AD+ I +G   ++YD +I     K 
Sbjct: 136 DFALLHAEIGGKIYNWYVFNIADVAIVVGVAALLYDSLIGLPAAKA 181


>gi|229552261|ref|ZP_04440986.1| signal peptidase II [Lactobacillus rhamnosus LMS2-1]
 gi|229314397|gb|EEN80370.1| signal peptidase II [Lactobacillus rhamnosus LMS2-1]
          Length = 183

 Score = 79.7 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 25/101 (24%), Positives = 44/101 (43%), Gaps = 4/101 (3%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           M             IL    +  +  ++   K  + +G  LIT GA+GN +D   + YV 
Sbjct: 81  MFEGKQ-WFFYVTTILAFVVVA-MLWRDSLHKPFYRMGLTLITAGAIGNFIDRLRFRYVT 138

Query: 61  DYIMIHTQT-WSF-AVFNLADLFISIGTCIIIYDDIILQHR 99
           D   +     W F A+FN AD+ I++G   ++   +  + +
Sbjct: 139 DMFHLEFLDQWRFNAIFNFADVCITLGVVFVLIYILFDRDK 179


>gi|239820868|ref|YP_002948053.1| lipoprotein signal peptidase [Variovorax paradoxus S110]
 gi|239805721|gb|ACS22787.1| lipoprotein signal peptidase [Variovorax paradoxus S110]
          Length = 174

 Score = 79.7 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 50/97 (51%), Gaps = 2/97 (2%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S     +  ++ I   AFIF +  + P    +F     L+  GALGN +D    G+V+D+
Sbjct: 77  SGWQRWLFTALAIAAAAFIFKLLVQ-PGGTPLFRAALALVLGGALGNAIDRSWQGHVVDF 135

Query: 63  IMIHTQT-WSFAVFNLADLFISIGTCIIIYDDIILQH 98
           I +H +  + FA+FN+AD  I+ G  +++  +I    
Sbjct: 136 IHLHWREVYDFAIFNVADCAITAGAALLVLAEIRRSR 172


>gi|330444225|ref|YP_004377211.1| lipoprotein signal peptidase [Chlamydophila pecorum E58]
 gi|328807335|gb|AEB41508.1| lipoprotein signal peptidase [Chlamydophila pecorum E58]
          Length = 166

 Score = 79.7 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 29/104 (27%), Positives = 59/104 (56%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           + +N    +L+    +I+  + +++ K     S+     IL+ +GA+GNV D   YG+VI
Sbjct: 63  LFTNYKKFLLIFRLCVIVGILAYLFFKRKSLSSLTRFALILLCSGAIGNVGDIFFYGHVI 122

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
           D++    ++++F  FN +D+FIS+GT +++Y     + ++   I
Sbjct: 123 DFLAFSYRSFAFPTFNFSDVFISLGTLLLVYKLYFPKKQKTNSI 166


>gi|325687370|gb|EGD29391.1| signal peptidase II [Streptococcus sanguinis SK72]
 gi|332360723|gb|EGJ38532.1| signal peptidase II [Streptococcus sanguinis SK49]
          Length = 155

 Score = 79.7 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 24/103 (23%), Positives = 44/103 (42%), Gaps = 3/103 (2%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           ML N    +   +  L+I    +   K+         G  L+  G LGN +D    G+V+
Sbjct: 56  MLEN-QQWLFTLVTFLVIGGAVYYLVKHLHASKWMLAGLTLVIAGGLGNFIDRIRQGFVV 114

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
           D   +      FA+FN+AD++++ G  I++   +  +      
Sbjct: 115 DMFQLDFIN--FAIFNVADMYLTFGVAILLLMILKEEKDGSKN 155


>gi|37519641|ref|NP_923018.1| lipoprotein signal peptidase [Gloeobacter violaceus PCC 7421]
 gi|81834507|sp|Q7NPI3|LSPA_GLOVI RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|35210632|dbj|BAC88013.1| lipoprotein signal peptidase [Gloeobacter violaceus PCC 7421]
          Length = 173

 Score = 79.7 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 25/99 (25%), Positives = 44/99 (44%), Gaps = 3/99 (3%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           + +  S   L  I +L+   +       P   S   +G+ L+  GA+GN  D   +G V 
Sbjct: 57  LFAGGSDW-LKWISLLVSVGLCVYALVGPHLGSWEQMGFGLLLGGAVGNGFDRFAFGEVT 115

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
           D++        F VFN AD+ I++G   ++   +  + R
Sbjct: 116 DFLDFRL--IQFPVFNGADIAINLGLACLLIGTLRSESR 152


>gi|119485620|ref|ZP_01619895.1| signal peptidase II [Lyngbya sp. PCC 8106]
 gi|119456945|gb|EAW38072.1| signal peptidase II [Lyngbya sp. PCC 8106]
          Length = 169

 Score = 79.7 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 28/98 (28%), Positives = 48/98 (48%), Gaps = 2/98 (2%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           + SN   + L  + + +   +  +    P+       GY LI  GALGN +D  + G+V+
Sbjct: 61  LFSNGGVSWLRWLSLGVSLGLMALAWWGPQFIRWEQTGYGLILGGALGNGIDRFISGHVV 120

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
           D++        F +FNLAD+ I+IG   ++    I +H
Sbjct: 121 DFLDFRL--IQFPIFNLADVSINIGIICLLIAMFIHEH 156


>gi|256850424|ref|ZP_05555852.1| lipoprotein signal peptidase A [Lactobacillus crispatus MV-1A-US]
 gi|262046427|ref|ZP_06019389.1| signal peptidase (SPase) II [Lactobacillus crispatus MV-3A-US]
 gi|256712821|gb|EEU27814.1| lipoprotein signal peptidase A [Lactobacillus crispatus MV-1A-US]
 gi|260573298|gb|EEX29856.1| signal peptidase (SPase) II [Lactobacillus crispatus MV-3A-US]
          Length = 154

 Score = 79.7 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 23/96 (23%), Positives = 45/96 (46%), Gaps = 2/96 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
              +   I I+ I    +         ++FD+G  LI  G +GN +D     YV+D + +
Sbjct: 58  QMWLFYIISIIAIGVCLYFLFNKKYKNTLFDVGLALILGGIVGNFIDRLHLKYVVDMLQL 117

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
                 F +FN+AD  I++G  ++    I ++ +++
Sbjct: 118 DFV--HFNIFNIADSAITVGVILVFIYLIFIEGKEE 151


>gi|254437286|ref|ZP_05050780.1| signal peptidase II [Octadecabacter antarcticus 307]
 gi|198252732|gb|EDY77046.1| signal peptidase II [Octadecabacter antarcticus 307]
          Length = 167

 Score = 79.7 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 25/102 (24%), Positives = 47/102 (46%), Gaps = 3/102 (2%)

Query: 1   MLSNVS-PTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYV 59
           + +      IL+ +   I  F+ +  +++P  +    I   L+  GALGNV+D  LYG V
Sbjct: 65  LFAGYDLRWILIVVAFAICGFVIWWLRRDPPGRWGM-ISAGLLIGGALGNVIDRVLYGAV 123

Query: 60  IDYIMIHTQTWSFA-VFNLADLFISIGTCIIIYDDIILQHRQ 100
            D++ +     +    FN+AD+ I  G   ++        ++
Sbjct: 124 ADFLNMSCCGINNPFAFNVADISIFAGAIGLVLFTDGDDKKK 165


>gi|167771409|ref|ZP_02443462.1| hypothetical protein ANACOL_02775 [Anaerotruncus colihominis DSM
           17241]
 gi|167666049|gb|EDS10179.1| hypothetical protein ANACOL_02775 [Anaerotruncus colihominis DSM
           17241]
          Length = 165

 Score = 79.7 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 25/95 (26%), Positives = 44/95 (46%), Gaps = 1/95 (1%)

Query: 9   ILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQ 68
           +L    + +I     +  +      +      LI  G +GN++D     +V+DYI I   
Sbjct: 62  LLSLFTLAVIVVALILLIRGRLRHPLLMWSVGLIIAGGVGNLIDRVFRSFVVDYIDIS-P 120

Query: 69  TWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
            +SF VFN AD  + IGT ++    +++  R+K  
Sbjct: 121 LFSFPVFNFADCCVVIGTAMLAVYMLLIDGRKKPN 155


>gi|256825467|ref|YP_003149427.1| lipoprotein signal peptidase [Kytococcus sedentarius DSM 20547]
 gi|256688860|gb|ACV06662.1| lipoprotein signal peptidase [Kytococcus sedentarius DSM 20547]
          Length = 207

 Score = 79.7 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 18/99 (18%), Positives = 46/99 (46%), Gaps = 12/99 (12%)

Query: 2   LSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYG---- 57
           L   +  +   +  ++   I +  ++       + +   LI  GA+GN+VD  +      
Sbjct: 79  LGTSATPVFTVLATVVSLAILWFSRQVIS--PAWGVALGLIAGGAVGNLVDRLVRAPGFA 136

Query: 58  --YVIDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDI 94
             +V+D++ +     ++ VFN+AD+ ++ G  +++   +
Sbjct: 137 RGHVVDFLALP----NWPVFNVADIGVTCGAALVVLLAL 171


>gi|257056704|ref|YP_003134536.1| lipoprotein signal peptidase [Saccharomonospora viridis DSM 43017]
 gi|256586576|gb|ACU97709.1| lipoprotein signal peptidase [Saccharomonospora viridis DSM 43017]
          Length = 207

 Score = 79.7 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 26/100 (26%), Positives = 44/100 (44%), Gaps = 9/100 (9%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLY------GYV 59
              IL  + I ++  I +  +K         +G  L+  GALGN+ D          G+V
Sbjct: 81  GTWILTVVAIAVVVGIAWFARKLRSAGW--AVGLGLVLAGALGNLTDRIFRAPAVFQGHV 138

Query: 60  IDYIM-IHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
           +D+I         F VFN AD  I++G  +I+   ++ + 
Sbjct: 139 VDFISVFAPNGEFFPVFNAADSAITVGAGLIVVLTLLGRD 178


>gi|89067216|ref|ZP_01154729.1| lipoprotein signal peptidase [Oceanicola granulosus HTCC2516]
 gi|89046785|gb|EAR52839.1| lipoprotein signal peptidase [Oceanicola granulosus HTCC2516]
          Length = 167

 Score = 79.7 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 45/95 (47%), Gaps = 3/95 (3%)

Query: 1   MLSNV-SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYV 59
           + S   +  +LV++ ++I AF+     +    +    +   L+  GALGNVVD  LYG V
Sbjct: 55  LFSGFDARWLLVALALVISAFVLIWLHREG-GRRAAYVSAGLLVGGALGNVVDRVLYGAV 113

Query: 60  IDYIMIHTQTWSFA-VFNLADLFISIGTCIIIYDD 93
            D+I +          FN+AD+ +  G   ++   
Sbjct: 114 ADFINMSCCGIDNPYAFNVADVGVFAGAVGLVLFT 148


>gi|324993008|gb|EGC24928.1| signal peptidase II [Streptococcus sanguinis SK405]
 gi|327462304|gb|EGF08631.1| signal peptidase II [Streptococcus sanguinis SK1]
          Length = 155

 Score = 79.7 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 21/98 (21%), Positives = 41/98 (41%), Gaps = 2/98 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
              +   +  L+I    +   K+         G  L+  G LGN +D    G+V+D   +
Sbjct: 60  QQWLFTLVTFLVIGGAVYYLIKHLHASKWMLAGLTLVIAGGLGNFIDRIRQGFVVDMFQL 119

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
                 FA+FN+AD++++ G  I++   +  +      
Sbjct: 120 DFIN--FAIFNVADMYLTFGVAILLLMILKEEKDGSKN 155


>gi|323351669|ref|ZP_08087323.1| signal peptidase II [Streptococcus sanguinis VMC66]
 gi|322122155|gb|EFX93881.1| signal peptidase II [Streptococcus sanguinis VMC66]
 gi|324991251|gb|EGC23185.1| signal peptidase II [Streptococcus sanguinis SK353]
          Length = 155

 Score = 79.7 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 21/98 (21%), Positives = 41/98 (41%), Gaps = 2/98 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
              +   +  L+I    +   K+         G  L+  G LGN +D    G+V+D   +
Sbjct: 60  QQWLFTLVTFLVIGGAVYYLIKHLHASKWMLAGLTLVIAGGLGNFIDRIRQGFVVDMFQL 119

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
                 FA+FN+AD++++ G  I++   +  +      
Sbjct: 120 DFIN--FAIFNVADMYLTFGVAILLLMILKEEKDGSKN 155


>gi|306825453|ref|ZP_07458793.1| signal peptidase II [Streptococcus sp. oral taxon 071 str. 73H25AP]
 gi|304432391|gb|EFM35367.1| signal peptidase II [Streptococcus sp. oral taxon 071 str. 73H25AP]
          Length = 155

 Score = 79.7 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 23/103 (22%), Positives = 46/103 (44%), Gaps = 3/103 (2%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           ML +    +   I ++++    +   K+ +       G  LI  G LGN +D    G+V+
Sbjct: 56  MLQD-QQWLFAVITLVVMVGAIWYLHKHMEDSLCLVFGLTLIIAGGLGNFIDRMSQGFVV 114

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
           D    H    +FA+FN+AD +++ G  +++   +  +      
Sbjct: 115 DM--FHLDFINFAIFNVADSYLTFGVIVLLIAMLKEEVNGNKN 155


>gi|284051153|ref|ZP_06381363.1| lipoprotein signal peptidase [Arthrospira platensis str. Paraca]
 gi|291565828|dbj|BAI88100.1| lipoprotein signal peptidase [Arthrospira platensis NIES-39]
          Length = 158

 Score = 79.7 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 27/94 (28%), Positives = 44/94 (46%), Gaps = 2/94 (2%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           + SN     L  + +L+   +       P+  S    GY LI  GALGN +D  + G+V+
Sbjct: 61  LFSNGGVYWLRWLSLLVSLGLMLWAWFGPRFISWEQWGYGLILGGALGNGIDRFVSGHVV 120

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDI 94
           D+         F VFN+AD+ I++G   ++    
Sbjct: 121 DFFDFRL--IQFPVFNVADISINVGIICLLIAAF 152


>gi|148244744|ref|YP_001219438.1| lipoprotein signal peptidase [Candidatus Vesicomyosocius okutanii
           HA]
 gi|146326571|dbj|BAF61714.1| lipoprotein signal peptidase [Candidatus Vesicomyosocius okutanii
           HA]
          Length = 152

 Score = 79.3 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 27/89 (30%), Positives = 45/89 (50%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S      L  I  +    I     + P       I  +LI +GA+GN++D    G+V+D+
Sbjct: 59  SGWQRYFLSGISAISSVIISIWILRTPLRYKFKLISLVLILSGAIGNMIDRITNGFVVDF 118

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIY 91
           I  H   +++ +FN AD+FIS+G  ++I 
Sbjct: 119 IDFHYSGFNYPIFNFADIFISVGVVVLII 147


>gi|324995684|gb|EGC27596.1| signal peptidase II [Streptococcus sanguinis SK678]
          Length = 155

 Score = 79.3 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 21/98 (21%), Positives = 42/98 (42%), Gaps = 2/98 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
              +   +  L+I    +   K+         G  L+ +G LGN +D    G+V+D   +
Sbjct: 60  QQWLFTLVTFLVIGGAVYYLIKHLHASKWMLAGLTLVISGGLGNFIDRIRQGFVVDMFQL 119

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
                 FA+FN+AD++++ G  I++   +  +      
Sbjct: 120 DFIN--FAIFNVADMYLTFGVAILLLMILKEEKDGSKN 155


>gi|303229351|ref|ZP_07316141.1| signal peptidase II [Veillonella atypica ACS-134-V-Col7a]
 gi|302515887|gb|EFL57839.1| signal peptidase II [Veillonella atypica ACS-134-V-Col7a]
          Length = 146

 Score = 79.3 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 22/96 (22%), Positives = 44/96 (45%), Gaps = 4/96 (4%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
                +++  ++I    F  K+         +G  L+  GA+GN +D  +   V+D+   
Sbjct: 55  QRWFFLAVAFVLIIVYGFYRKRVNNGPLSLRVGTALLIAGAIGNGIDRYVLHGVVDFFDF 114

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
                 + +FN+AD+ I +G   +IY  +  +H +K
Sbjct: 115 RI----WPIFNIADIGICVGVVCVIYYLLTSEHEEK 146


>gi|29839977|ref|NP_829083.1| lipoprotein signal peptidase [Chlamydophila caviae GPIC]
 gi|33301246|sp|Q824E2|LSPA_CHLCV RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|29834324|gb|AAP04961.1| lipoprotein signal peptidase [Chlamydophila caviae GPIC]
          Length = 165

 Score = 79.3 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 30/99 (30%), Positives = 50/99 (50%)

Query: 2   LSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVID 61
            S     +      +I+  + F++ +  +T        IL+ +GA+GNV D   Y +V+D
Sbjct: 65  FSKYKYFLFAIRIAIILGILAFLFLRKKRTSPSIRFSLILLCSGAIGNVGDILFYRHVVD 124

Query: 62  YIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
           +I I  + W F  FN AD+FIS+GT I +Y       ++
Sbjct: 125 FISIGFKRWYFPTFNFADIFISLGTFIFVYKLYFPTKQK 163


>gi|331001806|ref|ZP_08325328.1| signal peptidase II [Lachnospiraceae oral taxon 107 str. F0167]
 gi|330412780|gb|EGG92163.1| signal peptidase II [Lachnospiraceae oral taxon 107 str. F0167]
          Length = 166

 Score = 79.3 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 24/95 (25%), Positives = 52/95 (54%), Gaps = 4/95 (4%)

Query: 9   ILVSIRILIIAFIFFIWKKNPKTKSIFDIGY--ILITTGALGNVVDHCLYGYVIDYIMIH 66
           +   I ++++  I ++  K P  +  + +G+   LI  GALGN +D  +  YV+D+I  +
Sbjct: 68  LFYIITVIVLIGILYLLFKMPYERHYYPLGFCGGLIFAGALGNFIDRVIRNYVVDFI--Y 125

Query: 67  TQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
            +  +F +FN AD+ +++GT ++    + +    +
Sbjct: 126 FKPINFPIFNFADICVTVGTFLLFISLMFVYKENE 160


>gi|296117561|ref|ZP_06836145.1| signal peptidase II [Corynebacterium ammoniagenes DSM 20306]
 gi|295969292|gb|EFG82533.1| signal peptidase II [Corynebacterium ammoniagenes DSM 20306]
          Length = 162

