RPSBLAST alignment for GI: 254780749 and conserved domain: PRK14777

>gnl|CDD|173238 PRK14777, PRK14777, lipoprotein signal peptidase; Provisional. Length = 184
 Score = 39.1 bits (91), Expect = 2e-04
 Identities = 25/93 (26%), Positives = 46/93 (49%), Gaps = 19/93 (20%)

Query: 9   ILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQ 68
           +LV + +L+    + + +  P+      +   LI  GA+GN +D   +G V D  M+H+ 
Sbjct: 92  LLVGLGLLV----YLLRRPQPR---FLTVVLSLIAAGAIGNAIDGLRFGRVTD--MLHSP 142

Query: 69  TWS----------FAVFNLADLFISIGTCIIIY 91
             S          F +FNLAD+ +  GT ++++
Sbjct: 143 ALSAVTRALGQGDFPIFNLADMCVVGGTLLLLF 175