HHsearch alignment for GI: 254780750 and conserved domain: TIGR03420

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members of this protein family are Hda (Homologous to DnaA). These proteins are about half the length of DnaA and homologous over length of Hda. In the model species Escherichia coli, the initiation of DNA replication requires DnaA bound to ATP rather than ADP; Hda helps facilitate the conversion of DnaA-ATP to DnaA-ADP.
Probab=92.37  E-value=0.84  Score=24.44  Aligned_cols=96  Identities=16%  Similarity=0.187  Sum_probs=52.4

Q ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHCCC
Q ss_conf             43999967784407899999999999997198530353206822105676523766113853289999999999995899
Q gi|254780750|r  650 GKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFSRVGSADNLASGRSTFMVEMIETASILNQATN  729 (920)
Q Consensus       650 ~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D~IftRiGa~D~l~~g~STF~vEm~e~~~IL~~at~  729 (920)
T Consensus        38 ~~~l~i~G~~GsGKTHLl~a~~~-~~~~~-~~------------~~~yl~----------~~~~~~~~~---~~l~~l~~   90 (226)
T TIGR03420        38 DRFLYLWGESGSGKSHLLQAACA-AAEER-GK------------SAIYLP----------LAELAQADP---EVLEGLEQ   90 (226)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHH-HHHCC-CC------------CEEEEC----------HHHHHHHHH---HHHHHCCC
T ss_conf             88699989999988999999999-98626-99------------579952----------999877539---99972744


Q ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCH
Q ss_conf             85699932588988056799999999999972698499974875
Q gi|254780750|r  730 QSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFH  773 (920)
Q Consensus       730 ~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~  773 (920)
T Consensus        91 ~d~l~iDDi~~i~~~~~~e~~lF~l~N~~~~~-~~~ilits~~~  133 (226)
T TIGR03420        91 ADLVCLDDVEAIAGQPEWQEALFHLYNRVREA-GGRLLIAGRAA  133 (226)
T ss_pred             CCEEEEECHHHHCCCHHHHHHHHHHHHHHHHH-CCEEEEECCCC
T ss_conf             89999966333437837899999999999865-28289867888