 Score = 79.3 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 28/110 (25%), Positives = 50/110 (45%), Gaps = 12/110 (10%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHC------ 54
           M    S  +  +I++  +  +     K         +G  ++  GALGN+ D        
Sbjct: 51  MGGEGSTWLFTTIQLAFVIGVAIAAPKVK--DRWEAVGLAMLAGGALGNLTDRLAREPGF 108

Query: 55  LYGYVIDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
            +G+V+DYI +     +FAVFN+AD  I++G  + I   +  + R K + 
Sbjct: 109 WFGHVVDYISVG----NFAVFNIADACITVGVIVFILAMLTEERRTKNEQ 154


>gi|332360784|gb|EGJ38591.1| signal peptidase II [Streptococcus sanguinis SK355]
          Length = 155

 Score = 79.3 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 21/98 (21%), Positives = 41/98 (41%), Gaps = 2/98 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
              +   +  L+I    +   K+         G  L+  G LGN +D    G+V+D   +
Sbjct: 60  QQWLFTLVTFLVIGGAVYYLIKHLHASKWMLSGLTLVIAGGLGNFIDRIRQGFVVDMFQL 119

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
                 FA+FN+AD++++ G  I++   +  +      
Sbjct: 120 EFIN--FAIFNVADMYLTFGVAILLLMILKEEKDGSKN 155


>gi|323342855|ref|ZP_08083087.1| signal peptidase II [Erysipelothrix rhusiopathiae ATCC 19414]
 gi|322463967|gb|EFY09161.1| signal peptidase II [Erysipelothrix rhusiopathiae ATCC 19414]
          Length = 153

 Score = 79.3 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 24/103 (23%), Positives = 46/103 (44%), Gaps = 3/103 (2%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           M       + + +   +   + + + K  + K +      L+  GA GN+ D  +YGYV 
Sbjct: 54  MFDG-QKWLFIVLATAVCIVLAYYYVK--EDKPVILTAIALMFAGAFGNLFDRAIYGYVR 110

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
           D    +   + F VFN+AD+ + +G  I+     + +  QK +
Sbjct: 111 DMFAFNIFGYQFPVFNVADMSLVVGVFILAIVLYLDERGQKYE 153


>gi|327470140|gb|EGF15604.1| signal peptidase II [Streptococcus sanguinis SK330]
          Length = 155

 Score = 79.3 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 21/98 (21%), Positives = 41/98 (41%), Gaps = 2/98 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
              +   +  L+I    +   K+         G  L+  G LGN +D    G+V+D   +
Sbjct: 60  QQWLFTLVTFLVIGGAVYYLIKHLNASKWMLAGLTLVIAGGLGNFIDRIRQGFVVDMFQL 119

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
                 FA+FN+AD++++ G  I++   +  +      
Sbjct: 120 DFIN--FAIFNVADMYLTFGVAILLLMILKEEKDGSKN 155


>gi|114329520|gb|AAP49461.2| prolipoprotein signal peptidase [Streptococcus suis]
          Length = 154

 Score = 79.3 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 24/94 (25%), Positives = 41/94 (43%), Gaps = 2/94 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
                  + I+ +  + + + K  K          L+  GALGN +D    GYV+D    
Sbjct: 59  QQWFFTIMTIVAVTGLVWNYIKQIKGNIWTLFSLSLMIAGALGNFIDRLRLGYVVDM--F 116

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
           H    SF VFN+AD+ +++G  I+    +  +  
Sbjct: 117 HLDFISFPVFNVADVCLTVGVGILFICIMKEESN 150


>gi|229824102|ref|ZP_04450171.1| hypothetical protein GCWU000282_01406 [Catonella morbi ATCC 51271]
 gi|229786456|gb|EEP22570.1| hypothetical protein GCWU000282_01406 [Catonella morbi ATCC 51271]
          Length = 223

 Score = 79.3 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 24/83 (28%), Positives = 47/83 (56%), Gaps = 2/83 (2%)

Query: 9   ILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQ 68
           + + I +L +AF  +   +   + +  ++ Y  +  GA+GN++D  L GYV+D + +   
Sbjct: 133 LFIGISLLAVAFFSYKIYRRQASSTWVNLAYACLVGGAVGNLLDRLLNGYVVDMLQLDFV 192

Query: 69  TWSFAVFNLADLFISIGTCIIIY 91
             SF +FNLAD  +++G  I++ 
Sbjct: 193 --SFPIFNLADTALTVGVLILLL 213


>gi|163782159|ref|ZP_02177158.1| lipoprotein signal peptidase [Hydrogenivirga sp. 128-5-R1-1]
 gi|159882691|gb|EDP76196.1| lipoprotein signal peptidase [Hydrogenivirga sp. 128-5-R1-1]
          Length = 156

 Score = 79.3 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 22/98 (22%), Positives = 40/98 (40%), Gaps = 2/98 (2%)

Query: 1   MLSNVSPTILVSIRIL--IIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGY 58
           M ++      + + +L  ++AF+               +   +I  GALGN+ D    G 
Sbjct: 59  MFADTPDWFRIPLLLLTPLVAFVVTYIYSRRDGNPALALLMGMIAGGALGNLYDRLFIGK 118

Query: 59  VIDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIIL 96
           V D+I +H     +  FN AD  I+    ++I   +  
Sbjct: 119 VRDFIHLHVGEHYWPAFNFADASITTAIVLLIIGQLRR 156


>gi|15807378|ref|NP_296109.1| lipoprotein signal peptidase [Deinococcus radiodurans R1]
 gi|81858802|sp|Q9RRU7|LSPA_DEIRA RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|6460203|gb|AAF11933.1|AE002069_7 lipoprotein signal peptidase [Deinococcus radiodurans R1]
          Length = 191

 Score = 79.3 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 20/115 (17%), Positives = 47/115 (40%), Gaps = 10/115 (8%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           M S  +  + +   ++ +  + ++  K         +   +I  GA+GN +D    G V 
Sbjct: 79  MFSGSAVPLALGRILVGLGILSYLLWK--PQGRFLTVVLSMIAAGAIGNSIDGLQRGQVT 136

Query: 61  DYIMIH--------TQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDFP 107
           D I                F +FN+AD+ +  GT +++   ++ + +++  +   
Sbjct: 137 DMIHSPLLSAVTEAINGTRFPIFNIADMCVVGGTILLLVASLLPERKREKAVPEA 191


>gi|295425513|ref|ZP_06818205.1| signal peptidase II [Lactobacillus amylolyticus DSM 11664]
 gi|295064804|gb|EFG55720.1| signal peptidase II [Lactobacillus amylolyticus DSM 11664]
          Length = 154

 Score = 79.3 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 22/97 (22%), Positives = 41/97 (42%), Gaps = 2/97 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
              +  +I I+ I    +         + FD G  L+  G +GN +D     YV+D + +
Sbjct: 58  QMWLFYAISIVTIGVCLYFLFNKKYKNTWFDAGIALVLGGIIGNFIDRLHLKYVVDMLQL 117

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
                 F +FN+AD  I++G  +I    +    ++  
Sbjct: 118 DF--IHFNIFNIADSAITVGVILIFIYLVFFDEKENK 152


>gi|332361352|gb|EGJ39156.1| signal peptidase II [Streptococcus sanguinis SK1056]
          Length = 155

 Score = 79.3 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 20/98 (20%), Positives = 41/98 (41%), Gaps = 2/98 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
              +   +  L+I    +   K+         G  L+  G LGN +D    G+V+D   +
Sbjct: 60  QQWLFTLVTFLVIGGAVYYLIKHLNASKWMLAGLTLVIAGGLGNFIDRIRQGFVVDMFQL 119

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
                 FA+FN+AD++++ G  +++   +  +      
Sbjct: 120 DFIN--FAIFNVADMYLTFGVAVLLLMILKEEKDGSKN 155


>gi|83589719|ref|YP_429728.1| signal peptidase II [Moorella thermoacetica ATCC 39073]
 gi|123524750|sp|Q2RK54|LSPA_MOOTA RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|83572633|gb|ABC19185.1| signal peptidase II, Aspartic peptidase, MEROPS family A08
           [Moorella thermoacetica ATCC 39073]
          Length = 150

 Score = 79.3 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 25/95 (26%), Positives = 49/95 (51%), Gaps = 4/95 (4%)

Query: 9   ILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQ 68
           + V + +L+   I   ++  P  + +  +   L+  GALGN++D   +GYV+D++ +   
Sbjct: 59  VFVGVTVLVAIIILAAYRYLPPDRPLLRLSLALMLGGALGNLIDRLRFGYVVDFLDLRI- 117

Query: 69  TWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
              + VFNLAD+ I  G  I+ +  ++    Q  +
Sbjct: 118 ---WPVFNLADMAIVFGVIILCWQLLLPAGEQGRE 149


>gi|254452122|ref|ZP_05065559.1| signal peptidase II [Octadecabacter antarcticus 238]
 gi|198266528|gb|EDY90798.1| signal peptidase II [Octadecabacter antarcticus 238]
          Length = 159

 Score = 79.3 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 23/98 (23%), Positives = 47/98 (47%), Gaps = 2/98 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                 L+++ ++I AF+ +  ++    +    I   L+  GA+GNVVD  L+G V D++
Sbjct: 61  FDMRWALIAVALIISAFVLWWIRRENAGRWAH-ISAGLLVGGAIGNVVDRVLHGAVADFL 119

Query: 64  MIHTQTWSFA-VFNLADLFISIGTCIIIYDDIILQHRQ 100
            +     +    FN+AD+ I +G   ++        ++
Sbjct: 120 NVSCCGINNPYAFNVADISIFVGAIGLVLFTDGGNKKK 157


>gi|303231394|ref|ZP_07318128.1| signal peptidase II [Veillonella atypica ACS-049-V-Sch6]
 gi|302513990|gb|EFL55998.1| signal peptidase II [Veillonella atypica ACS-049-V-Sch6]
          Length = 146

 Score = 79.3 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 22/96 (22%), Positives = 44/96 (45%), Gaps = 4/96 (4%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
                +++  ++I    F  K+         +G  L+  GA+GN +D  +   V+D+   
Sbjct: 55  QRWFFLAVAFVLIIVYGFYRKRVNNGPVSLRVGTALLIAGAIGNGIDRYVLHGVVDFFDF 114

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
                 + +FN+AD+ I +G   +IY  +  +H +K
Sbjct: 115 RI----WPIFNIADIGICVGVVCVIYYLLTSEHEEK 146


>gi|227499565|ref|ZP_03929672.1| signal peptidase II [Anaerococcus tetradius ATCC 35098]
 gi|227218324|gb|EEI83578.1| signal peptidase II [Anaerococcus tetradius ATCC 35098]
          Length = 152

 Score = 79.3 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 28/100 (28%), Positives = 52/100 (52%), Gaps = 3/100 (3%)

Query: 7   PTILVSIRILIIAFIFFIWKKN-PKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
             + V + I I+ ++ + + KN  K   I +I   +I +GA+GN  D     YV+D+I  
Sbjct: 54  RILFVILTISIVLYLIYYFVKNIKKNPPILNIAMAMIISGAIGNFYDRLFQAYVVDFIEF 113

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
                 F VFN+AD+F+++G  ++I   ++   +   + D
Sbjct: 114 SFVN--FPVFNVADIFVTVGCGLMIIYIMLHGEKSNDRKD 151


>gi|15835303|ref|NP_297062.1| lipoprotein signal peptidase [Chlamydia muridarum Nigg]
 gi|270285476|ref|ZP_06194870.1| lipoprotein signal peptidase [Chlamydia muridarum Nigg]
 gi|270289487|ref|ZP_06195789.1| lipoprotein signal peptidase [Chlamydia muridarum Weiss]
 gi|301336873|ref|ZP_07225075.1| lipoprotein signal peptidase [Chlamydia muridarum MopnTet14]
 gi|14194916|sp|Q9PJY8|LSPA_CHLMU RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|7190720|gb|AAF39505.1| lipoprotein signal peptidase [Chlamydia muridarum Nigg]
          Length = 167

 Score = 79.3 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 32/101 (31%), Positives = 51/101 (50%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           + +     +L+    +I+    F+  K         I   LI  GALGNV D   +G V+
Sbjct: 65  LFAQYKIPLLIFRVFVILCLFLFLGIKFRSLHIRTRIALTLILAGALGNVGDILFHGKVV 124

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
           D++ I+  +WSF  FNLAD FIS+GT +++      +  +K
Sbjct: 125 DFLSINYYSWSFPSFNLADAFISLGTLLLVGHLYFSKEDKK 165


>gi|62184849|ref|YP_219634.1| lipoprotein signal peptidase [Chlamydophila abortus S26/3]
 gi|81312974|sp|Q5L6Q8|LSPA_CHLAB RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|62147916|emb|CAH63663.1| putative lipoprotein signal peptidase [Chlamydophila abortus S26/3]
          Length = 165

 Score = 79.3 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 29/100 (29%), Positives = 50/100 (50%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           + +     +      +I+  + F++ +   +        IL+ +GA+GNV D   Y +V+
Sbjct: 64  LFAKYKYFLFFIRITIILGILAFLFLRKKTSSPAIRFSLILLCSGAIGNVGDIVFYRHVV 123

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
           D+I I  + W F  FN AD+FIS+GT I IY       ++
Sbjct: 124 DFISIGYKRWFFPTFNFADIFISLGTLIFIYKLYFPTKQK 163


>gi|187779873|ref|ZP_02996346.1| hypothetical protein CLOSPO_03469 [Clostridium sporogenes ATCC
           15579]
 gi|187773498|gb|EDU37300.1| hypothetical protein CLOSPO_03469 [Clostridium sporogenes ATCC
           15579]
          Length = 147

 Score = 79.3 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 27/90 (30%), Positives = 49/90 (54%), Gaps = 1/90 (1%)

Query: 9   ILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQ 68
            L  I +++I  + +   K   T  +  I   LI +GA+GN++D   Y +V+D+IM+H +
Sbjct: 58  FLSLITVIVILGVAYFIVKYKPTSKLLKISLSLIISGAIGNLIDRIYYKFVVDFIMLHYK 117

Query: 69  T-WSFAVFNLADLFISIGTCIIIYDDIILQ 97
             + F  FN+AD  + IGT ++    +  +
Sbjct: 118 DVYFFPTFNVADTLVVIGTILLAIYILKEE 147


>gi|189218022|ref|YP_001938664.1| lipoprotein signal peptidase [Methylacidiphilum infernorum V4]
 gi|189184880|gb|ACD82065.1| Lipoprotein signal peptidase [Methylacidiphilum infernorum V4]
          Length = 145

 Score = 79.3 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 32/104 (30%), Positives = 53/104 (50%), Gaps = 1/104 (0%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           + +  +    V   +LI+   F+  KK  KT     IG  +I  GALGN +D  ++G+V 
Sbjct: 42  LFAGNNRFWEVFTLLLILIGFFYFRKKIFKTIPYMVIG-AMIFAGALGNGIDRIIHGHVT 100

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
           D+I +H   + +  FNLAD ++++G   I    + L+H    K 
Sbjct: 101 DFIDVHFFNYHWPAFNLADTYLTLGFSCIFLYFLKLKHTSNQKN 144


>gi|119952659|ref|YP_950197.1| lipoprotein signal peptidase [Arthrobacter aurescens TC1]
 gi|119951789|gb|ABM10698.1| lipoprotein signal peptidase [Arthrobacter aurescens TC1]
          Length = 171

 Score = 79.3 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 22/96 (22%), Positives = 44/96 (45%), Gaps = 5/96 (5%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFI-WKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYV 59
           M + + P  +++   L++A + +      P+   +   G  ++  GA GN +D      V
Sbjct: 71  MGAGLPPWAVIAGTALVMAALLWYTLSAAPRMSLLSRAGAAVLLGGAAGNFIDRLDGQGV 130

Query: 60  IDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDII 95
           +DY+        F  FNLAD+F+  G  +++    +
Sbjct: 131 VDYLHSGW----FPTFNLADVFVVGGVGLMVLGSFL 162


>gi|332705979|ref|ZP_08426052.1| signal peptidase Ii, aspartic peptidase, MEROPS family A08 [Lyngbya
           majuscula 3L]
 gi|332355239|gb|EGJ34706.1| signal peptidase Ii, aspartic peptidase, MEROPS family A08 [Lyngbya
           majuscula 3L]
          Length = 168

 Score = 79.3 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 25/113 (22%), Positives = 47/113 (41%), Gaps = 13/113 (11%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGY-- 58
           + S      L  + + +   +  +    PK   +  +GY  I  GALGN +D        
Sbjct: 56  LFSEDGSW-LRWLSLAVSLGLIALAWFGPKLIRLEQLGYGFILGGALGNGIDRFFNSCLV 114

Query: 59  --------VIDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
                   V+D++  H +  +F VFN+AD+ I++G   ++      Q  +  +
Sbjct: 115 DNQTVTGCVVDFL--HFRLINFPVFNVADVCINLGIVCLLIASFKHQSPKSRE 165


>gi|22299963|ref|NP_683210.1| lipoprotein signal peptidase [Thermosynechococcus elongatus BP-1]
 gi|81844808|sp|Q8DGA3|LSPA_THEEB RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|22296148|dbj|BAC09972.1| lipoprotein signal peptidase [Thermosynechococcus elongatus BP-1]
          Length = 158

 Score = 79.3 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 25/94 (26%), Positives = 45/94 (47%), Gaps = 3/94 (3%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           + +N S   L  + +++   +       P+      +GY  +  GALGN +D  L G V+
Sbjct: 65  LFANGSIW-LRWLSLIVSLGLITWAILGPRLDRWQQVGYGCLLGGALGNGIDRFLTGEVV 123

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDI 94
           D++        F VFN+AD+ I+IG   +++   
Sbjct: 124 DFLDFRW--IQFPVFNVADIAINIGIVCLLWSAW 155


>gi|304440210|ref|ZP_07400100.1| signal peptidase II [Peptoniphilus duerdenii ATCC BAA-1640]
 gi|304371259|gb|EFM24875.1| signal peptidase II [Peptoniphilus duerdenii ATCC BAA-1640]
          Length = 156

 Score = 78.9 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 32/104 (30%), Positives = 52/104 (50%)

Query: 2   LSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVID 61
           L N      +   ++++  + ++ K    +     I   LI  GA+GN +D     YVID
Sbjct: 53  LQNSQLLFSIITIVVLLGLMIYLIKNYKSSSLSTKISLTLIIAGAIGNFIDRLRLKYVID 112

Query: 62  YIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
           +I        FAVFNLAD FI IGT I++   I+ ++ ++ K +
Sbjct: 113 FISFRMFGHDFAVFNLADSFIVIGTIIVMILVILHENPKRKKNE 156


>gi|222152891|ref|YP_002562068.1| lipoprotein signal peptidase [Streptococcus uberis 0140J]
 gi|222113704|emb|CAR41655.1| lipoprotein signal peptidase [Streptococcus uberis 0140J]
          Length = 148

 Score = 78.9 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 43/92 (46%), Gaps = 2/92 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
                  I  ++++     + K      + +   ILI +GA+GN +D     YV+D I +
Sbjct: 59  QRWFFTIITCIVVSAAIIYYIKRAPMSKLKEWALILIISGAIGNFIDRMRLSYVVDMIHL 118

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQ 97
                 FA+FN+AD ++SIG  +++      +
Sbjct: 119 DFMN--FAIFNVADSYLSIGVVLLMIILWKEE 148


>gi|331269363|ref|YP_004395855.1| signal peptidase II [Clostridium botulinum BKT015925]
 gi|329125913|gb|AEB75858.1| signal peptidase II [Clostridium botulinum BKT015925]
          Length = 148

 Score = 78.9 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 25/93 (26%), Positives = 46/93 (49%), Gaps = 1/93 (1%)

Query: 7   PTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIH 66
             +LV   ++ I  I +   K         IG+  I  GALGN+ D   Y +V+D+I++H
Sbjct: 56  TFLLVLFTLIAILAIIYYVVKYKPKSKFIKIGFACIIAGALGNLYDRIFYKFVVDFILVH 115

Query: 67  TQT-WSFAVFNLADLFISIGTCIIIYDDIILQH 98
            +  + +  FN+AD+ + +GT ++    +    
Sbjct: 116 YKDVYYYPTFNIADILVVVGTIMLGIFILKEGK 148


>gi|323141905|ref|ZP_08076766.1| signal peptidase II [Phascolarctobacterium sp. YIT 12067]
 gi|322413652|gb|EFY04510.1| signal peptidase II [Phascolarctobacterium sp. YIT 12067]
          Length = 149

 Score = 78.9 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 50/97 (51%), Gaps = 5/97 (5%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           ML   S  + V I + +I  ++F+ ++  K+  +   G  L   GALGN++D    G VI
Sbjct: 52  MLEG-SRWLFVMIAVAVIGGVWFMRREIAKSGVMACWGTALFAGGALGNLIDRTTRGVVI 110

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQ 97
           D+         + +FN+AD+ I +G  +II+  +  +
Sbjct: 111 DFFDFRI----WPIFNVADIAICVGVGLIIWSILKTE 143


>gi|327460458|gb|EGF06795.1| signal peptidase II [Streptococcus sanguinis SK1057]
          Length = 155

 Score = 78.9 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 21/98 (21%), Positives = 41/98 (41%), Gaps = 2/98 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
              +   +  L+I    +   K+         G  L+  G LGN +D    G+V+D   +
Sbjct: 60  QQWLFTMVTFLVIGGAVYYLIKHLNASKWMLAGLTLVIAGGLGNFIDRIRQGFVVDMFQL 119

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
                 FA+FN+AD++++ G  I++   +  +      
Sbjct: 120 DFIN--FAIFNVADMYLTFGVAILLLMILKEEKDGSKN 155


>gi|330469279|ref|YP_004407022.1| lipoprotein signal peptidase [Verrucosispora maris AB-18-032]
 gi|328812250|gb|AEB46422.1| lipoprotein signal peptidase [Verrucosispora maris AB-18-032]
          Length = 211

 Score = 78.9 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 22/100 (22%), Positives = 39/100 (39%), Gaps = 9/100 (9%)

Query: 7   PTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYG------YVI 60
             I   I I ++A+I ++ +          I   L+  G  GN++D           +V+
Sbjct: 82  TWIFPLIAIGVLAWIAWMGRTLRSVPW--AISLGLVVGGVTGNLIDRIFRAPGWFVGHVV 139

Query: 61  DYIM-IHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
           D I         F +FN+AD  +  G  + I  +   + R
Sbjct: 140 DMISVFDPYGQVFPIFNIADSALVCGVILAIGLEFTGRQR 179


>gi|256843218|ref|ZP_05548706.1| signal peptidase II [Lactobacillus crispatus 125-2-CHN]
 gi|293380625|ref|ZP_06626678.1| signal peptidase II [Lactobacillus crispatus 214-1]
 gi|312977446|ref|ZP_07789194.1| signal peptidase II [Lactobacillus crispatus CTV-05]
 gi|256614638|gb|EEU19839.1| signal peptidase II [Lactobacillus crispatus 125-2-CHN]
 gi|290922812|gb|EFD99761.1| signal peptidase II [Lactobacillus crispatus 214-1]
 gi|310895877|gb|EFQ44943.1| signal peptidase II [Lactobacillus crispatus CTV-05]
          Length = 154

 Score = 78.9 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 23/96 (23%), Positives = 46/96 (47%), Gaps = 2/96 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
              +   I I+ I+   +         ++FD+G  LI  G +GN +D     YV+D + +
Sbjct: 58  QMWLFYIISIIAISVCLYFLFNKKYKNTLFDVGLALILGGIVGNFIDRLHLKYVVDMLQL 117

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
                 F +FN+AD  I++G  ++    I ++ +++
Sbjct: 118 DFV--HFNIFNIADSAITVGVILVFIYLIFIEGKEE 151


>gi|283778709|ref|YP_003369464.1| lipoprotein signal peptidase [Pirellula staleyi DSM 6068]
 gi|283437162|gb|ADB15604.1| lipoprotein signal peptidase [Pirellula staleyi DSM 6068]
          Length = 196

 Score = 78.9 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 20/115 (17%), Positives = 44/115 (38%), Gaps = 13/115 (11%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWK-KNPKTKSIFDIGYILITTGALGNVVDHC----- 54
           M +  S  +  S+ ++ +  IF              ++   ++T G LGN+ D       
Sbjct: 55  MGAGYS-WVFASLSVVAMLGIFVWLFVFQAARDRWLNVALGMVTGGILGNLYDRLGLWDS 113

Query: 55  ------LYGYVIDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
                     V D+I+   Q +++  FN+AD+ +  G  ++       +   + +
Sbjct: 114 TGLAPDFQHGVRDWILFRYQQYTWPNFNIADMLLVTGAIMLGLHAFFFREPSEEQ 168


>gi|325696404|gb|EGD38294.1| signal peptidase II [Streptococcus sanguinis SK160]
          Length = 155

 Score = 78.9 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 21/98 (21%), Positives = 41/98 (41%), Gaps = 2/98 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
              +   +  L+I    +   K+         G  L+  G LGN +D    G+V+D   +
Sbjct: 60  QQWLFTLVTFLVIGGAVYYLIKHLHASKWILAGLTLVIAGGLGNFIDRIRQGFVVDMFQL 119

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
                 FA+FN+AD++++ G  I++   +  +      
Sbjct: 120 DFIN--FAIFNVADMYLTFGVAILLLMILKEEKDGSNN 155


>gi|303247250|ref|ZP_07333524.1| lipoprotein signal peptidase [Desulfovibrio fructosovorans JJ]
 gi|302491409|gb|EFL51297.1| lipoprotein signal peptidase [Desulfovibrio fructosovorans JJ]
          Length = 163

 Score = 78.9 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 20/99 (20%), Positives = 45/99 (45%)

Query: 5   VSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIM 64
                  +   L +  IF + +       +  +G   I  GA+GN++D    G V+D++ 
Sbjct: 65  WQTYFFFAATALAVLIIFHLLRMASPDNKLLILGLGSILGGAVGNLIDRIKTGEVVDFLD 124

Query: 65  IHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
            + +++ +  FN+AD+ I +G+  ++     ++     K
Sbjct: 125 FYYKSYHWPAFNVADIAIFLGSLALLAAFYRMRRPSSRK 163


>gi|225567967|ref|ZP_03776992.1| hypothetical protein CLOHYLEM_04040 [Clostridium hylemonae DSM
           15053]
 gi|225163255|gb|EEG75874.1| hypothetical protein CLOHYLEM_04040 [Clostridium hylemonae DSM
           15053]
          Length = 175

 Score = 78.9 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 22/102 (21%), Positives = 47/102 (46%), Gaps = 5/102 (4%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIF--DIGYILITTGALGNVVDHCLYGY 58
           +  N      +S+  +I A + + + K P  +      I  ++I  GA GN +D     Y
Sbjct: 67  LFQNQRIFFFISVA-VICAVVIWFYMKVPMERRFLPLRICAVMIVAGAFGNCIDRVRLNY 125

Query: 59  VIDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
           V+D+   + +   F +FN+AD+++++ T  ++         +
Sbjct: 126 VVDF--FYFKLIDFPIFNVADIYVTVSTFALVILLFFYYKEE 165


>gi|315221341|ref|ZP_07863262.1| signal peptidase II [Streptococcus anginosus F0211]
 gi|315189460|gb|EFU23154.1| signal peptidase II [Streptococcus anginosus F0211]
          Length = 153

 Score = 78.9 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 23/94 (24%), Positives = 44/94 (46%), Gaps = 2/94 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
              +   I +++I    +   K+ K  +    G  LI  G +GN +D    G+V+D   +
Sbjct: 60  QQWLFAVITLVVIGAAIWYLSKHIKGSAWLLSGLSLIIAGGIGNFIDRMRQGFVVDMFQL 119

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
                 FA+FN+AD +++IG  ++I   +  +  
Sbjct: 120 DFIN--FAIFNVADSYLTIGVLVLIVMMLKEEDN 151


>gi|325108353|ref|YP_004269421.1| Lipoprotein signal peptidase [Planctomyces brasiliensis DSM 5305]
 gi|324968621|gb|ADY59399.1| Lipoprotein signal peptidase [Planctomyces brasiliensis DSM 5305]
          Length = 194

 Score = 78.9 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 19/107 (17%), Positives = 37/107 (34%), Gaps = 10/107 (9%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHC------ 54
           M    S    +   +  I  + ++            +   L+  G LGN+ D        
Sbjct: 59  MGQGFSSLFALLSVLAAIGILTWLTYFRGAASLWLCVTLGLVLAGTLGNLYDRLGWHGNE 118

Query: 55  ----LYGYVIDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQ 97
                   V D++     T+ + +FN AD+F+  G  ++      L+
Sbjct: 119 IDGERMYAVRDFLAFTFGTYHYPIFNFADVFLVTGAIMLGVYSFFLE 165


>gi|227878614|ref|ZP_03996536.1| lipoprotein signal peptidase A [Lactobacillus crispatus JV-V01]
 gi|227861791|gb|EEJ69388.1| lipoprotein signal peptidase A [Lactobacillus crispatus JV-V01]
          Length = 154

 Score = 78.9 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 23/96 (23%), Positives = 46/96 (47%), Gaps = 2/96 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
              +   I I+ I+   +         ++FD+G  LI  G +GN +D     YV+D + +
Sbjct: 58  QMWLFYIISIIAISVCLYFLFNKKYKNTLFDVGLALILGGIVGNFIDRLHLKYVVDMLQL 117

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
                 F +FN+AD  I++G  ++    I ++ +++
Sbjct: 118 DFV--HFNIFNIADSAITVGVILVFIYLIFIEGKEE 151


>gi|94990202|ref|YP_598302.1| lipoprotein signal peptidase [Streptococcus pyogenes MGAS10270]
 gi|209559191|ref|YP_002285663.1| lipoprotein signal peptidase [Streptococcus pyogenes NZ131]
 gi|148887164|sp|Q1JHH8|LSPA_STRPD RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|94543710|gb|ABF33758.1| Lipoprotein signal peptidase [Streptococcus pyogenes MGAS10270]
 gi|209540392|gb|ACI60968.1| Putative prolipoprotein signal peptidase [Streptococcus pyogenes
           NZ131]
          Length = 152

 Score = 78.9 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 23/93 (24%), Positives = 44/93 (47%), Gaps = 2/93 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
                V I +L+I +  +    +P       +  +LI +G +GN +D     YVID I +
Sbjct: 59  QQWFFVVITVLVIGYAIYYLATHPHLNIWKQLALLLIISGGIGNFIDRLRLAYVIDMIHL 118

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
                 FA+FN+AD ++++G  +++      + 
Sbjct: 119 DFMD--FAIFNVADSYLTVGVILLVICLWKEED 149


>gi|113477031|ref|YP_723092.1| lipoprotein signal peptidase [Trichodesmium erythraeum IMS101]
 gi|110168079|gb|ABG52619.1| signal peptidase II. Aspartic peptidase. MEROPS family A08
           [Trichodesmium erythraeum IMS101]
          Length = 165

 Score = 78.9 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 29/103 (28%), Positives = 51/103 (49%), Gaps = 2/103 (1%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           + SN   + L  + +++   +       PK      +GY LI  GALGN +D  + GYV+
Sbjct: 63  LFSNGGVSWLRWLSLIVSLGLMGFAWFGPKFDRWEQLGYGLILGGALGNGIDRFVSGYVV 122

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
           D++  H    +F +FN+AD+ I+IG   ++      +  + G 
Sbjct: 123 DFL--HFSLINFPIFNVADVSINIGIICLLVATFFAEIPKLGN 163


>gi|84684373|ref|ZP_01012274.1| signal peptidase II [Maritimibacter alkaliphilus HTCC2654]
 gi|84667352|gb|EAQ13821.1| signal peptidase II [Rhodobacterales bacterium HTCC2654]
          Length = 159

 Score = 78.9 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 22/104 (21%), Positives = 46/104 (44%), Gaps = 5/104 (4%)

Query: 1   MLS---NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYG 57
           + S   +    IL+ + + I   + +  ++         I   ++  GALGNV+D  +YG
Sbjct: 55  LFSSSEDTMRWILIGVALAICLGVLWWVRR-KSMTLAARIAAGVLVGGALGNVIDRVVYG 113

Query: 58  YVIDYIMIHTQTWSFA-VFNLADLFISIGTCIIIYDDIILQHRQ 100
            V D++ +    ++    FN+AD+ +  G   +I        ++
Sbjct: 114 AVADFLNMSCCGFTNPYSFNVADIAVFAGAIGLILLADKADGKK 157


>gi|325689796|gb|EGD31800.1| signal peptidase II [Streptococcus sanguinis SK115]
          Length = 155

 Score = 78.9 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 21/98 (21%), Positives = 41/98 (41%), Gaps = 2/98 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
              +   +  L+I    +   K+         G  L+  G LGN +D    G+V+D   +
Sbjct: 60  QQWLFTLVTFLVIGGAVYYLIKHLHASKWILAGLTLVIAGGLGNFIDRIRQGFVVDMFQL 119

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
                 FA+FN+AD++++ G  I++   +  +      
Sbjct: 120 DFIN--FAIFNVADMYLTFGVAILLLIILKEEKDGSKN 155


>gi|225018394|ref|ZP_03707586.1| hypothetical protein CLOSTMETH_02341 [Clostridium methylpentosum
           DSM 5476]
 gi|224948812|gb|EEG30021.1| hypothetical protein CLOSTMETH_02341 [Clostridium methylpentosum
           DSM 5476]
          Length = 170

 Score = 78.9 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 25/107 (23%), Positives = 50/107 (46%), Gaps = 5/107 (4%)

Query: 7   PTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIH 66
             +LV    L++    ++      T+    +   LI  G +GN++D    GYV+DYI ++
Sbjct: 63  RWLLVVATFLMVCICIYLLLSKRVTRVPVQLSLSLIIAGGVGNLIDRIFRGYVVDYIDLN 122

Query: 67  TQTWS-FAVFNLADLFISIGTCIIIYDDII----LQHRQKGKIDFPQ 108
            + +  FA+FN AD  + +GT ++    +      + +   + + P 
Sbjct: 123 FKPFDGFAIFNFADCLVVVGTILLFICILFEDFIFRKKTVEEKEVPH 169


>gi|139436955|ref|ZP_01771115.1| Hypothetical protein COLAER_00088 [Collinsella aerofaciens ATCC
           25986]
 gi|133776602|gb|EBA40422.1| Hypothetical protein COLAER_00088 [Collinsella aerofaciens ATCC
           25986]
          Length = 193

 Score = 78.9 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 21/93 (22%), Positives = 44/93 (47%), Gaps = 2/93 (2%)

Query: 10  LVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQT 69
              + + +I  I     +  +   +  +G  ++  GA+GN +D  ++G+V D+I      
Sbjct: 68  FAVLALAVIIAIAVYLVRASQLAHLEVVGMAMVAGGAIGNAIDRLVFGFVTDFIATTF-- 125

Query: 70  WSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
             F VFN+AD+ I++G  + +   + L    + 
Sbjct: 126 IDFPVFNVADIGITVGVVLALIGYMFLSPAARE 158


>gi|327399493|ref|YP_004340362.1| Lipoprotein signal peptidase [Hippea maritima DSM 10411]
 gi|327182122|gb|AEA34303.1| Lipoprotein signal peptidase [Hippea maritima DSM 10411]
          Length = 164

 Score = 78.9 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 28/94 (29%), Positives = 47/94 (50%)

Query: 9   ILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQ 68
            L  I +++   IF++         +F +G   +  G LGN+ D    GYVID++  H  
Sbjct: 71  FLGGISLVVFVVIFYLVLFGKDRSFLFILGLSFLAGGDLGNLYDRIFRGYVIDFLDFHIN 130

Query: 69  TWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
            + +  FNLAD FI+IG  I+I+  ++    +  
Sbjct: 131 RYHYPAFNLADSFITIGLFILIFYRMVGSRIKNA 164


>gi|86139368|ref|ZP_01057937.1| lipoprotein signal peptidase [Roseobacter sp. MED193]
 gi|85823871|gb|EAQ44077.1| lipoprotein signal peptidase [Roseobacter sp. MED193]
          Length = 161

 Score = 78.5 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 48/97 (49%), Gaps = 1/97 (1%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           ++ +  IL+ + + I   +     +      +  +   L+  GALGNV D  LYGYV+D+
Sbjct: 63  ADSARWILIGLSLAICLALVLWVGRGHDKGGLMQVSAGLVIGGALGNVADRLLYGYVLDF 122

Query: 63  IMIHTQTWSFA-VFNLADLFISIGTCIIIYDDIILQH 98
           + +     +   VFNLAD+FI  G   +I  +  ++ 
Sbjct: 123 LNMSCCGLNNPYVFNLADVFIFAGAAGLILFEGRIKK 159


>gi|25011478|ref|NP_735873.1| lipoprotein signal peptidase [Streptococcus agalactiae NEM316]
 gi|76787896|ref|YP_330007.1| lipoprotein signal peptidase [Streptococcus agalactiae A909]
 gi|77408215|ref|ZP_00784959.1| lipoprotein signal peptidase [Streptococcus agalactiae COH1]
 gi|77412099|ref|ZP_00788424.1| lipoprotein signal peptidase [Streptococcus agalactiae CJB111]
 gi|81845590|sp|Q8E4G5|LSPA_STRA3 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|123601591|sp|Q3K0E6|LSPA_STRA1 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|24413016|emb|CAD47095.1| Unknown [Streptococcus agalactiae NEM316]
 gi|76562953|gb|ABA45537.1| signal peptidase II [Streptococcus agalactiae A909]
 gi|77161855|gb|EAO72841.1| lipoprotein signal peptidase [Streptococcus agalactiae CJB111]
 gi|77173156|gb|EAO76281.1| lipoprotein signal peptidase [Streptococcus agalactiae COH1]
          Length = 154

 Score = 78.5 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 23/98 (23%), Positives = 40/98 (40%), Gaps = 2/98 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
              +   I I ++        K+        I   LI +G LGN +D    GYV+D + +
Sbjct: 59  QQWLFTLITIFVVCVAIIYLMKHINGSYWLLISLTLIISGGLGNFIDRLRLGYVVDMVHL 118

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
                 FA+FN+AD +++IG   ++      +      
Sbjct: 119 DFIN--FAIFNVADSYLTIGIICLMIALWKEESNGNHN 154


>gi|163791724|ref|ZP_02186115.1| lipoprotein signal peptidase [Carnobacterium sp. AT7]
 gi|159873016|gb|EDP67129.1| lipoprotein signal peptidase [Carnobacterium sp. AT7]
          Length = 156

 Score = 78.5 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 24/92 (26%), Positives = 47/92 (51%), Gaps = 2/92 (2%)

Query: 9   ILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQ 68
           +   I +L++ ++ + +   P+   +  I +  I  GALGN +D    GYV+D +     
Sbjct: 60  LFFIITVLVVGYLVYTFHNLPQRSILAGISFSFILAGALGNFIDRMRLGYVVDMLRFDF- 118

Query: 69  TWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
              F +FN+AD+F++IG   +I   +  +  +
Sbjct: 119 -IDFPIFNVADVFLTIGVGTMIVYLLFFEKEE 149


>gi|125717900|ref|YP_001035033.1| lipoprotein signal peptidase [Streptococcus sanguinis SK36]
 gi|125497817|gb|ABN44483.1| Lipoprotein signal peptidase, putative [Streptococcus sanguinis
           SK36]
 gi|327474177|gb|EGF19587.1| signal peptidase II [Streptococcus sanguinis SK408]
          Length = 155

 Score = 78.5 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 22/98 (22%), Positives = 41/98 (41%), Gaps = 2/98 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
              +   +  L+I    +   K+         G  L+  G LGN +D    G+VID   +
Sbjct: 60  QQWLFTLVTFLVIGGAVYYLIKHLHASKWMLAGLTLVIAGGLGNFIDRIRQGFVIDMFQL 119

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
                 FA+FN+AD++++ G  I++   +  +      
Sbjct: 120 DFIN--FAIFNVADMYLTFGVAILLLMILKEEKDGSKN 155


>gi|299134229|ref|ZP_07027422.1| lipoprotein signal peptidase [Afipia sp. 1NLS2]
 gi|298590976|gb|EFI51178.1| lipoprotein signal peptidase [Afipia sp. 1NLS2]
          Length = 166

 Score = 78.5 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 29/89 (32%), Positives = 44/89 (49%), Gaps = 4/89 (4%)

Query: 11  VSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHT--- 67
           + +    +A +            +  IG  LI  GA+GN VD   YG V+D+ + H    
Sbjct: 69  LLMAGKAVAIVLLAIWMARSQTRLAVIGLGLIIGGAIGNAVDRIAYGAVVDFALFHIAVA 128

Query: 68  -QTWSFAVFNLADLFISIGTCIIIYDDII 95
            +T+S+ VFNLAD  I  G   ++YD +I
Sbjct: 129 GKTYSWYVFNLADAAIVAGVAALLYDSLI 157


>gi|156326650|ref|XP_001618664.1| hypothetical protein NEMVEDRAFT_v1g224923 [Nematostella vectensis]
 gi|156199755|gb|EDO26564.1| predicted protein [Nematostella vectensis]
          Length = 319

 Score = 78.5 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 16/65 (24%), Positives = 35/65 (53%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +        +I +++ A +    K+    ++   +   L+  GALGN+VD  ++G+V+D+
Sbjct: 252 AGWQRWFFAAIAVMVSAVLVVWLKRLKSGETWLAVALALVLGGALGNLVDRVVFGHVVDF 311

Query: 63  IMIHT 67
           I++H 
Sbjct: 312 ILLHW 316


>gi|22537513|ref|NP_688364.1| lipoprotein signal peptidase [Streptococcus agalactiae 2603V/R]
 gi|76797716|ref|ZP_00779984.1| lipoprotein signal peptidase [Streptococcus agalactiae 18RS21]
 gi|77406373|ref|ZP_00783434.1| lipoprotein signal peptidase [Streptococcus agalactiae H36B]
 gi|77414615|ref|ZP_00790755.1| lipoprotein signal peptidase [Streptococcus agalactiae 515]
 gi|81845410|sp|Q8DYV7|LSPA_STRA5 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|22534393|gb|AAN00237.1|AE014254_17 lipoprotein signal peptidase [Streptococcus agalactiae 2603V/R]
 gi|76586940|gb|EAO63430.1| lipoprotein signal peptidase [Streptococcus agalactiae 18RS21]
 gi|77159328|gb|EAO70499.1| lipoprotein signal peptidase [Streptococcus agalactiae 515]
 gi|77174997|gb|EAO77805.1| lipoprotein signal peptidase [Streptococcus agalactiae H36B]
          Length = 154

 Score = 78.5 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 23/98 (23%), Positives = 40/98 (40%), Gaps = 2/98 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
              +   I I ++        K+        I   LI +G LGN +D    GYV+D + +
Sbjct: 59  QQWLFTLITIFVVGVAIIYLMKHINGSYWLLISLTLIISGGLGNFIDRLRLGYVVDMVHL 118

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
                 FA+FN+AD +++IG   ++      +      
Sbjct: 119 DFIN--FAIFNVADSYLTIGIICLMIALWKEESNGNHN 154


>gi|269958477|ref|YP_003328264.1| lipoprotein signal peptidase [Anaplasma centrale str. Israel]
 gi|269848306|gb|ACZ48950.1| lipoprotein signal peptidase [Anaplasma centrale str. Israel]
          Length = 170

 Score = 78.5 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 24/96 (25%), Positives = 46/96 (47%), Gaps = 2/96 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
           S  I   + + +I  +F +  +    KS F +G   +  GALGN+ D   +G V D+I +
Sbjct: 62  SNLIFTYVSLGVILALFVLLLQAKHKKSTFCMGV--VIGGALGNLADRLRFGAVYDFISL 119

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
           H     +  FN+AD  ++ G    +  +++   + +
Sbjct: 120 HVGELYWPAFNIADACVTCGVIGFLCLEVMYHAKAR 155


>gi|224541419|ref|ZP_03681958.1| hypothetical protein CATMIT_00581 [Catenibacterium mitsuokai DSM
           15897]
 gi|224525665|gb|EEF94770.1| hypothetical protein CATMIT_00581 [Catenibacterium mitsuokai DSM
           15897]
          Length = 156

 Score = 78.5 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 30/100 (30%), Positives = 56/100 (56%), Gaps = 1/100 (1%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           MLS     +  +I I+    + + + K+ K++ +   G +LI +G LGN+ D  ++ YV 
Sbjct: 49  MLSG-RFFLFYAISIIAGIMLIYYFIKSDKSQILLRFGIVLIFSGMLGNLYDRVVFHYVR 107

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
           D++      + F +FN+AD+ + IG  +II D  I +++Q
Sbjct: 108 DFLDFFVFGYDFPIFNIADMGVVIGVLLIILDLGIGEYKQ 147


>gi|319947182|ref|ZP_08021416.1| signal peptidase II [Streptococcus australis ATCC 700641]
 gi|319747230|gb|EFV99489.1| signal peptidase II [Streptococcus australis ATCC 700641]
          Length = 153

 Score = 78.5 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 23/97 (23%), Positives = 46/97 (47%), Gaps = 3/97 (3%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           ML N        I +  +   F    ++ K      +G  LI +G +GN +D    G+V+
Sbjct: 56  MLEN-QQWFFTIITLTAMGAAFVYLYRHIKGSLWLLLGLTLIISGGIGNFIDRVRQGFVV 114

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQ 97
           D   +      FA+FN+AD+++++G  +++   +  +
Sbjct: 115 DMFHLDFMN--FAIFNVADIYLTVGVGLLLIYILREE 149


>gi|86751288|ref|YP_487784.1| lipoprotein signal peptidase [Rhodopseudomonas palustris HaA2]
 gi|86574316|gb|ABD08873.1| signal peptidase II. Aspartic peptidase. MEROPS family A08
           [Rhodopseudomonas palustris HaA2]
          Length = 165

 Score = 78.5 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 29/96 (30%), Positives = 46/96 (47%), Gaps = 4/96 (4%)

Query: 11  VSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHT--- 67
           + +    +A +         T  +  IG  LI  GA+GN +D   YG V+D+ + H    
Sbjct: 69  IMLAFKAVAIVALAIWMARSTTKVATIGLGLIIGGAIGNAIDRLAYGAVVDFALFHAAIA 128

Query: 68  -QTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
            +T+S+ VFNLAD  I +G  +++YD        K 
Sbjct: 129 GKTYSWYVFNLADTAIVVGVALLLYDSFFGAPAAKA 164


>gi|19745905|ref|NP_607041.1| lipoprotein signal peptidase [Streptococcus pyogenes MGAS8232]
 gi|139473996|ref|YP_001128712.1| lipoprotein signal peptidase [Streptococcus pyogenes str. Manfredo]
 gi|73920910|sp|Q8P1G4|LSPA_STRP8 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|152032579|sp|A2RF66|LSPA_STRPG RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|19748059|gb|AAL97540.1| putative prolipoprotein signal peptidase [Streptococcus pyogenes
           MGAS8232]
 gi|134272243|emb|CAM30495.1| lipoprotein signal peptidase [Streptococcus pyogenes str. Manfredo]
          Length = 152

 Score = 78.5 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 23/93 (24%), Positives = 44/93 (47%), Gaps = 2/93 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
                V I +L+I +  +    +P       +  +LI +G +GN +D     YVID I +
Sbjct: 59  QQWFFVVITVLVIGYAIYYLATHPHLNIWKQLALLLIISGGIGNFIDRLRLAYVIDMIHL 118

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
                 FA+FN+AD ++++G  +++      + 
Sbjct: 119 DFVD--FAIFNVADSYLTVGVILLVICLWKEED 149


>gi|16124953|ref|NP_419517.1| lipoprotein signal peptidase [Caulobacter crescentus CB15]
 gi|81856369|sp|Q9AAA6|LSPA_CAUCR RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|13421923|gb|AAK22685.1| lipoprotein signal peptidase [Caulobacter crescentus CB15]
          Length = 168

 Score = 78.5 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 23/98 (23%), Positives = 48/98 (48%), Gaps = 2/98 (2%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S+    +L+   IL++  +     K      +     ++I      N++D  +YGYV+D+
Sbjct: 67  SDWGRWLLIGFSILVVIGLAVWVHKA-TRPLLAVGIGLIIGGAIGNNLIDRVIYGYVVDF 125

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
           I +    + + VFN+AD  IS+G  +++ D  + +  +
Sbjct: 126 IDVSRLYFPW-VFNIADSGISVGVALLLLDSFLSEENK 162


>gi|326803608|ref|YP_004321426.1| signal peptidase II [Aerococcus urinae ACS-120-V-Col10a]
 gi|326650621|gb|AEA00804.1| signal peptidase II [Aerococcus urinae ACS-120-V-Col10a]
          Length = 149

 Score = 78.5 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 24/101 (23%), Positives = 46/101 (45%), Gaps = 3/101 (2%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           ML+     + + I +L+   I + +  +     ++     L+  GA+GN +D    GYV+
Sbjct: 52  MLAGHM-WLFIPITLLVSGLIIYYYHYDNVRHPLYVTSLSLLLAGAVGNFIDRVRLGYVV 110

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
           D   +      F VFN AD  +S+G    I   +  + +++
Sbjct: 111 DMFKLEFMD--FPVFNFADTCLSLGVIFFIIYLLFFESKEE 149


>gi|259649772|dbj|BAI41934.1| signal peptidase [Lactobacillus rhamnosus GG]
          Length = 183

 Score = 78.5 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 25/101 (24%), Positives = 44/101 (43%), Gaps = 4/101 (3%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           M             IL    +  +  ++   K  + +G  LIT GA+GN +D   + YV 
Sbjct: 81  MFEGKQ-WFFYVTTILAFVVVA-MLWRDSLHKPFYRMGLTLITAGAIGNFIDRLRFRYVT 138

Query: 61  DYIMIHTQT-WSF-AVFNLADLFISIGTCIIIYDDIILQHR 99
           D   +     W F A+FN AD+ I++G   ++   +  + +
Sbjct: 139 DMFHLEFLDQWRFNAIFNFADVCITLGVIFVLIYILFDRDK 179


>gi|254500014|ref|ZP_05112167.1| signal peptidase II [Labrenzia alexandrii DFL-11]
 gi|222441481|gb|EEE48158.1| signal peptidase II [Labrenzia alexandrii DFL-11]
          Length = 169

 Score = 78.5 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 21/83 (25%), Positives = 37/83 (44%), Gaps = 2/83 (2%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           +L  V   +LV +   +  ++  +            + Y +I  GALGNV D   Y  V 
Sbjct: 69  LLGEVHWFVLVVLAFAVCVWLSVLLI--SAASKFEALAYGMIIGGALGNVTDRLRYRAVT 126

Query: 61  DYIMIHTQTWSFAVFNLADLFIS 83
           D++  +     +  FN+AD+F+ 
Sbjct: 127 DFLDFYFGAAHWPSFNMADVFVV 149


>gi|332686652|ref|YP_004456426.1| lipoprotein signal peptidase [Melissococcus plutonius ATCC 35311]
 gi|332370661|dbj|BAK21617.1| lipoprotein signal peptidase [Melissococcus plutonius ATCC 35311]
          Length = 170

 Score = 78.5 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 45/97 (46%), Gaps = 2/97 (2%)

Query: 9   ILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQ 68
             + I +++   + ++  K  K      IG   +  GALGN +D    GYV+D I     
Sbjct: 61  FFIIITVIVGIGLIYLLVKFYKKSYWLSIGLSFVLAGALGNFIDRIRLGYVVDMIQTEF- 119

Query: 69  TWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
              F +FN+AD  + +G   II   I+ +   KG+ +
Sbjct: 120 -IHFPIFNVADSSLVVGVICIIIYLILDEKAVKGEKN 155


>gi|91978498|ref|YP_571157.1| lipoprotein signal peptidase [Rhodopseudomonas palustris BisB5]
 gi|91684954|gb|ABE41256.1| signal peptidase II. Aspartic peptidase. MEROPS family A08
           [Rhodopseudomonas palustris BisB5]
          Length = 165

 Score = 78.5 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 44/89 (49%), Gaps = 4/89 (4%)

Query: 11  VSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHT--- 67
           + +    +A +         T     IG  LI  GA+GN +D   YG V+D+ + H    
Sbjct: 69  IMLAFKAVAIVVLAIWMARSTTRFATIGLGLIIGGAIGNAIDRLSYGAVVDFALFHAEIA 128

Query: 68  -QTWSFAVFNLADLFISIGTCIIIYDDII 95
            +T+S+ VFNLAD  I +G   ++YD + 
Sbjct: 129 GKTYSWYVFNLADAAIVVGVAALLYDSLF 157


>gi|262276792|ref|ZP_06054585.1| signal peptidase II [alpha proteobacterium HIMB114]
 gi|262223895|gb|EEY74354.1| signal peptidase II [alpha proteobacterium HIMB114]
          Length = 181

 Score = 78.5 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 43/78 (55%)

Query: 29  PKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQTWSFAVFNLADLFISIGTCI 88
              K I  IG+  I  GA+GN+ D   Y  V D+I IH  ++ +  FN++D+ IS+G  +
Sbjct: 97  KSEKIIELIGFSAIAGGAMGNLTDRFYYNAVPDFIDIHYNSFHWFTFNVSDICISVGIFL 156

Query: 89  IIYDDIILQHRQKGKIDF 106
           I++ D+I    +  +I  
Sbjct: 157 ILFSDVISLKNKNEEIIN 174


>gi|94496309|ref|ZP_01302886.1| lipoprotein signal peptidase [Sphingomonas sp. SKA58]
 gi|94424055|gb|EAT09079.1| lipoprotein signal peptidase [Sphingomonas sp. SKA58]
          Length = 170

 Score = 78.5 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 28/84 (33%), Positives = 41/84 (48%), Gaps = 3/84 (3%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
           +     LV +  LI  F+     +    + +      L+  GA+GN+VD    GYV+DY 
Sbjct: 68  DAMRWALVGMTFLIATFVAVWMWREKARQDVA--ALGLVLGGAIGNIVDRVRLGYVVDYA 125

Query: 64  MIHTQTWS-FAVFNLADLFISIGT 86
            +H   W  F +FNLAD  I+IG 
Sbjct: 126 DLHFGEWRPFLIFNLADAAITIGV 149


>gi|184155640|ref|YP_001843980.1| signal peptidase [Lactobacillus fermentum IFO 3956]
 gi|227514876|ref|ZP_03944925.1| signal peptidase II [Lactobacillus fermentum ATCC 14931]
 gi|260663036|ref|ZP_05863929.1| signal peptidase (SPase) II [Lactobacillus fermentum 28-3-CHN]
 gi|183226984|dbj|BAG27500.1| signal peptidase [Lactobacillus fermentum IFO 3956]
 gi|227086723|gb|EEI22035.1| signal peptidase II [Lactobacillus fermentum ATCC 14931]
 gi|260552657|gb|EEX25657.1| signal peptidase (SPase) II [Lactobacillus fermentum 28-3-CHN]
          Length = 145

 Score = 78.5 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 22/92 (23%), Positives = 39/92 (42%), Gaps = 3/92 (3%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
                  I +  +  + ++  +  +T     I   LI  GALGN +D     YV+D   +
Sbjct: 57  QQWFFYLITLAAVVVLAYLM-RQWRTNRWKMIALSLIMAGALGNFIDRVHQHYVVDMFEL 115

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQ 97
                +F VFN+AD  +++G   +I   +   
Sbjct: 116 --LPINFPVFNVADSCLTVGVIALIIIILKED 145


>gi|15674864|ref|NP_269038.1| lipoprotein signal peptidase [Streptococcus pyogenes M1 GAS]
 gi|71910450|ref|YP_282000.1| lipoprotein signal peptidase [Streptococcus pyogenes MGAS5005]
 gi|73920911|sp|Q9A0D2|LSPA_STRP1 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|13622000|gb|AAK33759.1| putative prolipoprotein signal peptidase [Streptococcus pyogenes M1
           GAS]
 gi|71853232|gb|AAZ51255.1| lipoprotein signal peptidase [Streptococcus pyogenes MGAS5005]
          Length = 152

 Score = 78.5 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 23/93 (24%), Positives = 44/93 (47%), Gaps = 2/93 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
                V I +L+I +  +    +P       +  +LI +G +GN +D     YVID I +
Sbjct: 59  QQWFFVVITVLVIGYAIYYLATHPHLNIWKQLALLLIISGGIGNFIDRLRLAYVIDMIHL 118

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
                 FA+FN+AD ++++G  +++      + 
Sbjct: 119 DFVD--FAIFNVADSYLTVGVILLLICLWKEED 149


>gi|305681424|ref|ZP_07404231.1| signal peptidase II [Corynebacterium matruchotii ATCC 14266]
 gi|305659629|gb|EFM49129.1| signal peptidase II [Corynebacterium matruchotii ATCC 14266]
          Length = 179

 Score = 78.1 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 26/104 (25%), Positives = 44/104 (42%), Gaps = 12/104 (11%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLY------GYV 59
           S  +    ++  +  + +   K         +G  LI  GALGN+ D          G+V
Sbjct: 54  STWLFTCFQLAFLIGVLWYSPKVR--DRWIALGLALIGGGALGNLGDRLFRAPQFFLGHV 111

Query: 60  IDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
           +D+I +      FAVFN+AD  I+ G  + +   ++    Q  K
Sbjct: 112 VDFISVG----DFAVFNIADSAITCGVAVFLIATLLEGRGQGQK 151


>gi|256545130|ref|ZP_05472496.1| signal peptidase II [Anaerococcus vaginalis ATCC 51170]
 gi|256399171|gb|EEU12782.1| signal peptidase II [Anaerococcus vaginalis ATCC 51170]
          Length = 155

 Score = 78.1 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 26/105 (24%), Positives = 52/105 (49%), Gaps = 2/105 (1%)

Query: 2   LSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVID 61
           L N     L+   +++I  +++  +       + +I   LI +GALGN  D   +G+V+D
Sbjct: 50  LQNKRIFFLILTLVVVIYLLYYFIRNIKSNPKLLNISLSLIVSGALGNFYDRLFHGFVVD 109

Query: 62  YIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDF 106
           +I      + F VFN+AD+ ++ G+ ++I   I  +   +  +  
Sbjct: 110 FIEFSF--FDFPVFNVADILVTTGSVLLIIFIIFGKMDGEENVSS 152


>gi|221233673|ref|YP_002516109.1| lipoprotein signal peptidase [Caulobacter crescentus NA1000]
 gi|220962845|gb|ACL94201.1| lipoprotein signal peptidase [Caulobacter crescentus NA1000]
          Length = 147

 Score = 78.1 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 23/98 (23%), Positives = 48/98 (48%), Gaps = 2/98 (2%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S+    +L+   IL++  +     K      +     ++I      N++D  +YGYV+D+
Sbjct: 46  SDWGRWLLIGFSILVVIGLAVWVHKA-TRPLLAVGIGLIIGGAIGNNLIDRVIYGYVVDF 104

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
           I +    + + VFN+AD  IS+G  +++ D  + +  +
Sbjct: 105 IDVSRLYFPW-VFNIADSGISVGVALLLLDSFLSEENK 141


>gi|309792571|ref|ZP_07687033.1| lipoprotein signal peptidase [Oscillochloris trichoides DG6]
 gi|308225385|gb|EFO79151.1| lipoprotein signal peptidase [Oscillochloris trichoides DG6]
          Length = 168

 Score = 78.1 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 28/90 (31%), Positives = 43/90 (47%), Gaps = 5/90 (5%)

Query: 9   ILVSIRILIIAFIFFIWK-KNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHT 67
            L    + IIA   + ++ + P  +    +   LI  GA GN++D    GYV+D+I I  
Sbjct: 70  FLTFTSLAIIAVAIYFYRTQLPNHQWFVQLIMGLIMGGAFGNLIDRVRLGYVVDFIQIGW 129

Query: 68  QTWSFAVFNLADLFISIGTCIIIYDDIILQ 97
               F +FN AD  IS+G   +I   I  +
Sbjct: 130 ----FPIFNFADCAISVGAFFLIIQFIREE 155


>gi|46447431|ref|YP_008796.1| putative signal peptidase II (prolipoprotein signal peptidase)
           [Candidatus Protochlamydia amoebophila UWE25]
 gi|46401072|emb|CAF24521.1| putative signal peptidase II (prolipoprotein signal peptidase)
           [Candidatus Protochlamydia amoebophila UWE25]
          Length = 175

 Score = 78.1 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 30/97 (30%), Positives = 50/97 (51%), Gaps = 2/97 (2%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           M  N   ++++    LI+    +++  N   +  + I  ILI  GA+GNV+D   YG+V+
Sbjct: 81  MFGNYQLSLMLFRIGLIVGLCVYLFHFN--QQKAWQIPLILIIAGAIGNVLDFFFYGHVV 138

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQ 97
           D +      + F VFN+AD FISIG  ++    +   
Sbjct: 139 DMLHFVLWGYDFPVFNVADSFISIGIGLLFILSLFKS 175


>gi|295691027|ref|YP_003594720.1| lipoprotein signal peptidase [Caulobacter segnis ATCC 21756]
 gi|295432930|gb|ADG12102.1| lipoprotein signal peptidase [Caulobacter segnis ATCC 21756]
          Length = 165

 Score = 78.1 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 25/98 (25%), Positives = 49/98 (50%), Gaps = 2/98 (2%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S+    +L+   ++++  +    +K  K      IG I+       N++D   YGYV+D+
Sbjct: 64  SDWGRWLLIGFSVVVVIALAIWARKATKLLPALGIGMIIGGA-IGNNLIDRVQYGYVVDF 122

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
           I +    + + VFN+AD  ISIG  +++ D  + +  +
Sbjct: 123 IDVSRLYFPW-VFNVADSGISIGVALLLLDSFLSEESK 159


>gi|116333480|ref|YP_795007.1| lipoprotein signal peptidase [Lactobacillus brevis ATCC 367]
 gi|116098827|gb|ABJ63976.1| signal peptidase II. Aspartic peptidase. MEROPS family A08
           [Lactobacillus brevis ATCC 367]
          Length = 154

 Score = 78.1 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 19/99 (19%), Positives = 42/99 (42%), Gaps = 4/99 (4%)

Query: 6   SPTILVSIRILIIAFIFFIWK--KNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
                  I ++ +  + + +   +  +   + ++G  L+  G +GN +D    GYV+D  
Sbjct: 58  QMWFFAVIAVVALGIMGYFFWQYRRDQNHRLEELGLALMMAGTIGNFIDRLTQGYVVDMF 117

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
            +      F +FN AD  +++G  +I     +   R+  
Sbjct: 118 QLDFIN--FPIFNFADSCLTVGVILIAIGVYLADRREAK 154


>gi|254797239|ref|YP_003082081.1| signal peptidase II [Neorickettsia risticii str. Illinois]
 gi|254590478|gb|ACT69840.1| signal peptidase II [Neorickettsia risticii str. Illinois]
          Length = 167

 Score = 78.1 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 20/92 (21%), Positives = 41/92 (44%)

Query: 2   LSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVID 61
                 + L  + + +   +F ++    + + +  + +  I  GA+ NV D   +G V D
Sbjct: 67  FGGYQFSNLFFLLVNVPVVLFVLFFSFRERRLVACVAWGFILGGAVANVTDRVRFGAVRD 126

Query: 62  YIMIHTQTWSFAVFNLADLFISIGTCIIIYDD 93
           +I  H     + VFN+AD  I +G   +++  
Sbjct: 127 FIDFHFLDLHWPVFNVADAAIFLGVAFVLFYS 158


>gi|148263595|ref|YP_001230301.1| lipoprotein signal peptidase [Geobacter uraniireducens Rf4]
 gi|146397095|gb|ABQ25728.1| signal peptidase II, Aspartic peptidase, MEROPS family A08
           [Geobacter uraniireducens Rf4]
          Length = 166

 Score = 78.1 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 21/98 (21%), Positives = 40/98 (40%), Gaps = 1/98 (1%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGY-VIDY 62
           N+   +      + +A +      +P    +  I   L+  G +GN++D       VID+
Sbjct: 66  NIRFWVFTFFTGIFLACMLVYLLVSPNNSKVKMISLSLVVGGGIGNLIDRIFNDGCVIDF 125

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
           + I   +    VFN+AD+ IS G   +         ++
Sbjct: 126 MNIGIGSLRTGVFNVADIAISFGVVWLFAISFKASKKK 163


>gi|229493272|ref|ZP_04387063.1| signal peptidase II [Rhodococcus erythropolis SK121]
 gi|229319774|gb|EEN85604.1| signal peptidase II [Rhodococcus erythropolis SK121]
          Length = 158

 Score = 78.1 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 23/96 (23%), Positives = 42/96 (43%), Gaps = 5/96 (5%)

Query: 3   SNVSPTILVSIRILIIAFI-FFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVID 61
             +   I++++   I   +  + W+  P    +  +G+  I  GA  NV+D  + G V D
Sbjct: 52  QQLPAWIILAVTAAITLGVGIYAWRTVPTASLVGTVGWSAILAGAAANVIDRAVDGKVTD 111

Query: 62  YIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQ 97
           Y         +  FNLAD +I+ G  +++   I   
Sbjct: 112 YFHTGW----WPTFNLADTYITCGVVLLVASLIFES 143


>gi|158425864|ref|YP_001527156.1| lipoprotein signal peptidase [Azorhizobium caulinodans ORS 571]
 gi|158332753|dbj|BAF90238.1| signal peptidase II precursor [Azorhizobium caulinodans ORS 571]
          Length = 171

 Score = 78.1 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 28/92 (30%), Positives = 49/92 (53%), Gaps = 2/92 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
              +LV+++I           + P  + +   G  L+  GALGN VD  +YG V D+I +
Sbjct: 67  GRWVLVAVKIAAAIGFAVWLARTP--RRLEAFGLGLLIGGALGNAVDRVVYGGVFDFISL 124

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQ 97
           H   + + VFN+AD+ + +G  I++YD +  +
Sbjct: 125 HAGDFRWYVFNVADIAVVVGVVILLYDALFAR 156


>gi|220931775|ref|YP_002508683.1| lipoprotein signal peptidase [Halothermothrix orenii H 168]
 gi|254810447|sp|B8CWL9|LSPA_HALOH RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|219993085|gb|ACL69688.1| lipoprotein signal peptidase [Halothermothrix orenii H 168]
          Length = 145

 Score = 78.1 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 26/92 (28%), Positives = 46/92 (50%), Gaps = 5/92 (5%)

Query: 7   PTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIH 66
             + + I +++I+F+   + K      +  +   LI  GALGN++D   +GYV+DY+   
Sbjct: 56  RYLFIVITVVVISFLLIYYYKTR-GSGMVTLSTGLIIGGALGNLIDRIRFGYVVDYLDFR 114

Query: 67  TQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
                + VFNLAD  + IG  ++I      + 
Sbjct: 115 I----WPVFNLADSSVVIGAALLILYLWQQEK 142


>gi|328955607|ref|YP_004372940.1| lipoprotein signal peptidase [Coriobacterium glomerans PW2]
 gi|328455931|gb|AEB07125.1| lipoprotein signal peptidase [Coriobacterium glomerans PW2]
          Length = 192

 Score = 78.1 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 23/98 (23%), Positives = 49/98 (50%), Gaps = 2/98 (2%)

Query: 11  VSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQTW 70
           +++  ++ A       + P    +  IG  ++  G++GN +D  LYG V D+I +     
Sbjct: 78  IALTAIVSAAGIVYLVRAPIVSRLEPIGLGMLMGGSIGNAIDRVLYGSVTDFIQVRIMD- 136

Query: 71  SFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDFPQ 108
            F +FN+AD+ I++G  + ++  + L    +  +D  +
Sbjct: 137 -FPIFNVADIGITLGILVALFGFMKLSPANQRALDRDE 173


>gi|148379447|ref|YP_001253988.1| signal peptidase II [Clostridium botulinum A str. ATCC 3502]
 gi|153933756|ref|YP_001383826.1| signal peptidase II [Clostridium botulinum A str. ATCC 19397]
 gi|153937656|ref|YP_001387376.1| signal peptidase II [Clostridium botulinum A str. Hall]
 gi|153939032|ref|YP_001390823.1| signal peptidase II [Clostridium botulinum F str. Langeland]
 gi|168180133|ref|ZP_02614797.1| signal peptidase II [Clostridium botulinum NCTC 2916]
 gi|170757577|ref|YP_001781113.1| signal peptidase II [Clostridium botulinum B1 str. Okra]
 gi|226948811|ref|YP_002803902.1| signal peptidase II [Clostridium botulinum A2 str. Kyoto]
 gi|148288931|emb|CAL83018.1| lipoprotein signal peptidase [Clostridium botulinum A str. ATCC
           3502]
 gi|152929800|gb|ABS35300.1| signal peptidase II [Clostridium botulinum A str. ATCC 19397]
 gi|152933570|gb|ABS39069.1| signal peptidase II [Clostridium botulinum A str. Hall]
 gi|152934928|gb|ABS40426.1| signal peptidase II [Clostridium botulinum F str. Langeland]
 gi|169122789|gb|ACA46625.1| signal peptidase II [Clostridium botulinum B1 str. Okra]
 gi|182669028|gb|EDT81004.1| signal peptidase II [Clostridium botulinum NCTC 2916]
 gi|226843690|gb|ACO86356.1| signal peptidase II [Clostridium botulinum A2 str. Kyoto]
 gi|295318892|gb|ADF99269.1| signal peptidase II [Clostridium botulinum F str. 230613]
 gi|322805793|emb|CBZ03358.1| lipoprotein signal peptidase [Clostridium botulinum H04402 065]
          Length = 147

 Score = 78.1 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 27/90 (30%), Positives = 49/90 (54%), Gaps = 1/90 (1%)

Query: 9   ILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQ 68
            L  I  ++I  + +   K   T  +  I   LI +GA+GN++D   Y +V+D+IM+H +
Sbjct: 58  FLSLITAIVILGVVYFIVKYKPTSKLLKISLSLIISGAIGNLIDRIYYKFVVDFIMLHYK 117

Query: 69  T-WSFAVFNLADLFISIGTCIIIYDDIILQ 97
             + F  FN+AD+ + IGT ++    +  +
Sbjct: 118 DVYYFPTFNVADMLVVIGTVLLAIYILKEE 147


>gi|295692990|ref|YP_003601600.1| lipoprotein signal peptidase [Lactobacillus crispatus ST1]
 gi|295031096|emb|CBL50575.1| Lipoprotein signal peptidase [Lactobacillus crispatus ST1]
          Length = 154

 Score = 78.1 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 23/96 (23%), Positives = 46/96 (47%), Gaps = 2/96 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
              +   I I+ I+   +         ++FD+G  LI  G +GN +D     YV+D + +
Sbjct: 58  QMWLFYIISIIAISVCLYFLFNKKYKNTLFDVGLALILGGIVGNFIDRLHLKYVVDMLQL 117

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
                 F +FN+AD  I++G  ++    I ++ +++
Sbjct: 118 DFV--HFNIFNIADSAITVGVILVFIYLIFIEGKEE 151


>gi|86606198|ref|YP_474961.1| lipoprotein signal peptidase [Synechococcus sp. JA-3-3Ab]
 gi|86554740|gb|ABC99698.1| signal peptidase II [Synechococcus sp. JA-3-3Ab]
          Length = 156

 Score = 78.1 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 22/92 (23%), Positives = 42/92 (45%), Gaps = 2/92 (2%)

Query: 9   ILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQ 68
            L  + + +   +  +  +         +GY L+  GA+GN +D  L GYV+D+      
Sbjct: 62  FLKWVSLGVAVALALLAIRGSSLGRWEQVGYGLVWAGAMGNGIDRFLNGYVVDFFNFVWI 121

Query: 69  TWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
              F VFN+AD+ I++G   ++        ++
Sbjct: 122 G--FPVFNVADVAINVGVACLLVGLWQGSPKK 151


>gi|253581994|ref|ZP_04859218.1| lipoprotein signal peptidase [Fusobacterium varium ATCC 27725]
 gi|251836343|gb|EES64880.1| lipoprotein signal peptidase [Fusobacterium varium ATCC 27725]
          Length = 151

 Score = 78.1 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 31/102 (30%), Positives = 54/102 (52%), Gaps = 2/102 (1%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           M       I ++  I I+A +++++K   K   +  IG+  +  GA+GN++D    G+VI
Sbjct: 52  MFQGKLDIISIATVIAIVAIVYYLYKGRNKMPLLEKIGFTFVLAGAIGNMIDRIWRGFVI 111

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           D I          VFNLAD++I+IG  +I+ D    + ++K 
Sbjct: 112 DMIDFR--GIWSFVFNLADVWINIGVVLILLDYFFAERKKKK 151


>gi|171778235|ref|ZP_02919441.1| hypothetical protein STRINF_00280 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
 gi|171282935|gb|EDT48359.1| hypothetical protein STRINF_00280 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
          Length = 157

 Score = 78.1 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 23/94 (24%), Positives = 43/94 (45%), Gaps = 2/94 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
                  I + ++    + + KN      F  G +LI +G +GN +D    GYV+D + +
Sbjct: 62  QQWFFTVITLAVVGAACYYFIKNINGNFWFLFGLLLIISGGIGNFIDRLRLGYVVDMVHL 121

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
                 FA+FN+AD ++++G  I+       +  
Sbjct: 122 DFMN--FAIFNVADSYLTVGVVILFIALWKEEEN 153


>gi|193215313|ref|YP_001996512.1| lipoprotein [Chloroherpeton thalassium ATCC 35110]
 gi|193088790|gb|ACF14065.1| lipoprotein signal peptidase [Chloroherpeton thalassium ATCC 35110]
          Length = 171

 Score = 78.1 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 25/98 (25%), Positives = 42/98 (42%), Gaps = 8/98 (8%)

Query: 2   LSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVID 61
           L    P  +    I     I +    + +    +   + LI  GA+GN++D   YG VID
Sbjct: 53  LEMGGPLFVTGFAIAATIGICYYLYISRRDNIYYTTAFGLILGGAIGNLIDRFAYGQVID 112

Query: 62  YIMIHTQTWS--------FAVFNLADLFISIGTCIIIY 91
           +I                + +FN+AD  I+IG C+++ 
Sbjct: 113 FIHFDLYRGYIFGNYLALWPIFNIADSAITIGVCVMLI 150


>gi|284030830|ref|YP_003380761.1| lipoprotein signal peptidase [Kribbella flavida DSM 17836]
 gi|283810123|gb|ADB31962.1| lipoprotein signal peptidase [Kribbella flavida DSM 17836]
          Length = 258

 Score = 78.1 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 17/103 (16%), Positives = 49/103 (47%), Gaps = 12/103 (11%)

Query: 2   LSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHC------L 55
           L +    ++ +I+I +   + ++ ++         + + L+  GA+GN+ D         
Sbjct: 135 LGSDFTPVISAIQITVALGVIWLSRRVGSAGW--AVAFGLLFGGAVGNITDRIFREPSPF 192

Query: 56  YGYVIDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
           +G+V+D++       ++A+FN+AD+ ++    +++   +    
Sbjct: 193 HGHVVDFLQTP----NWAIFNVADMAVTSAAALLVIQTLRGIR 231


>gi|288553140|ref|YP_003425075.1| lipoprotein signal peptidase [Bacillus pseudofirmus OF4]
 gi|288544300|gb|ADC48183.1| lipoprotein signal peptidase [Bacillus pseudofirmus OF4]
          Length = 153

 Score = 78.1 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 45/97 (46%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
                  I  ++I  I +  +K  K   +F     LI  GA+GN +D    G V+D++  
Sbjct: 55  QMWFFYIITTIVIIGIIYYMEKEAKGDVLFATSLALILGGAVGNFIDRVFRGEVVDFVDT 114

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
               ++FA+FN+AD  + IG  ++       + R+K 
Sbjct: 115 FIFGYNFAIFNVADAALCIGVGLLFIKMFQDERRKKE 151


>gi|317498468|ref|ZP_07956762.1| signal peptidase II [Lachnospiraceae bacterium 5_1_63FAA]
 gi|316894161|gb|EFV16349.1| signal peptidase II [Lachnospiraceae bacterium 5_1_63FAA]
          Length = 171

 Score = 77.7 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 25/94 (26%), Positives = 49/94 (52%), Gaps = 4/94 (4%)

Query: 9   ILVSIRILIIAFIFFIWKKNPKTKSI--FDIGYILITTGALGNVVDHCLYGYVIDYIMIH 66
             V I +     + +I+++ P+TK      I Y LI  GA GN++D    GYV+D+   +
Sbjct: 63  FFVLITVAAAVILTWIYRRIPQTKKYIPLRISYALIMAGAFGNLIDRVFRGYVVDF--FY 120

Query: 67  TQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
            +   F VFN+AD+++++   +++   +     +
Sbjct: 121 FKWIDFPVFNVADIYVTVTMILLLILILFFYKEE 154


>gi|256847300|ref|ZP_05552746.1| signal peptidase II [Lactobacillus coleohominis 101-4-CHN]
 gi|256715964|gb|EEU30939.1| signal peptidase II [Lactobacillus coleohominis 101-4-CHN]
          Length = 167

 Score = 77.7 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 25/106 (23%), Positives = 51/106 (48%), Gaps = 4/106 (3%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           +L          + I+ IA + ++  +  K + + ++ + LI  G +GN +D   +GYVI
Sbjct: 60  LLEGKQ-WFFAIVSIIAIAVLIYLMHR-FKDQWLVELSFSLIFAGTIGNFIDRLRFGYVI 117

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDF 106
           D   +     +F VFN+AD  +++G  I+I   ++ +       + 
Sbjct: 118 DMFEL--MPINFPVFNIADACLTVGVVILIIIVLLEKDEGNRNAES 161


>gi|316935894|ref|YP_004110876.1| lipoprotein signal peptidase [Rhodopseudomonas palustris DX-1]
 gi|315603608|gb|ADU46143.1| lipoprotein signal peptidase [Rhodopseudomonas palustris DX-1]
          Length = 164

 Score = 77.7 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 26/90 (28%), Positives = 46/90 (51%), Gaps = 4/90 (4%)

Query: 17  IIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHT----QTWSF 72
            +A +         T  +  IG  LI  GA+GN +D   YG V+D+ ++H     + +++
Sbjct: 74  AVAIVALAIWMARSTTKVATIGLGLIIGGAIGNAIDRLAYGAVVDFALLHAEIGGKIYNW 133

Query: 73  AVFNLADLFISIGTCIIIYDDIILQHRQKG 102
            VFN+AD+ I +G   ++YD ++     K 
Sbjct: 134 YVFNVADVAIVVGVAALLYDSLLGPPAAKA 163


>gi|156740303|ref|YP_001430432.1| lipoprotein signal peptidase [Roseiflexus castenholzii DSM 13941]
 gi|156231631|gb|ABU56414.1| lipoprotein signal peptidase [Roseiflexus castenholzii DSM 13941]
          Length = 191

 Score = 77.7 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 23/86 (26%), Positives = 42/86 (48%), Gaps = 4/86 (4%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKK-NPKTKSIFDIGYILITTGALGNVVDHCLYGYV 59
           M       +  +  ++I     + ++   P    I  +   LI  GA+GN++D   +GYV
Sbjct: 70  MFDAGFSHVFTATSLIISLGAMYFYRYHLPGPHLISQVCLGLIVGGAIGNIIDRLRFGYV 129

Query: 60  IDYIMIHTQTWSFAVFNLADLFISIG 85
           ID++ +H       +FN+AD  I++G
Sbjct: 130 IDFVHVHWFPG---IFNVADSAITVG 152


>gi|329770486|ref|ZP_08261864.1| signal peptidase II [Gemella sanguinis M325]
 gi|328836235|gb|EGF85904.1| signal peptidase II [Gemella sanguinis M325]
          Length = 153

 Score = 77.7 bits (191), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 23/96 (23%), Positives = 44/96 (45%), Gaps = 1/96 (1%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNP-KTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIM 64
           S    + + I+ +A + +   K   K   +    + LI  GA+GN +D      V+D++ 
Sbjct: 57  SRLFFIVVTIIFMAILSYYLFKQKGKLTIVDKFTFSLIYAGAIGNFIDRLTRHEVVDFLD 116

Query: 65  IHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
                + F +FNLAD FI +G   ++      + ++
Sbjct: 117 FRIFGYDFPIFNLADCFICVGVFFLMLKIYNEEDKK 152


>gi|192293219|ref|YP_001993824.1| lipoprotein signal peptidase [Rhodopseudomonas palustris TIE-1]
 gi|238692574|sp|B3Q7Z4|LSPA_RHOPT RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|192286968|gb|ACF03349.1| lipoprotein signal peptidase [Rhodopseudomonas palustris TIE-1]
          Length = 164

 Score = 77.7 bits (191), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 27/90 (30%), Positives = 48/90 (53%), Gaps = 4/90 (4%)

Query: 10  LVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHT-- 67
           ++ +    +A +         T  +  IG  LI  GA+GN +D   YG V+D+ + H   
Sbjct: 67  ILMLAFKAVAIVALAIWMARSTTKLATIGLGLIIGGAIGNAIDRLAYGAVVDFALFHVEI 126

Query: 68  --QTWSFAVFNLADLFISIGTCIIIYDDII 95
             +T+++ VFN+AD+ I +G   ++YD +I
Sbjct: 127 AGKTYNWYVFNIADVAIVVGVVALLYDSLI 156


>gi|169350184|ref|ZP_02867122.1| hypothetical protein CLOSPI_00928 [Clostridium spiroforme DSM 1552]
 gi|169292967|gb|EDS75100.1| hypothetical protein CLOSPI_00928 [Clostridium spiroforme DSM 1552]
          Length = 167

 Score = 77.7 bits (191), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 41/78 (52%)

Query: 9   ILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQ 68
           + + I +L   F+ + + K    + +   G +L   G  GN++D  + GYV D+I     
Sbjct: 73  LFIIIALLSAIFMIYFFTKTKSREVLTRFGLVLTFAGMAGNLIDRIVLGYVRDFIDFVIF 132

Query: 69  TWSFAVFNLADLFISIGT 86
            ++F +FN+AD+ + IG 
Sbjct: 133 NYNFPIFNIADIAVVIGV 150


>gi|329767018|ref|ZP_08258546.1| signal peptidase II [Gemella haemolysans M341]
 gi|328837743|gb|EGF87368.1| signal peptidase II [Gemella haemolysans M341]
          Length = 151

 Score = 77.7 bits (191), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 24/95 (25%), Positives = 43/95 (45%), Gaps = 1/95 (1%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPK-TKSIFDIGYILITTGALGNVVDHCLYGYVIDYIM 64
           S    + + I+ IA + +   K      S     + LI  GA+GN +D      V+D++ 
Sbjct: 57  SRIFFIVVTIIFIAILTYYLVKQRNILSSFDKAIFSLIYGGAIGNFIDRLTRHEVVDFLD 116

Query: 65  IHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
                + F +FNLAD FI +G   +++     + +
Sbjct: 117 FRIFGYDFPIFNLADCFICVGVVFLLFKIYKEEDK 151


>gi|255325322|ref|ZP_05366428.1| signal peptidase II [Corynebacterium tuberculostearicum SK141]
 gi|255297887|gb|EET77198.1| signal peptidase II [Corynebacterium tuberculostearicum SK141]
          Length = 163

 Score = 77.7 bits (191), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 26/109 (23%), Positives = 50/109 (45%), Gaps = 12/109 (11%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYG--- 57
           M    S  +  +I+++ +  +     +   ++    +G  LI  GALGN  D        
Sbjct: 61  MGGEGSTWLFTTIQLVFVLGVAIAAPRITHSR--QAVGLALIAGGALGNFADRIFRAPGF 118

Query: 58  ---YVIDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
              +V+D+I +     SFAVFN+AD  I+ G  + I   ++ + + + +
Sbjct: 119 WCGHVVDFISVG----SFAVFNIADAAITCGVVLFIIAMVLEERKAEHE 163


>gi|195978251|ref|YP_002123495.1| lipoprotein signal peptidase [Streptococcus equi subsp.
           zooepidemicus MGCS10565]
 gi|195974956|gb|ACG62482.1| lipoprotein signal peptidase [Streptococcus equi subsp.
           zooepidemicus MGCS10565]
          Length = 145

 Score = 77.7 bits (191), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 24/93 (25%), Positives = 45/93 (48%), Gaps = 2/93 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
                  I IL++ +  +   K+PK      +  +LI +G LGN +D     YV+D I +
Sbjct: 52  QQWFFTIITILVVGYAIYYVLKHPKASFWLQLSLLLIISGGLGNFIDRMRLSYVVDMIHL 111

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
                 FA+FN+AD ++++G  +++      + 
Sbjct: 112 DVIN--FAIFNVADSYLTVGVLLLVICLWKEED 142


>gi|50914001|ref|YP_059973.1| lipoprotein signal peptidase [Streptococcus pyogenes MGAS10394]
 gi|73920909|sp|Q5XCS3|LSPA_STRP6 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|50903075|gb|AAT86790.1| Lipoprotein signal peptidase [Streptococcus pyogenes MGAS10394]
          Length = 152

 Score = 77.7 bits (191), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 22/93 (23%), Positives = 45/93 (48%), Gaps = 2/93 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
                V+I +L+I +  +    +P       +  +LI +G +GN +D     YVID + +
Sbjct: 59  QQWFFVAITVLVIGYAIYYLATHPHLNIWKQLALLLIISGGIGNFIDRLRLAYVIDMVHL 118

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
                 FA+FN+AD ++++G  +++      + 
Sbjct: 119 DFVD--FAIFNVADSYLTVGVILLVICLWKEED 149


>gi|319939286|ref|ZP_08013649.1| signal peptidase II [Streptococcus anginosus 1_2_62CV]
 gi|319811682|gb|EFW07958.1| signal peptidase II [Streptococcus anginosus 1_2_62CV]
          Length = 153

 Score = 77.7 bits (191), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 42/94 (44%), Gaps = 2/94 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
              +   I +++I    +   K+ K          LI  G +GN +D    G+V+D   +
Sbjct: 60  QQWLFAVITLVVIGAAIWYLSKHIKGSVWLLSSLCLIIAGGIGNFIDRMRQGFVVDMFQL 119

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
                 FA+FN+AD +++IG  ++I   +  +  
Sbjct: 120 DFIN--FAIFNVADSYLTIGVLVLIVMMLKEEDN 151


>gi|149002473|ref|ZP_01827407.1| signal peptidase II [Streptococcus pneumoniae SP14-BS69]
 gi|147759410|gb|EDK66402.1| signal peptidase II [Streptococcus pneumoniae SP14-BS69]
          Length = 159

 Score = 77.7 bits (191), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 22/92 (23%), Positives = 45/92 (48%), Gaps = 2/92 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
              +   I ++++    +   K+ +      +G  LI  G LGN +D    G+V+D    
Sbjct: 66  QQLLFAVITLVVVIGAIWYLHKHMEDSFWMVLGLTLIIAGGLGNFIDRASQGFVVDM--F 123

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQ 97
           H    +FA+FN+AD ++++G  I++   +  +
Sbjct: 124 HLDFINFAIFNVADSYLTVGVIILLIAMLKEE 155


>gi|219849170|ref|YP_002463603.1| lipoprotein signal peptidase [Chloroflexus aggregans DSM 9485]
 gi|219543429|gb|ACL25167.1| lipoprotein signal peptidase [Chloroflexus aggregans DSM 9485]
          Length = 191

 Score = 77.7 bits (191), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 20/99 (20%), Positives = 39/99 (39%), Gaps = 4/99 (4%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           +  +    + +S   +++          P       +   L+  G L N+ D    GYV+
Sbjct: 58  LFPDQGGVLSISAGFILLVLALTYQYLLPAESRWVTVATGLVFGGGLSNLFDRLRQGYVV 117

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
           D+I        + +FNLAD  I++G   + +  I +   
Sbjct: 118 DFIQFGW----WPMFNLADSAITLGVAALAFHIIFIGDE 152


>gi|149177286|ref|ZP_01855891.1| prolipoprotein signal peptidase (Signal peptidase II.)
           [Planctomyces maris DSM 8797]
 gi|148843811|gb|EDL58169.1| prolipoprotein signal peptidase (Signal peptidase II.)
           [Planctomyces maris DSM 8797]
          Length = 185

 Score = 77.7 bits (191), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 20/108 (18%), Positives = 45/108 (41%), Gaps = 2/108 (1%)

Query: 2   LSNVSPTILVSIR-ILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGY-V 59
           LS      L+ +     +  +  +     +   +  I   L+  G +GN++D       V
Sbjct: 67  LSKPVRFFLLVVANAAFLILVTGMLVFRWQMPLVQFIALSLLLAGGIGNLIDRVFLNGIV 126

Query: 60  IDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDFP 107
           ID++ I        +FN+AD+ I+ G  ++++     + + + K +  
Sbjct: 127 IDFLNIGFGPLRTGIFNVADMAITGGALLMLFSWFFTKDQIEQKKEQA 174


>gi|227833473|ref|YP_002835180.1| Lipoprotein signal peptidase [Corynebacterium aurimucosum ATCC
           700975]
 gi|227454489|gb|ACP33242.1| Lipoprotein signal peptidase [Corynebacterium aurimucosum ATCC
           700975]
          Length = 176

 Score = 77.7 bits (191), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 29/112 (25%), Positives = 50/112 (44%), Gaps = 12/112 (10%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHC------ 54
           M    S  +  +I+++ +  +     +         IG  +I  GALGN++D        
Sbjct: 67  MGGEGSTWLFTTIQLVFVVGVAIAAPRIH--DKWQAIGLAMIAGGALGNLIDRLVREPGF 124

Query: 55  LYGYVIDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDF 106
            +G+V+DYI +     SFAVFN+AD  I+ G  + I      +  +K +   
Sbjct: 125 WFGHVVDYISVG----SFAVFNIADAAITCGVVVFIIAMFWSEMNEKSEEQE 172


>gi|297617021|ref|YP_003702180.1| lipoprotein signal peptidase [Syntrophothermus lipocalidus DSM
           12680]
 gi|297144858|gb|ADI01615.1| lipoprotein signal peptidase [Syntrophothermus lipocalidus DSM
           12680]
          Length = 137

 Score = 77.7 bits (191), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 44/97 (45%), Gaps = 6/97 (6%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           +LS      L     + + F+   +    K       G  L++ GALGN+VD   +G V+
Sbjct: 46  LLSG--RYFLFLATAIGLIFVASYYAVYYKPNKALQFGLGLVSGGALGNLVDRLWHGGVV 103

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQ 97
           D+I +      + VFNLAD  I +GT  +    +  +
Sbjct: 104 DFIDLGF----WPVFNLADSAIVVGTAWLALLLLKSR 136


>gi|317056646|ref|YP_004105113.1| lipoprotein signal peptidase [Ruminococcus albus 7]
 gi|315448915|gb|ADU22479.1| lipoprotein signal peptidase [Ruminococcus albus 7]
          Length = 168

 Score = 77.7 bits (191), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 41/96 (42%), Gaps = 2/96 (2%)

Query: 7   PTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIH 66
              LVS+ IL+     F   K  K   I  +   +I  G +GN++D      VIDYI   
Sbjct: 63  TWFLVSLPILVCIAGIFYMYKVRKGSKIEIVSVAMIIAGGVGNLIDRVRMHEVIDYIKF- 121

Query: 67  TQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
            +  +F +FN AD+ I +G        ++   +   
Sbjct: 122 -EPINFPIFNFADICIVLGAVFFCLSILVADVKSSK 156


>gi|332366656|gb|EGJ44399.1| signal peptidase II [Streptococcus sanguinis SK1059]
          Length = 155

 Score = 77.3 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 21/98 (21%), Positives = 40/98 (40%), Gaps = 2/98 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
              +   +  L+I    +   K          G  L+  G LGN +D    G+V+D   +
Sbjct: 60  QQWLFTLVTFLVIGGAVYYLIKYLNASKWMLSGLTLVIAGGLGNFIDRIRQGFVVDMFQL 119

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
                 FA+FN+AD++++ G  I++   +  +      
Sbjct: 120 DFIN--FAIFNVADMYLTFGVSILLLMILKEEKDGSKN 155


>gi|149277691|ref|ZP_01883831.1| lipoprotein signal peptidase [Pedobacter sp. BAL39]
 gi|149231379|gb|EDM36758.1| lipoprotein signal peptidase [Pedobacter sp. BAL39]
          Length = 169

 Score = 77.3 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 22/102 (21%), Positives = 46/102 (45%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           M       +L+ + + ++    +      +      IG   +  G  GN+ D  +YG V 
Sbjct: 65  MHDTWKLLVLIVMPVAVLVGALYFVLSRKQMPLYVLIGICCVIGGGAGNLYDRIVYGSVT 124

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKG 102
           D++ I    +   VFN+AD+ I +G  +I+ + ++ + +  G
Sbjct: 125 DFLHIDFGIFQTGVFNVADMSIMLGMGLILINSVLRREQTDG 166


>gi|225021945|ref|ZP_03711137.1| hypothetical protein CORMATOL_01977 [Corynebacterium matruchotii
           ATCC 33806]
 gi|224945231|gb|EEG26440.1| hypothetical protein CORMATOL_01977 [Corynebacterium matruchotii
           ATCC 33806]
          Length = 199

 Score = 77.3 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 26/104 (25%), Positives = 44/104 (42%), Gaps = 12/104 (11%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLY------GYV 59
           S  +    ++  +  + +   K         +G  LI  GALGN+ D          G+V
Sbjct: 74  STWLFTCFQLAFLIGVLWYSPKVR--DRWIALGLALIGGGALGNLGDRLFRAPQFFLGHV 131

Query: 60  IDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
           +D+I +      FAVFN+AD  I+ G  + +   ++    Q  K
Sbjct: 132 VDFISVG----DFAVFNIADSAITCGVAVFLIATLLEGRGQGQK 171


>gi|255263796|ref|ZP_05343138.1| signal peptidase II [Thalassiobium sp. R2A62]
 gi|255106131|gb|EET48805.1| signal peptidase II [Thalassiobium sp. R2A62]
          Length = 159

 Score = 77.3 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 23/98 (23%), Positives = 45/98 (45%), Gaps = 2/98 (2%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S   P  L+++ + I   +     +   ++  F    +L+  GA+GNVVD  +YG V D+
Sbjct: 60  SEWLPWALIALALAISGAVLIWVYRENGSRWTFIWAGVLV-GGAIGNVVDRIIYGAVADF 118

Query: 63  IMIHTQTWSFA-VFNLADLFISIGTCIIIYDDIILQHR 99
           + +          FN+AD+ I +G   ++      + +
Sbjct: 119 LNMSCCGIDNPFAFNVADVAIFVGAVGLVLTTGDGKKK 156


>gi|307150291|ref|YP_003885675.1| lipoprotein signal peptidase [Cyanothece sp. PCC 7822]
 gi|306980519|gb|ADN12400.1| lipoprotein signal peptidase [Cyanothece sp. PCC 7822]
          Length = 168

 Score = 77.3 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 26/103 (25%), Positives = 50/103 (48%), Gaps = 6/103 (5%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           +     +     +++   + F+    P+ + I  +GY  I  GALGN +D  + GYV+D+
Sbjct: 62  AGWLRWL----SLIVSLGLIFLAWYAPRMRLIEQLGYGFILAGALGNGIDRFVMGYVVDF 117

Query: 63  IMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
           +        F +FNLAD+FI++G   ++   +  +   K  + 
Sbjct: 118 LDFRLIN--FPIFNLADVFINVGIFCLLIASLPTKPSAKRNLS 158


>gi|21910092|ref|NP_664360.1| lipoprotein signal peptidase [Streptococcus pyogenes MGAS315]
 gi|28896210|ref|NP_802560.1| lipoprotein signal peptidase [Streptococcus pyogenes SSI-1]
 gi|71903283|ref|YP_280086.1| lipoprotein signal peptidase [Streptococcus pyogenes MGAS6180]
 gi|94988323|ref|YP_596424.1| lipoprotein signal peptidase [Streptococcus pyogenes MGAS9429]
 gi|94992200|ref|YP_600299.1| lipoprotein signal peptidase [Streptococcus pyogenes MGAS2096]
 gi|94994122|ref|YP_602220.1| lipoprotein signal peptidase [Streptococcus pyogenes MGAS10750]
 gi|306827572|ref|ZP_07460853.1| signal peptidase II [Streptococcus pyogenes ATCC 10782]
 gi|73920908|sp|Q8K7Y7|LSPA_STRP3 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|123640097|sp|Q48U75|LSPA_STRPM RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|148887162|sp|Q1JCF3|LSPA_STRPB RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|148887163|sp|Q1JMD2|LSPA_STRPC RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|148887165|sp|Q1J798|LSPA_STRPF RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|21904283|gb|AAM79163.1| putative prolipoprotein signal peptidase [Streptococcus pyogenes
           MGAS315]
 gi|28811461|dbj|BAC64393.1| putative prolipoprotein signal peptidase [Streptococcus pyogenes
           SSI-1]
 gi|71802378|gb|AAX71731.1| lipoprotein signal peptidase [Streptococcus pyogenes MGAS6180]
 gi|94541831|gb|ABF31880.1| lipoprotein signal peptidase [Streptococcus pyogenes MGAS9429]
 gi|94545708|gb|ABF35755.1| Lipoprotein signal peptidase [Streptococcus pyogenes MGAS2096]
 gi|94547630|gb|ABF37676.1| Lipoprotein signal peptidase [Streptococcus pyogenes MGAS10750]
 gi|304430224|gb|EFM33252.1| signal peptidase II [Streptococcus pyogenes ATCC 10782]
          Length = 152

 Score = 77.3 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 22/93 (23%), Positives = 44/93 (47%), Gaps = 2/93 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
                V I +L+I +  +    +P       +  +LI +G +GN +D     YVID + +
Sbjct: 59  QQWFFVVITVLVIGYAIYYLATHPHLNIWKQLALLLIISGGIGNFIDRLRLAYVIDMVHL 118

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
                 FA+FN+AD ++++G  +++      + 
Sbjct: 119 DFVD--FAIFNVADSYLTVGVILLVICLWKEED 149


>gi|322376433|ref|ZP_08050926.1| signal peptidase II [Streptococcus sp. M334]
 gi|321282240|gb|EFX59247.1| signal peptidase II [Streptococcus sp. M334]
          Length = 153

 Score = 77.3 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 22/92 (23%), Positives = 45/92 (48%), Gaps = 2/92 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
              +   I ++++    +   K+ +      +G  LI  G LGN +D    G+V+D    
Sbjct: 60  QQFLFAIITLVVVVGAIWYLHKHMEESLWMVLGLTLIIAGGLGNFIDRISQGFVVDM--F 117

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQ 97
           H    +FA+FN+AD ++++G  I++   +  +
Sbjct: 118 HLDFINFAIFNVADSYLTVGVIILLIAMLKEE 149


>gi|215403395|ref|ZP_03415576.1| lipoprotein signal peptidase [Mycobacterium tuberculosis 02_1987]
 gi|215411201|ref|ZP_03420009.1| lipoprotein signal peptidase [Mycobacterium tuberculosis 94_M4241A]
 gi|215430433|ref|ZP_03428352.1| lipoprotein signal peptidase [Mycobacterium tuberculosis EAS054]
 gi|218753260|ref|ZP_03532056.1| lipoprotein signal peptidase [Mycobacterium tuberculosis GM 1503]
 gi|219557450|ref|ZP_03536526.1| lipoprotein signal peptidase [Mycobacterium tuberculosis T17]
          Length = 168

 Score = 77.3 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 22/95 (23%), Positives = 45/95 (47%), Gaps = 12/95 (12%)

Query: 7   PTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCL------YGYVI 60
             +L  I   ++  IF++ ++       + +G  +I  GA+GN+VD          G+V+
Sbjct: 56  TWVLTLIATGVVVGIFWMGRRL--VSPWWALGLGMILGGAMGNLVDRFFRAPGPLRGHVV 113

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDII 95
           D++ +      + VFN+AD  +  G  +++   I 
Sbjct: 114 DFLSVGW----WPVFNVADPSVVGGAILLVILSIF 144


>gi|227892506|ref|ZP_04010311.1| signal peptidase II [Lactobacillus ultunensis DSM 16047]
 gi|227865627|gb|EEJ73048.1| signal peptidase II [Lactobacillus ultunensis DSM 16047]
          Length = 154

 Score = 77.3 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 25/95 (26%), Positives = 42/95 (44%), Gaps = 2/95 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
              +   I I++I    +         ++FDIG  L+  G +GN +D     YVID   +
Sbjct: 58  QMWLFYLISIVVIGVCLYFLFNKKYKNTLFDIGLSLVLGGIIGNFIDRIHLKYVIDMFQL 117

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
                 F +FN+AD  I++G  I+    I    ++
Sbjct: 118 DF--IHFNIFNIADSAITVGVIIVFVYLIFFADKE 150


>gi|241889611|ref|ZP_04776909.1| signal peptidase II [Gemella haemolysans ATCC 10379]
 gi|241863233|gb|EER67617.1| signal peptidase II [Gemella haemolysans ATCC 10379]
          Length = 150

 Score = 77.3 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 25/97 (25%), Positives = 44/97 (45%)

Query: 2   LSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVID 61
           L +     LV   I I    ++++K+     S     + LI  GA+GN +D      V+D
Sbjct: 54  LQDSRLFFLVVTVIFIAILTYYLFKQKNTLSSFDKGTFALIYGGAIGNFIDRLTRHEVVD 113

Query: 62  YIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
           ++      + F +FNLAD FI +G   +++      +
Sbjct: 114 FLDFRIFGYDFPIFNLADCFICVGVIFLLFKIYKEDN 150


>gi|38234159|ref|NP_939926.1| putative lipoprotein signal peptidase [Corynebacterium diphtheriae
           NCTC 13129]
 gi|38200421|emb|CAE50109.1| Putative lipoprotein signal peptidase [Corynebacterium diphtheriae]
          Length = 174

 Score = 77.3 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 26/104 (25%), Positives = 50/104 (48%), Gaps = 12/104 (11%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLY------GYV 59
           +  +   I+++ +  I    +K         +G  LI  GALGN++D          G+V
Sbjct: 77  ATWVFTCIQLIFVIGIVATMRKIK--DPWQAVGLALIAGGALGNLIDRLFRAPAFFIGHV 134

Query: 60  IDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGK 103
           +D+I +     +FAVFN+AD  IS G  +++   ++   ++  +
Sbjct: 135 VDFISVG----NFAVFNVADSAISCGVVLVVIAMLLEGRKEGKE 174


>gi|307704905|ref|ZP_07641796.1| signal peptidase II [Streptococcus mitis SK597]
 gi|307621519|gb|EFO00565.1| signal peptidase II [Streptococcus mitis SK597]
          Length = 153

 Score = 77.3 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 22/92 (23%), Positives = 45/92 (48%), Gaps = 2/92 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
              +   I ++++    +   K+ +      +G  LI  G LGN +D    G+V+D    
Sbjct: 60  QQFLFAIITLVVVVGAIWYLHKHMEDSFWLVLGLTLIIAGGLGNFIDRVSQGFVVDM--F 117

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQ 97
           H    +FA+FN+AD ++++G  I++   +  +
Sbjct: 118 HLDFINFAIFNVADSYLTVGVIILLIAMLKEE 149


>gi|315185518|gb|EFU19288.1| lipoprotein signal peptidase [Spirochaeta thermophila DSM 6578]
          Length = 178

 Score = 77.3 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 18/109 (16%), Positives = 45/109 (41%), Gaps = 5/109 (4%)

Query: 5   VSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGY-VIDYI 63
           V   + + + ++++  I   + ++ +  S+       I  G +G ++D       V+D+I
Sbjct: 68  VRIFLFLFVPVVLLVGILVYFFRSDELSSLQRWALAGILGGGVGTLIDRFFRDAGVVDFI 127

Query: 64  MIHTQTW----SFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDFPQ 108
            +          +  FN+AD  I + + +++    I   +   + D  Q
Sbjct: 128 DVKFFGIFGLERWPTFNIADASIVVCSLLLLISFFIEMRKDSKERDHEQ 176


>gi|294084712|ref|YP_003551470.1| lipoprotein signal peptidase [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292664285|gb|ADE39386.1| Lipoprotein signal peptidase [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 167

 Score = 77.3 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 25/101 (24%), Positives = 45/101 (44%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           +L++    +   + +L +    +          I       I  GA+GN +D   +G V+
Sbjct: 66  LLADGGMIVRFGLAVLALLVAIWFLWSATSLTRIQRYAGGAIVGGAIGNAIDRLRFGQVV 125

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQK 101
           D+I +H   W +  FN+AD+ ISIG  + I      Q  ++
Sbjct: 126 DFIDLHVAGWHWPAFNVADITISIGAVLWIVSLFFEQENKE 166


>gi|317495212|ref|ZP_07953582.1| signal peptidase II [Gemella moribillum M424]
 gi|316914634|gb|EFV36110.1| signal peptidase II [Gemella moribillum M424]
          Length = 150

 Score = 77.3 bits (190), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 45/94 (47%), Gaps = 1/94 (1%)

Query: 6   SPTILVSIRILIIAFIFFIWK-KNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIM 64
           S    +++ +L +A + +    +         + + LI  GA+GN +D  +   V+D++ 
Sbjct: 57  SRLFFLAVTVLFLAILLYYVYNRKNILTKFDILTFSLIMGGAIGNFIDRLIRHEVVDFLD 116

Query: 65  IHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
               ++ F +FNLAD +I IG   ++      ++
Sbjct: 117 FRIFSYDFPIFNLADCYICIGVVFLLIKIYKEEN 150


>gi|256377922|ref|YP_003101582.1| lipoprotein signal peptidase [Actinosynnema mirum DSM 43827]
 gi|255922225|gb|ACU37736.1| lipoprotein signal peptidase [Actinosynnema mirum DSM 43827]
          Length = 178

 Score = 77.3 bits (190), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 25/87 (28%), Positives = 39/87 (44%), Gaps = 5/87 (5%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKN-PKTKSIFDIGYILITTGALGNVVDHCLYGYV 59
           + S++   ++  +  LI   +     +  P T     +   L+  GA+GN+VD    G V
Sbjct: 62  LGSSLPAWVVTVVTALITLGVALYAHRTAPTTPRWGRVALALVLGGAVGNLVDRAFDGAV 121

Query: 60  IDYIMIHTQTWSFAVFNLADLFISIGT 86
            DY         FA FN+AD+ IS G 
Sbjct: 122 TDYFHTGW----FATFNVADVLISAGA 144


>gi|160914263|ref|ZP_02076484.1| hypothetical protein EUBDOL_00273 [Eubacterium dolichum DSM 3991]
 gi|158433890|gb|EDP12179.1| hypothetical protein EUBDOL_00273 [Eubacterium dolichum DSM 3991]
          Length = 152

 Score = 77.3 bits (190), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 23/89 (25%), Positives = 43/89 (48%)

Query: 9   ILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQ 68
               I I+ +  + + ++ +    +   +G IL+  GA+GN +D     YV D+      
Sbjct: 55  FFYLITIVFLIAMVYFYRTSEDADTFTKLGMILMMAGAVGNFIDRLALQYVRDFFDFLLL 114

Query: 69  TWSFAVFNLADLFISIGTCIIIYDDIILQ 97
            ++F VFN+AD+ + IG  +II    +  
Sbjct: 115 GYNFPVFNIADISLCIGVALIILSVFLES 143


>gi|78043389|ref|YP_360338.1| signal peptidase II [Carboxydothermus hydrogenoformans Z-2901]
 gi|77995504|gb|ABB14403.1| signal peptidase II [Carboxydothermus hydrogenoformans Z-2901]
          Length = 144

 Score = 77.3 bits (190), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 27/93 (29%), Positives = 39/93 (41%), Gaps = 4/93 (4%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
              I + I I +++ I                   LI  GALGN  D    G V D++  
Sbjct: 56  QRGIFILITIFVLSGILIYLVTTGNRNRFLLTSLALIFGGALGNFYDRLTQGQVTDFLDF 115

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQH 98
           H     + VFNLAD FI+IG  +  Y  ++ + 
Sbjct: 116 HF----WPVFNLADSFITIGLLLFTYQFLLKKE 144


>gi|220909556|ref|YP_002484867.1| lipoprotein signal peptidase [Cyanothece sp. PCC 7425]
 gi|254810442|sp|B8HXG1|LSPA_CYAP4 RecName: Full=Lipoprotein signal peptidase; AltName:
           Full=Prolipoprotein signal peptidase; AltName:
           Full=Signal peptidase II; Short=SPase II
 gi|219866167|gb|ACL46506.1| lipoprotein signal peptidase [Cyanothece sp. PCC 7425]
          Length = 173

 Score = 77.3 bits (190), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 25/110 (22%), Positives = 46/110 (41%), Gaps = 6/110 (5%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           + S      L  + + +   +  +    P        GY  +  GA GN +D  + G V+
Sbjct: 60  LFSQGGEW-LRWLSLGVSVGLMALAILGPNFNRWEQAGYGFLLGGAAGNGIDRFVAGRVV 118

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDD---IILQHRQKGKIDFP 107
           D++        F +FNLAD+FI+IG   ++      +  + R + +   P
Sbjct: 119 DFLDFRLIG--FPIFNLADVFINIGIICLLIAAWGPLPSRRRAERRPSSP 166


>gi|291528978|emb|CBK94564.1| lipoprotein signal peptidase [Eubacterium rectale M104/1]
          Length = 201

 Score = 77.3 bits (190), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 47/94 (50%), Gaps = 4/94 (4%)

Query: 9   ILVSIRILIIAFIFFIWKKNP--KTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIH 66
               I I ++  +   ++K P  K   + ++  IL   GALGN++D  +  YV+D+   +
Sbjct: 93  FFSVITIAVVILLCVWYRKIPVSKRFRLLNVVVILFVAGALGNLIDRIVNNYVVDF--FY 150

Query: 67  TQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
               +F +FN+AD+++++   + I   +     +
Sbjct: 151 FSLINFPIFNVADIYVTVAAFMFIILGLFYYKEE 184


>gi|300858800|ref|YP_003783783.1| hypothetical protein cpfrc_01383 [Corynebacterium
           pseudotuberculosis FRC41]
 gi|300686254|gb|ADK29176.1| putative membrane protein [Corynebacterium pseudotuberculosis
           FRC41]
 gi|302206505|gb|ADL10847.1| Putative lipoprotein signal peptidase [Corynebacterium
           pseudotuberculosis C231]
 gi|302331060|gb|ADL21254.1| Putative lipoprotein signal peptidase [Corynebacterium
           pseudotuberculosis 1002]
 gi|308276747|gb|ADO26646.1| Lipoprotein signal peptidase [Corynebacterium pseudotuberculosis
           I19]
          Length = 186

 Score = 77.3 bits (190), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 26/104 (25%), Positives = 45/104 (43%), Gaps = 12/104 (11%)

Query: 2   LSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYG---- 57
               +  +  SI+++ +  I +   K         +   +I  GALGN++D         
Sbjct: 73  FGENATWLFTSIQLIFVVGIAWYAPKVR--DGWTAVALAMIAGGALGNLIDRLFREPAFF 130

Query: 58  --YVIDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
             +V+D+I I     +FAVFN+AD  I+ G  I     ++   R
Sbjct: 131 VGHVVDFISIG----NFAVFNVADSAITCGVAIFFVAILLESRR 170


>gi|289167774|ref|YP_003446043.1| lipoprotein signal peptidase, signal peptidase type II
           [Streptococcus mitis B6]
 gi|288907341|emb|CBJ22178.1| lipoprotein signal peptidase, signal peptidase type II
           [Streptococcus mitis B6]
          Length = 153

 Score = 77.3 bits (190), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 45/92 (48%), Gaps = 2/92 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
              +   I +L++    +   K+ +      +G  LI  G LGN +D    G+V+D    
Sbjct: 60  QQLLFAIITLLVVVGAIWYLHKHMEDSLWMVLGLTLIIAGGLGNFIDRISQGFVVDM--F 117

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQ 97
           H    +FA+FN+AD ++++G  I++   +  +
Sbjct: 118 HLDFINFAIFNVADSYLTVGVIILLIAMLKEE 149


>gi|171912970|ref|ZP_02928440.1| lipoprotein signal peptidase [Verrucomicrobium spinosum DSM 4136]
          Length = 166

 Score = 77.3 bits (190), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 22/103 (21%), Positives = 41/103 (39%), Gaps = 3/103 (2%)

Query: 5   VSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIM 64
            S  I   I ++ + F  + ++K      +  +   LI  G  GN  D  +Y +V+D++ 
Sbjct: 61  YSNYIFGGIALVALGFFIWAYRKGFFPGLLNRVAIALIVAGVCGNFTDRLIYHHVVDFLS 120

Query: 65  IHTQT---WSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI 104
                     +  FN+AD  + I  C++          +K K 
Sbjct: 121 FDLHLPMASPWPSFNVADSCVVIAACLLASGVFRADPSEKDKQ 163


>gi|209886348|ref|YP_002290205.1| signal peptidase II [Oligotropha carboxidovorans OM5]
 gi|209874544|gb|ACI94340.1| signal peptidase II [Oligotropha carboxidovorans OM5]
          Length = 166

 Score = 77.3 bits (190), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 30/97 (30%), Positives = 49/97 (50%), Gaps = 7/97 (7%)

Query: 3   SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDY 62
           S     +L+   I +I    ++   +     +  IG  LI  GA+GN +D   YG V+D+
Sbjct: 64  SFGQTLLLMGKIIAVILLGVWM---SRSQTRLAVIGLGLIIGGAIGNAIDRIAYGAVVDF 120

Query: 63  IMIHT----QTWSFAVFNLADLFISIGTCIIIYDDII 95
            + H     +T+S+ VFNLAD  I  G   ++YD ++
Sbjct: 121 ALFHIAIGGKTYSWYVFNLADAAIVAGVAALLYDSLV 157


>gi|307708570|ref|ZP_07645034.1| signal peptidase II [Streptococcus mitis NCTC 12261]
 gi|307709118|ref|ZP_07645577.1| signal peptidase II [Streptococcus mitis SK564]
 gi|307615319|gb|EFN94528.1| signal peptidase II [Streptococcus mitis NCTC 12261]
 gi|307620064|gb|EFN99181.1| signal peptidase II [Streptococcus mitis SK564]
          Length = 153

 Score = 77.3 bits (190), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 22/92 (23%), Positives = 45/92 (48%), Gaps = 2/92 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
              +   I ++++    +   K+ +      +G  LI  G LGN +D    G+V+D    
Sbjct: 60  QQLLFAVITLVVVVGAIWYLHKHMEDSFWMVLGLTLIIAGGLGNFIDRVSQGFVVDM--F 117

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQ 97
           H    +FA+FN+AD ++++G  I++   +  +
Sbjct: 118 HLDFINFAIFNVADSYLTVGVIILLIAMLKEE 149


>gi|153853143|ref|ZP_01994552.1| hypothetical protein DORLON_00537 [Dorea longicatena DSM 13814]
 gi|149753929|gb|EDM63860.1| hypothetical protein DORLON_00537 [Dorea longicatena DSM 13814]
          Length = 168

 Score = 77.3 bits (190), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 21/96 (21%), Positives = 45/96 (46%), Gaps = 4/96 (4%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIF--DIGYILITTGALGNVVDHCLYGYVIDYI 63
                    +LI   + + + K P         I  +LI +GA GN +D     YV+D++
Sbjct: 67  QRIFFYISVLLITIAVIWFYHKVPIEHKYLPLRICAVLILSGAFGNCIDRIRLNYVVDFL 126

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
             + +  +F +FN+AD+++++   +++   +I    
Sbjct: 127 --YFKLINFPIFNVADIYVTVAAFLLVILILIYYKE 160


>gi|168182404|ref|ZP_02617068.1| signal peptidase II [Clostridium botulinum Bf]
 gi|237794813|ref|YP_002862365.1| lipoprotein signal peptidase [Clostridium botulinum Ba4 str. 657]
 gi|182674429|gb|EDT86390.1| signal peptidase II [Clostridium botulinum Bf]
 gi|229261895|gb|ACQ52928.1| signal peptidase II [Clostridium botulinum Ba4 str. 657]
          Length = 147

 Score = 77.0 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 27/90 (30%), Positives = 49/90 (54%), Gaps = 1/90 (1%)

Query: 9   ILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQ 68
            L  I  ++I  + +   K   T  +  I   LI +GA+GN++D   Y +V+D+IM+H +
Sbjct: 58  FLSLITAIVILGVVYFIVKYKPTSKLLKISLSLIISGAIGNLIDRIYYKFVVDFIMLHYK 117

Query: 69  T-WSFAVFNLADLFISIGTCIIIYDDIILQ 97
             + F  FN+AD+ + IGT ++    +  +
Sbjct: 118 DVYYFPTFNVADMLVVIGTVLLAIYILKEE 147


>gi|169831111|ref|YP_001717093.1| lipoprotein signal peptidase [Candidatus Desulforudis audaxviator
           MP104C]
 gi|169637955|gb|ACA59461.1| lipoprotein signal peptidase [Candidatus Desulforudis audaxviator
           MP104C]
          Length = 153

 Score = 77.0 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 24/102 (23%), Positives = 45/102 (44%), Gaps = 6/102 (5%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
              P +++   +L    +     +  +    + +   L+  GALGN+ D   YG V+D+I
Sbjct: 55  GGQPVLVLGFTLLAAVVVLAFLPRIIRAG--YGLPVGLLFGGALGNLADRLRYGRVLDFI 112

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
                   + VFNLAD+ I+ G  ++    +  +   +G  D
Sbjct: 113 DFGF----WPVFNLADVAITAGAVLLGAHVLWHERSHRGGQD 150


>gi|309811345|ref|ZP_07705132.1| signal peptidase II [Dermacoccus sp. Ellin185]
 gi|308434652|gb|EFP58497.1| signal peptidase II [Dermacoccus sp. Ellin185]
          Length = 173

 Score = 77.0 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 26/109 (23%), Positives = 44/109 (40%), Gaps = 5/109 (4%)

Query: 1   MLSNVSPTILVSIRILI-IAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYV 59
           M   +   ++V+I   I +AF+ + W + P+   +  I    +  GA+ NV D    G V
Sbjct: 65  MGDKLPAGVVVAITAAISVAFVLYAWHRAPRAGRMEQIAGGAVIGGAVANVADRARDGMV 124

Query: 60  IDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDFPQ 108
            DY+        +  FNLAD F+  G  +I             + +   
Sbjct: 125 TDYLHTGW----WPTFNLADTFLVTGCVVIALVHARPGRAADDEKEQRH 169


>gi|313884261|ref|ZP_07818027.1| signal peptidase II [Eremococcus coleocola ACS-139-V-Col8]
 gi|312620708|gb|EFR32131.1| signal peptidase II [Eremococcus coleocola ACS-139-V-Col8]
          Length = 152

 Score = 77.0 bits (189), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 22/99 (22%), Positives = 44/99 (44%), Gaps = 3/99 (3%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           +      T  +   +L+  +  ++  K+ K      I Y L+  GA+GN++D    GYV+
Sbjct: 53  LFQG-QMTFFMFATLLVCIYFIYLTYKHRKGPWYLRISYGLLLGGAIGNLIDRLRLGYVV 111

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
           D     T    F +FN+AD  +++    ++   +  +  
Sbjct: 112 DM--FRTLFIEFPIFNIADAALTLAVISLLIIQLFSKEE 148


>gi|294848189|ref|ZP_06788936.1| signal peptidase II [Staphylococcus aureus A9754]
 gi|294824989|gb|EFG41411.1| signal peptidase II [Staphylococcus aureus A9754]
          Length = 163

 Score = 77.0 bits (189), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 24/84 (28%), Positives = 43/84 (51%)

Query: 20  FIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQTWSFAVFNLAD 79
            + + + K+ +      +   L+  GALGN +D  L G V+D+I  +   + F +FN+AD
Sbjct: 77  ALVYFFIKDAQYNLFMQVAISLLFAGALGNFIDRILTGEVVDFIDTNIFGYDFPIFNIAD 136

Query: 80  LFISIGTCIIIYDDIILQHRQKGK 103
             ++IG  +II   +     +K K
Sbjct: 137 SSLTIGVILIIIALLKDTSNKKEK 160


>gi|291524837|emb|CBK90424.1| lipoprotein signal peptidase [Eubacterium rectale DSM 17629]
          Length = 201

 Score = 77.0 bits (189), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 47/94 (50%), Gaps = 4/94 (4%)

Query: 9   ILVSIRILIIAFIFFIWKKNP--KTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIH 66
               I I ++  +   ++K P  K   + ++  IL   GALGN++D  +  YV+D+   +
Sbjct: 93  FFSVITIAVVILLCVWYRKIPVSKRFRLLNVVVILFVAGALGNLIDRIVNNYVVDF--FY 150

Query: 67  TQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
               +F +FN+AD+++++   + I   +     +
Sbjct: 151 FSLINFPIFNVADIYVTVAAFMFIILGLFYYKEE 184


>gi|227529324|ref|ZP_03959373.1| signal peptidase II [Lactobacillus vaginalis ATCC 49540]
 gi|227350752|gb|EEJ41043.1| signal peptidase II [Lactobacillus vaginalis ATCC 49540]
          Length = 150

 Score = 77.0 bits (189), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 25/100 (25%), Positives = 46/100 (46%), Gaps = 4/100 (4%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           M           + +++IA I + + +      I  +   LI  GA+GN +D  L GYV+
Sbjct: 55  MFQG-QQLFFSIVTVVVIAGIGYCFWRFRHRHPIL-LCLSLILAGAIGNFIDRLLQGYVV 112

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQ 100
           D         +F VFN+AD+ +++G  ++I   +     +
Sbjct: 113 DMFEF--LPVNFPVFNIADMCLTLGVIMLIIIVLREDDEK 150


>gi|255280912|ref|ZP_05345467.1| signal peptidase II [Bryantella formatexigens DSM 14469]
 gi|255268360|gb|EET61565.1| signal peptidase II [Bryantella formatexigens DSM 14469]
          Length = 167

 Score = 77.0 bits (189), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 23/93 (24%), Positives = 46/93 (49%), Gaps = 5/93 (5%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGY--ILITTGALGNVVDHCLYGY 58
           M   +   + + +  LIIA + ++W K P  +          +   GA+GN +D    GY
Sbjct: 64  MFGGMQ-WVFLLLTALIIAGVCYLWHKVPFERKYRAFRILSAIFLAGAVGNAIDRLFRGY 122

Query: 59  VIDYIMIHTQTWSFAVFNLADLFISIGTCIIIY 91
           V+D+   +    +F VFN+AD ++++   +++ 
Sbjct: 123 VVDF--FYFSLINFPVFNVADCYVTVSLVLLLI 153


>gi|295698743|ref|YP_003603398.1| signal peptidase II [Candidatus Riesia pediculicola USDA]
 gi|291157300|gb|ADD79745.1| signal peptidase II [Candidatus Riesia pediculicola USDA]
          Length = 172

 Score = 77.0 bits (189), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 24/90 (26%), Positives = 40/90 (44%)

Query: 8   TILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHT 67
             L+    L+  ++               + Y +I  GA GN++D  +YGY+ID+I +H 
Sbjct: 73  YFLIFFVGLLTLYVLIFLISVGYNDKDRYLCYFMILAGAFGNLIDRLIYGYIIDFIDLHV 132

Query: 68  QTWSFAVFNLADLFISIGTCIIIYDDIILQ 97
             + F  FN AD  I +G   +I      +
Sbjct: 133 GRYHFPTFNTADFSIFLGEIFLILRIFFKK 162


>gi|307706434|ref|ZP_07643243.1| signal peptidase II [Streptococcus mitis SK321]
 gi|307618144|gb|EFN97302.1| signal peptidase II [Streptococcus mitis SK321]
          Length = 147

 Score = 77.0 bits (189), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 22/92 (23%), Positives = 45/92 (48%), Gaps = 2/92 (2%)

Query: 6   SPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMI 65
              +   I ++++    +   K+ +      +G  LI  G LGN +D    G+V+D    
Sbjct: 54  QQWLFAIITLVVMVGAIWYLHKHIEDSLWMVLGLTLIIAGGLGNFIDRISQGFVVDM--F 111

Query: 66  HTQTWSFAVFNLADLFISIGTCIIIYDDIILQ 97
           H    +FA+FN+AD ++++G  I++   +  +
Sbjct: 112 HLDFINFAIFNVADSYLTVGVIILLIAMLKEE 143


>gi|33867153|ref|NP_898711.1| putative lipoprotein signal peptidase [Rhodococcus erythropolis]
 gi|33668987|gb|AAP73981.1| putative lipoprotein signal peptidase [Rhodococcus erythropolis]
          Length = 184

 Score = 77.0 bits (189), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 25/98 (25%), Positives = 48/98 (48%), Gaps = 5/98 (5%)

Query: 1   MLSNVSPTILVSIRILIIAFI-FFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYV 59
           + + +   ++++   L    I  + W+  P+++ +  IG+ LI  GA  NVVD  L G V
Sbjct: 77  LGNQLPSAVIIAFTALATIGIAVYAWRSVPQSRGVAVIGFALIVAGAASNVVDRALDGKV 136

Query: 60  IDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQ 97
            DY         +  FNLAD +++ G  +++   ++  
Sbjct: 137 TDYFHTGW----WPTFNLADTYLTCGFILVVVSLLVES 170


>gi|227543152|ref|ZP_03973201.1| signal peptidase II [Corynebacterium glucuronolyticum ATCC 51866]
 gi|227180961|gb|EEI61933.1| signal peptidase II [Corynebacterium glucuronolyticum ATCC 51866]
          Length = 198

 Score = 77.0 bits (189), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 29/107 (27%), Positives = 52/107 (48%), Gaps = 13/107 (12%)

Query: 6   SPTILVSIRIL-IIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLY------GY 58
           +  +  +I+++ I+A   +   +         IG  LI  GALGNV+D          G+
Sbjct: 65  ATWVFTTIQLVFIVAVFTYFLPRLTSN--WTAIGVALIAGGALGNVIDRLFRAPGFFIGH 122

Query: 59  VIDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKID 105
           V+D+I +     SFA+FN+AD  I++G  I I   ++ +   + +  
Sbjct: 123 VVDFISVG----SFAIFNIADSAITVGVVIFIIGVLLEEQGAEEEKS 165


>gi|56752374|ref|YP_173075.1| lipoprotein signal peptidase [Synechococcus elongatus PCC 6301]
 gi|81300535|ref|YP_400743.1| lipoprotein signal peptidase [Synechococcus elongatus PCC 7942]
 gi|56687333|dbj|BAD80555.1| lipoprotein signal peptidase [Synechococcus elongatus PCC 6301]
 gi|81169416|gb|ABB57756.1| signal peptidase II. Aspartic peptidase. MEROPS family A08
           [Synechococcus elongatus PCC 7942]
          Length = 163

 Score = 77.0 bits (189), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 25/94 (26%), Positives = 41/94 (43%), Gaps = 3/94 (3%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           + S  S   L  +  L+   +       P+      +GY  I  GA GN +D    G V+
Sbjct: 58  LFSGGSSW-LRWLSFLVCFGLAIWAWFGPRMTRSEQLGYGFIFAGAFGNGLDRFYDGSVV 116

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDI 94
           D++        F VFN+AD+ I++G   +I   +
Sbjct: 117 DFLDFRLIL--FPVFNIADVLINLGVACLIISFL 148


>gi|332654862|ref|ZP_08420604.1| signal peptidase II [Ruminococcaceae bacterium D16]
 gi|332516205|gb|EGJ45813.1| signal peptidase II [Ruminococcaceae bacterium D16]
          Length = 216

 Score = 77.0 bits (189), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 25/96 (26%), Positives = 44/96 (45%), Gaps = 2/96 (2%)

Query: 4   NVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYI 63
           N    IL  I +++   +     K      +  +   L+  GA+GN++D  L GYV+D  
Sbjct: 112 NEHTWILTLISLVMSVILAVALVKKFFRHPLGRVCLALLLAGAVGNLIDRALQGYVVDMF 171

Query: 64  MIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHR 99
            +      FAVFN+AD+ + +G        ++L  +
Sbjct: 172 NVLFMN--FAVFNVADICVVVGGIGAALYYLLLWDK 205


>gi|323442287|gb|EGA99917.1| lipoprotein signal peptidase [Staphylococcus aureus O46]
          Length = 163

 Score = 77.0 bits (189), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 24/84 (28%), Positives = 43/84 (51%)

Query: 20  FIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQTWSFAVFNLAD 79
            + + + K+ +      +   L+  GALGN +D  L G V+D+I  +   + F +FN+AD
Sbjct: 77  ALVYFFIKDAQYNLFMQVAISLLFAGALGNFIDRVLTGEVVDFIDTNIFGYDFPIFNIAD 136

Query: 80  LFISIGTCIIIYDDIILQHRQKGK 103
             ++IG  +II   +     +K K
Sbjct: 137 SSLTIGV